--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:55:22 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0863/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -430.40 -434.57
2 -430.43 -434.64
--------------------------------------
TOTAL -430.42 -434.61
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898057 0.085546 0.373533 1.494165 0.872634 1414.44 1417.90 1.000
r(A<->C){all} 0.164647 0.020483 0.000009 0.457360 0.124975 168.84 240.13 1.000
r(A<->G){all} 0.170645 0.020166 0.000029 0.454171 0.133734 146.71 298.25 1.000
r(A<->T){all} 0.167341 0.019660 0.000014 0.445043 0.133204 131.94 165.49 1.000
r(C<->G){all} 0.173780 0.022020 0.000057 0.482937 0.134858 182.50 284.53 1.000
r(C<->T){all} 0.161486 0.019081 0.000030 0.444810 0.124160 193.09 205.86 1.000
r(G<->T){all} 0.162101 0.019908 0.000010 0.448968 0.123590 124.61 140.49 1.001
pi(A){all} 0.211467 0.000544 0.170456 0.261589 0.210616 1337.33 1419.17 1.001
pi(C){all} 0.265974 0.000631 0.217383 0.315793 0.265158 1384.02 1442.51 1.003
pi(G){all} 0.307362 0.000670 0.254292 0.354757 0.306607 1395.90 1411.16 1.000
pi(T){all} 0.215197 0.000543 0.169675 0.258638 0.214946 1391.83 1446.41 1.000
alpha{1,2} 0.419209 0.228001 0.000136 1.357038 0.252272 1292.78 1365.22 1.002
alpha{3} 0.445222 0.228323 0.000347 1.407039 0.283034 1416.62 1438.15 1.000
pinvar{all} 0.994697 0.000042 0.982536 0.999995 0.996750 1361.37 1379.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -413.152117
Model 2: PositiveSelection -413.152092
Model 0: one-ratio -413.152107
Model 7: beta -413.152118
Model 8: beta&w>1 -413.1521
Model 0 vs 1 1.9999999949504854E-5
Model 2 vs 1 4.999999998744897E-5
Model 8 vs 7 3.599999990910874E-5
>C1
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
>C2
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
>C3
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
>C4
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
>C5
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
>C6
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=104
C1 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
C2 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
C3 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
C4 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
C5 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
C6 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
**************************************************
C1 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
C2 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
C3 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
C4 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
C5 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
C6 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
**************************************************
C1 RRSG
C2 RRSG
C3 RRSG
C4 RRSG
C5 RRSG
C6 RRSG
****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3120]--->[3120]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.455 Mb, Max= 30.629 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
C2 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
C3 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
C4 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
C5 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
C6 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
**************************************************
C1 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
C2 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
C3 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
C4 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
C5 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
C6 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
**************************************************
C1 RRSG
C2 RRSG
C3 RRSG
C4 RRSG
C5 RRSG
C6 RRSG
****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
C2 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
C3 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
C4 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
C5 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
C6 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
**************************************************
C1 GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
C2 GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
C3 GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
C4 GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
C5 GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
C6 GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
**************************************************
C1 CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
C2 CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
C3 CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
C4 CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
C5 CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
C6 CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
**************************************************
C1 CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
C2 CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
C3 CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
C4 CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
C5 CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
C6 CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
**************************************************
C1 GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
C2 GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
C3 GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
C4 GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
C5 GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
C6 GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
**************************************************
C1 TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
C2 TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
C3 TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
C4 TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
C5 TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
C6 TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
**************************************************
C1 AGACGATCCGGC
C2 AGACGATCCGGC
C3 AGACGATCCGGC
C4 AGACGATCCGGC
C5 AGACGATCCGGC
C6 AGACGATCCGGC
************
>C1
GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
AGACGATCCGGC
>C2
GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
AGACGATCCGGC
>C3
GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
AGACGATCCGGC
>C4
GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
AGACGATCCGGC
>C5
GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
AGACGATCCGGC
>C6
GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG
GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG
CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC
CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT
GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG
TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG
AGACGATCCGGC
>C1
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
>C2
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
>C3
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
>C4
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
>C5
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
>C6
VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
RRSG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 312 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579798437
Setting output file names to "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 212111969
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0195931620
Seed = 843460480
Swapseed = 1579798437
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -698.270957 -- -24.965149
Chain 2 -- -698.270917 -- -24.965149
Chain 3 -- -698.270957 -- -24.965149
Chain 4 -- -698.270957 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -698.270957 -- -24.965149
Chain 2 -- -698.270851 -- -24.965149
Chain 3 -- -698.270957 -- -24.965149
Chain 4 -- -698.270957 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-698.271] (-698.271) (-698.271) (-698.271) * [-698.271] (-698.271) (-698.271) (-698.271)
500 -- [-436.987] (-439.656) (-442.558) (-445.192) * (-436.456) (-439.601) (-440.914) [-441.519] -- 0:00:00
1000 -- (-441.319) (-441.964) [-434.852] (-443.661) * [-439.101] (-435.906) (-442.350) (-446.248) -- 0:00:00
1500 -- (-434.488) [-434.791] (-443.432) (-443.208) * [-434.552] (-446.403) (-445.039) (-435.864) -- 0:00:00
2000 -- (-440.598) [-436.692] (-443.122) (-437.468) * (-440.352) (-437.954) [-441.366] (-457.978) -- 0:00:00
2500 -- (-433.977) (-444.441) [-439.989] (-438.660) * (-442.428) (-443.270) (-440.686) [-438.022] -- 0:00:00
3000 -- (-439.308) [-436.916] (-440.729) (-441.469) * (-443.436) [-448.175] (-439.093) (-444.854) -- 0:00:00
3500 -- (-443.163) [-441.804] (-443.166) (-438.429) * (-436.662) (-436.998) [-433.795] (-441.219) -- 0:00:00
4000 -- (-450.763) [-438.419] (-453.056) (-440.296) * [-442.118] (-437.845) (-439.824) (-438.741) -- 0:00:00
4500 -- (-441.940) [-445.288] (-432.568) (-437.099) * (-442.849) [-436.456] (-437.998) (-441.059) -- 0:00:00
5000 -- (-441.777) (-445.185) (-433.665) [-436.966] * (-443.830) (-444.743) (-438.858) [-442.461] -- 0:00:00
Average standard deviation of split frequencies: 0.067344
5500 -- (-439.043) (-437.489) (-430.289) [-441.889] * [-443.466] (-440.114) (-443.322) (-443.022) -- 0:00:00
6000 -- (-440.698) (-435.881) (-430.527) [-435.405] * [-440.557] (-437.625) (-438.792) (-448.064) -- 0:00:00
6500 -- (-442.839) (-458.012) (-432.637) [-439.334] * (-441.333) [-440.542] (-441.521) (-437.590) -- 0:00:00
7000 -- (-440.155) (-447.319) [-432.583] (-437.482) * [-443.603] (-446.418) (-435.704) (-447.188) -- 0:00:00
7500 -- [-439.993] (-437.340) (-435.752) (-439.106) * (-446.742) [-439.671] (-440.246) (-436.245) -- 0:00:00
8000 -- (-441.388) (-440.966) [-430.355] (-440.968) * (-439.629) (-444.348) (-445.257) [-440.050] -- 0:00:00
8500 -- (-443.551) [-437.070] (-431.999) (-438.113) * (-441.073) (-433.211) (-443.557) [-435.922] -- 0:00:00
9000 -- (-437.580) (-441.720) (-435.917) [-439.583] * [-439.004] (-440.436) (-442.559) (-445.911) -- 0:00:00
9500 -- (-438.569) (-445.763) [-435.031] (-439.579) * [-435.347] (-446.443) (-446.773) (-438.060) -- 0:00:00
10000 -- (-438.637) [-440.164] (-430.955) (-442.811) * (-441.996) (-438.965) (-435.823) [-443.865] -- 0:00:00
Average standard deviation of split frequencies: 0.082075
10500 -- (-443.193) (-445.113) (-430.033) [-443.949] * [-437.343] (-433.987) (-435.643) (-440.558) -- 0:00:00
11000 -- (-438.828) (-438.942) (-433.585) [-442.354] * (-439.771) (-430.010) [-442.802] (-439.122) -- 0:00:00
11500 -- (-439.476) (-444.060) (-430.956) [-434.941] * (-440.134) [-429.701] (-445.816) (-444.856) -- 0:00:00
12000 -- (-441.370) (-440.947) (-431.346) [-437.526] * (-441.329) [-430.267] (-440.124) (-436.641) -- 0:00:00
12500 -- [-444.412] (-435.319) (-433.692) (-439.560) * (-440.631) (-431.528) [-434.884] (-438.392) -- 0:00:00
13000 -- [-439.899] (-441.832) (-428.882) (-440.558) * (-444.478) (-431.462) [-442.306] (-446.221) -- 0:00:00
13500 -- (-440.972) [-445.331] (-430.010) (-439.715) * (-448.306) (-431.508) [-440.616] (-452.250) -- 0:00:00
14000 -- (-440.873) (-437.519) (-432.296) [-445.170] * (-443.626) (-430.001) (-439.130) [-444.220] -- 0:00:00
14500 -- (-448.343) [-438.755] (-435.294) (-437.614) * (-444.431) (-433.422) (-446.547) [-437.557] -- 0:00:00
15000 -- [-442.027] (-443.012) (-433.979) (-445.542) * (-434.589) [-430.595] (-440.957) (-439.366) -- 0:00:00
Average standard deviation of split frequencies: 0.060476
15500 -- [-435.302] (-444.493) (-432.664) (-439.695) * (-440.552) [-431.320] (-434.741) (-443.104) -- 0:01:03
16000 -- (-447.958) (-451.656) (-430.996) [-442.942] * (-444.700) [-430.622] (-439.094) (-442.461) -- 0:01:01
16500 -- (-440.709) (-444.786) (-430.227) [-441.455] * (-439.744) (-429.812) [-436.193] (-434.273) -- 0:00:59
17000 -- (-444.547) (-438.403) [-430.263] (-440.583) * (-444.113) [-432.165] (-451.563) (-437.375) -- 0:00:57
17500 -- (-440.212) (-447.804) [-431.016] (-438.277) * (-440.348) (-431.114) [-433.945] (-429.875) -- 0:00:56
18000 -- (-438.172) (-442.105) [-431.544] (-440.695) * (-438.637) (-432.622) (-435.075) [-430.897] -- 0:00:54
18500 -- [-442.738] (-440.981) (-430.399) (-440.551) * (-441.017) (-431.608) (-445.081) [-430.651] -- 0:00:53
19000 -- (-446.068) [-437.838] (-430.848) (-445.250) * (-440.618) (-430.844) [-439.254] (-435.239) -- 0:00:51
19500 -- (-435.573) [-432.039] (-433.533) (-442.908) * (-437.887) (-430.714) [-441.019] (-436.086) -- 0:00:50
20000 -- (-442.642) (-433.420) [-430.308] (-438.786) * (-438.959) (-430.431) [-436.113] (-429.677) -- 0:00:49
Average standard deviation of split frequencies: 0.048154
20500 -- [-441.290] (-430.923) (-430.032) (-446.051) * (-435.825) [-429.922] (-447.058) (-430.745) -- 0:00:47
21000 -- (-442.035) (-436.692) [-429.520] (-445.309) * (-438.900) (-429.275) [-438.805] (-432.634) -- 0:00:46
21500 -- [-436.666] (-431.153) (-430.359) (-439.036) * [-434.546] (-430.153) (-448.443) (-431.353) -- 0:00:45
22000 -- (-438.307) [-433.408] (-431.510) (-444.396) * [-445.394] (-431.018) (-444.605) (-429.896) -- 0:00:44
22500 -- (-439.384) [-430.302] (-432.594) (-438.515) * [-437.977] (-429.516) (-444.158) (-432.609) -- 0:00:43
23000 -- (-449.193) (-430.179) (-433.739) [-441.861] * (-442.581) [-429.631] (-445.058) (-429.861) -- 0:00:42
23500 -- (-446.302) (-430.052) (-431.751) [-435.645] * (-440.836) (-432.315) [-440.382] (-430.916) -- 0:00:41
24000 -- (-437.982) (-430.170) (-428.679) [-436.149] * (-447.714) (-432.237) (-439.359) [-429.885] -- 0:00:40
24500 -- (-441.614) [-433.390] (-435.186) (-437.957) * (-435.323) (-432.962) (-434.277) [-431.620] -- 0:00:39
25000 -- (-438.379) (-433.219) (-433.769) [-447.082] * (-439.501) [-429.306] (-440.101) (-429.718) -- 0:00:39
Average standard deviation of split frequencies: 0.055299
25500 -- (-443.469) (-430.108) [-430.365] (-438.245) * (-444.788) (-429.552) (-441.489) [-434.653] -- 0:00:38
26000 -- (-440.186) (-432.604) [-431.848] (-438.189) * (-441.493) [-431.001] (-444.850) (-433.121) -- 0:00:37
26500 -- (-449.175) (-433.382) [-430.863] (-442.128) * (-439.475) [-431.778] (-443.575) (-430.363) -- 0:00:36
27000 -- (-445.381) (-432.938) [-431.589] (-442.999) * (-457.702) (-432.123) [-436.474] (-434.685) -- 0:00:36
27500 -- (-440.011) (-432.339) [-430.517] (-442.454) * (-440.114) (-430.813) (-449.303) [-430.928] -- 0:00:35
28000 -- (-443.422) [-433.631] (-429.654) (-436.709) * [-431.761] (-432.130) (-439.005) (-431.654) -- 0:00:34
28500 -- (-446.731) (-434.574) (-432.798) [-438.480] * (-431.019) [-429.615] (-438.124) (-430.924) -- 0:00:34
29000 -- (-444.174) (-432.166) (-429.989) [-436.031] * (-432.763) (-430.292) [-438.405] (-431.585) -- 0:00:33
29500 -- (-442.031) (-430.374) (-429.623) [-440.962] * (-431.154) (-429.207) (-444.096) [-432.837] -- 0:00:32
30000 -- [-432.832] (-430.760) (-430.178) (-443.674) * (-431.856) (-431.289) (-438.647) [-430.788] -- 0:00:32
Average standard deviation of split frequencies: 0.053802
30500 -- (-433.989) (-429.478) (-429.695) [-443.903] * [-430.590] (-431.210) (-448.706) (-429.622) -- 0:00:31
31000 -- (-434.179) (-430.625) (-430.229) [-441.230] * (-432.948) [-431.767] (-436.906) (-430.979) -- 0:00:31
31500 -- (-430.150) (-434.924) [-434.896] (-440.694) * [-432.388] (-432.266) (-448.053) (-428.922) -- 0:00:30
32000 -- (-429.766) (-438.851) [-430.433] (-443.902) * [-429.417] (-432.349) (-439.810) (-432.082) -- 0:01:00
32500 -- (-430.934) (-430.267) (-429.371) [-436.083] * [-432.627] (-437.443) (-445.236) (-430.074) -- 0:00:59
33000 -- [-430.153] (-429.780) (-432.960) (-445.275) * (-433.755) [-434.966] (-437.959) (-429.775) -- 0:00:58
33500 -- (-432.280) (-433.642) [-432.778] (-440.524) * (-433.675) (-432.274) [-442.323] (-430.116) -- 0:00:57
34000 -- [-430.932] (-431.386) (-431.923) (-438.097) * (-429.546) (-431.054) [-442.529] (-430.724) -- 0:00:56
34500 -- (-429.022) (-431.700) (-429.088) [-440.740] * (-430.863) (-429.252) [-444.410] (-437.756) -- 0:00:55
35000 -- [-431.006] (-433.275) (-429.208) (-443.485) * (-432.431) (-430.876) (-447.536) [-440.947] -- 0:00:55
Average standard deviation of split frequencies: 0.044797
35500 -- [-432.113] (-430.278) (-431.833) (-436.825) * (-432.094) [-430.126] (-440.777) (-432.736) -- 0:00:54
36000 -- (-430.395) [-431.929] (-431.918) (-446.961) * (-435.379) [-431.515] (-443.169) (-429.857) -- 0:00:53
36500 -- (-431.000) [-429.545] (-430.889) (-442.327) * [-433.808] (-429.328) (-461.252) (-429.545) -- 0:00:52
37000 -- (-431.056) [-431.071] (-431.307) (-438.984) * (-433.887) [-432.262] (-448.169) (-431.966) -- 0:00:52
37500 -- [-432.692] (-430.768) (-432.010) (-442.867) * (-434.495) [-430.675] (-433.824) (-430.857) -- 0:00:51
38000 -- [-435.854] (-429.301) (-435.936) (-434.670) * (-434.125) [-429.357] (-430.011) (-430.199) -- 0:00:50
38500 -- (-430.329) (-431.057) [-430.906] (-441.532) * (-433.698) (-430.252) [-430.538] (-429.839) -- 0:00:49
39000 -- [-430.427] (-433.096) (-430.726) (-440.830) * (-431.562) (-429.904) (-431.940) [-430.679] -- 0:00:49
39500 -- (-430.274) [-430.604] (-430.583) (-446.422) * (-432.896) [-431.963] (-431.476) (-431.539) -- 0:00:48
40000 -- (-432.813) [-431.441] (-429.083) (-455.425) * [-435.959] (-434.877) (-430.004) (-432.043) -- 0:00:48
Average standard deviation of split frequencies: 0.036139
40500 -- [-430.438] (-431.664) (-430.626) (-446.361) * (-431.043) (-431.203) [-432.326] (-430.656) -- 0:00:47
41000 -- [-431.429] (-435.451) (-430.077) (-435.812) * (-434.262) (-429.970) (-433.126) [-429.897] -- 0:00:46
41500 -- (-430.436) (-433.560) (-429.835) [-443.119] * (-436.900) [-430.500] (-432.235) (-431.130) -- 0:00:46
42000 -- (-434.131) (-431.194) (-430.696) [-439.037] * (-435.002) (-431.419) [-430.536] (-429.511) -- 0:00:45
42500 -- (-431.041) [-430.393] (-432.160) (-442.172) * (-431.992) (-429.918) (-430.419) [-430.989] -- 0:00:45
43000 -- (-431.441) (-432.552) (-431.829) [-436.511] * (-433.011) (-429.752) (-433.120) [-429.826] -- 0:00:44
43500 -- (-431.925) (-430.339) (-429.568) [-439.125] * (-431.199) (-430.065) [-434.084] (-430.343) -- 0:00:43
44000 -- (-431.433) (-432.592) [-430.611] (-449.262) * (-433.205) (-432.144) (-429.673) [-432.284] -- 0:00:43
44500 -- [-431.350] (-434.379) (-430.769) (-446.444) * (-430.384) (-430.017) [-432.680] (-431.579) -- 0:00:42
45000 -- (-430.285) (-430.314) [-430.566] (-440.763) * (-431.362) (-432.586) (-432.354) [-430.408] -- 0:00:42
Average standard deviation of split frequencies: 0.034160
45500 -- (-428.885) (-431.388) [-431.994] (-444.879) * (-429.335) (-431.614) (-430.024) [-435.937] -- 0:00:41
46000 -- (-430.676) (-434.873) (-432.365) [-439.667] * (-430.436) (-430.158) (-430.488) [-433.033] -- 0:00:41
46500 -- (-429.484) [-431.272] (-431.490) (-437.689) * (-430.831) (-429.112) (-429.088) [-430.923] -- 0:00:41
47000 -- (-430.342) (-431.904) (-431.451) [-447.394] * [-431.869] (-429.231) (-429.740) (-432.027) -- 0:00:40
47500 -- [-430.385] (-429.846) (-434.748) (-439.176) * (-432.015) [-429.036] (-430.935) (-432.110) -- 0:00:40
48000 -- (-431.052) (-429.352) (-431.382) [-436.820] * (-432.801) (-429.165) (-431.337) [-436.845] -- 0:00:39
48500 -- (-433.950) (-431.831) [-431.140] (-438.870) * (-432.158) (-430.657) [-429.758] (-437.078) -- 0:00:39
49000 -- (-435.736) (-430.241) [-435.809] (-443.010) * (-431.557) (-430.010) [-429.562] (-434.006) -- 0:00:58
49500 -- (-429.964) [-430.501] (-430.156) (-440.566) * (-430.675) (-430.098) (-434.914) [-429.669] -- 0:00:57
50000 -- (-432.181) (-431.837) [-433.364] (-436.023) * [-429.860] (-433.166) (-430.359) (-429.562) -- 0:00:57
Average standard deviation of split frequencies: 0.030101
50500 -- [-430.008] (-431.564) (-436.269) (-444.413) * (-433.131) (-435.095) [-432.721] (-429.829) -- 0:00:56
51000 -- [-431.655] (-431.190) (-429.502) (-447.686) * (-431.219) (-436.870) [-430.950] (-432.299) -- 0:00:55
51500 -- (-430.246) [-429.584] (-432.265) (-442.929) * (-429.891) [-429.984] (-433.714) (-429.946) -- 0:00:55
52000 -- (-434.876) (-434.827) (-433.041) [-439.245] * (-437.309) (-430.453) (-435.482) [-431.545] -- 0:00:54
52500 -- (-430.415) [-431.259] (-430.428) (-442.557) * (-430.487) (-431.422) [-429.080] (-434.425) -- 0:00:54
53000 -- (-430.379) [-431.125] (-433.642) (-444.598) * [-430.281] (-435.562) (-431.943) (-431.639) -- 0:00:53
53500 -- [-429.424] (-430.654) (-429.707) (-437.485) * (-434.883) (-432.865) (-430.714) [-430.260] -- 0:00:53
54000 -- (-431.007) [-431.900] (-429.368) (-445.747) * (-431.254) (-431.278) (-432.137) [-430.577] -- 0:00:52
54500 -- [-431.463] (-434.146) (-429.602) (-446.927) * [-431.122] (-432.649) (-430.809) (-430.881) -- 0:00:52
55000 -- (-431.992) [-430.591] (-431.065) (-439.455) * [-430.488] (-435.593) (-430.504) (-432.678) -- 0:00:51
Average standard deviation of split frequencies: 0.030570
55500 -- (-433.420) [-432.204] (-435.454) (-444.293) * [-431.182] (-433.075) (-429.549) (-429.860) -- 0:00:51
56000 -- (-430.411) [-431.398] (-433.461) (-440.700) * (-430.885) (-430.000) (-430.952) [-434.323] -- 0:00:50
56500 -- (-429.582) (-430.935) (-435.963) [-445.459] * [-429.051] (-433.025) (-434.657) (-430.378) -- 0:00:50
57000 -- (-432.102) (-429.647) (-432.419) [-446.459] * (-429.854) (-430.309) [-429.235] (-431.904) -- 0:00:49
57500 -- [-429.973] (-429.448) (-437.799) (-450.421) * (-429.242) (-430.802) (-430.197) [-435.819] -- 0:00:49
58000 -- [-429.951] (-432.913) (-434.101) (-454.750) * (-429.585) (-430.708) (-430.611) [-432.010] -- 0:00:48
58500 -- (-431.950) [-431.225] (-431.480) (-442.654) * (-432.014) [-432.704] (-429.602) (-434.955) -- 0:00:48
59000 -- [-431.977] (-431.383) (-431.546) (-429.485) * [-432.012] (-431.737) (-432.312) (-433.715) -- 0:00:47
59500 -- [-431.944] (-430.554) (-431.686) (-430.500) * (-430.113) (-432.476) (-430.097) [-430.088] -- 0:00:47
60000 -- (-431.978) (-429.995) [-431.097] (-429.612) * (-431.122) (-430.338) [-432.836] (-433.914) -- 0:00:47
Average standard deviation of split frequencies: 0.023311
60500 -- (-431.514) [-430.811] (-429.368) (-431.618) * (-430.706) (-435.544) [-430.221] (-432.749) -- 0:00:46
61000 -- (-431.084) [-429.458] (-431.034) (-431.401) * (-432.104) (-433.838) [-430.696] (-437.107) -- 0:00:46
61500 -- (-432.103) (-428.825) [-428.753] (-433.490) * (-433.563) (-431.701) [-431.005] (-429.689) -- 0:00:45
62000 -- (-433.076) (-428.779) (-432.185) [-432.300] * [-432.656] (-430.347) (-431.456) (-431.364) -- 0:00:45
62500 -- [-432.059] (-431.551) (-432.330) (-429.380) * (-429.817) (-429.504) (-432.098) [-435.680] -- 0:00:45
63000 -- (-430.525) (-432.538) [-432.223] (-429.542) * (-429.753) (-431.317) (-430.068) [-430.272] -- 0:00:44
63500 -- [-432.138] (-430.934) (-429.272) (-429.730) * (-433.445) (-433.033) (-431.612) [-430.345] -- 0:00:44
64000 -- (-431.164) (-432.590) [-431.098] (-432.166) * (-433.869) [-431.861] (-431.522) (-429.952) -- 0:00:58
64500 -- (-430.487) (-433.767) (-429.677) [-430.180] * (-429.819) (-430.643) (-429.840) [-429.933] -- 0:00:58
65000 -- [-431.158] (-431.094) (-430.337) (-431.508) * (-431.438) (-430.867) [-430.407] (-435.509) -- 0:00:57
Average standard deviation of split frequencies: 0.026869
65500 -- (-429.819) (-430.317) (-434.008) [-429.187] * (-431.085) (-431.778) [-430.212] (-432.085) -- 0:00:57
66000 -- (-429.811) (-429.617) [-429.714] (-434.112) * (-429.655) (-431.559) [-432.812] (-431.408) -- 0:00:56
66500 -- (-429.701) [-430.217] (-431.364) (-434.284) * [-430.095] (-431.083) (-433.828) (-431.082) -- 0:00:56
67000 -- (-436.304) [-429.304] (-430.962) (-431.955) * (-431.784) [-433.894] (-433.572) (-430.209) -- 0:00:55
67500 -- (-432.168) (-431.942) [-431.449] (-431.710) * (-430.567) (-430.726) (-429.295) [-430.123] -- 0:00:55
68000 -- (-430.060) (-430.688) [-431.576] (-432.871) * (-433.479) (-429.669) [-431.914] (-432.860) -- 0:00:54
68500 -- (-429.237) [-430.816] (-432.540) (-438.456) * (-431.126) (-429.478) [-430.842] (-430.996) -- 0:00:54
69000 -- [-428.999] (-432.870) (-436.995) (-433.242) * [-430.244] (-430.522) (-432.309) (-431.783) -- 0:00:53
69500 -- (-431.310) (-432.343) [-430.258] (-432.158) * (-432.203) (-429.540) (-430.511) [-430.481] -- 0:00:53
70000 -- [-431.334] (-434.476) (-429.628) (-431.754) * (-432.259) [-430.454] (-430.560) (-432.012) -- 0:00:53
Average standard deviation of split frequencies: 0.027636
70500 -- (-429.574) [-428.958] (-430.267) (-435.339) * (-431.440) (-431.352) (-430.640) [-430.453] -- 0:00:52
71000 -- (-432.638) (-431.456) [-433.120] (-435.023) * (-432.496) [-432.117] (-428.984) (-432.555) -- 0:00:52
71500 -- (-431.650) [-430.958] (-432.840) (-430.396) * (-430.570) (-429.649) (-431.730) [-429.074] -- 0:00:51
72000 -- (-429.449) (-431.668) (-429.873) [-431.318] * (-431.478) (-432.079) [-432.596] (-429.983) -- 0:00:51
72500 -- (-431.002) (-431.460) [-430.721] (-430.550) * (-431.205) (-430.594) (-430.328) [-429.554] -- 0:00:51
73000 -- [-430.478] (-432.466) (-430.670) (-431.804) * (-432.600) (-429.516) (-432.812) [-431.073] -- 0:00:50
73500 -- (-429.543) (-430.191) [-431.386] (-429.917) * [-430.192] (-431.253) (-433.570) (-429.241) -- 0:00:50
74000 -- (-429.063) (-434.421) (-431.341) [-431.777] * (-430.437) [-433.401] (-429.609) (-436.431) -- 0:00:50
74500 -- (-430.536) (-431.953) [-431.634] (-430.636) * [-430.925] (-433.574) (-432.001) (-434.020) -- 0:00:49
75000 -- (-431.564) (-430.992) [-430.964] (-429.683) * (-434.503) (-431.428) (-432.815) [-431.027] -- 0:00:49
Average standard deviation of split frequencies: 0.026502
75500 -- [-430.776] (-432.340) (-429.955) (-429.638) * (-433.813) [-431.491] (-431.525) (-430.336) -- 0:00:48
76000 -- (-431.295) [-431.740] (-431.839) (-429.420) * [-431.005] (-430.221) (-430.123) (-431.015) -- 0:00:48
76500 -- (-431.813) (-431.800) [-429.084] (-431.439) * (-432.717) (-430.158) [-429.613] (-432.263) -- 0:00:48
77000 -- [-431.646] (-429.877) (-431.297) (-430.542) * (-429.210) [-432.113] (-431.768) (-431.748) -- 0:00:47
77500 -- (-433.041) (-430.329) (-430.759) [-431.548] * (-436.926) (-430.420) [-431.756] (-429.554) -- 0:00:47
78000 -- [-430.825] (-430.401) (-431.077) (-429.687) * [-429.749] (-432.499) (-432.789) (-430.399) -- 0:00:47
78500 -- (-433.345) [-429.549] (-432.633) (-429.319) * [-431.110] (-431.644) (-430.103) (-430.076) -- 0:00:46
79000 -- (-432.119) [-430.241] (-428.955) (-430.425) * (-431.628) (-431.262) (-429.306) [-430.262] -- 0:00:46
79500 -- (-432.749) (-433.434) [-430.026] (-431.557) * [-430.375] (-432.331) (-430.684) (-430.507) -- 0:00:46
80000 -- [-429.363] (-431.194) (-432.434) (-431.432) * (-432.913) (-430.779) (-432.055) [-430.957] -- 0:00:46
Average standard deviation of split frequencies: 0.026297
80500 -- (-430.935) (-431.906) (-432.591) [-432.596] * (-433.091) [-434.251] (-431.319) (-437.442) -- 0:00:57
81000 -- (-431.633) [-429.647] (-430.230) (-429.645) * [-432.629] (-431.516) (-431.411) (-431.732) -- 0:00:56
81500 -- (-430.446) (-431.790) (-432.609) [-429.586] * (-430.425) (-431.261) (-432.799) [-431.473] -- 0:00:56
82000 -- [-434.625] (-429.945) (-429.208) (-431.035) * (-433.708) [-432.791] (-434.445) (-431.896) -- 0:00:55
82500 -- [-429.529] (-431.899) (-430.834) (-434.349) * [-428.767] (-432.834) (-430.233) (-430.513) -- 0:00:55
83000 -- [-431.348] (-430.312) (-433.488) (-431.539) * (-429.055) (-429.163) (-430.126) [-429.139] -- 0:00:55
83500 -- (-431.277) (-430.744) (-431.262) [-430.463] * (-432.052) (-432.903) (-431.363) [-433.182] -- 0:00:54
84000 -- (-431.221) (-431.250) (-430.340) [-431.603] * (-430.206) [-432.213] (-429.458) (-429.788) -- 0:00:54
84500 -- (-431.072) (-430.626) [-431.309] (-430.185) * (-431.741) [-429.793] (-428.988) (-434.926) -- 0:00:54
85000 -- (-432.386) [-430.578] (-431.324) (-428.988) * [-432.301] (-430.231) (-429.789) (-430.526) -- 0:00:53
Average standard deviation of split frequencies: 0.027884
85500 -- [-429.739] (-429.996) (-431.588) (-429.455) * (-431.781) (-429.515) (-432.399) [-430.730] -- 0:00:53
86000 -- (-430.585) (-431.324) (-431.466) [-430.305] * [-430.081] (-430.434) (-435.603) (-434.890) -- 0:00:53
86500 -- (-438.496) (-430.828) [-429.520] (-431.241) * (-431.084) (-432.705) (-433.693) [-431.522] -- 0:00:52
87000 -- [-435.388] (-433.438) (-430.729) (-429.835) * (-429.497) [-432.911] (-430.685) (-431.609) -- 0:00:52
87500 -- (-434.438) (-433.328) [-430.891] (-431.190) * (-432.689) [-432.292] (-435.995) (-434.467) -- 0:00:52
88000 -- (-435.642) [-431.670] (-429.398) (-430.107) * [-430.677] (-431.144) (-434.219) (-437.421) -- 0:00:51
88500 -- (-434.130) (-430.604) [-431.491] (-432.465) * (-429.771) [-430.209] (-431.440) (-432.502) -- 0:00:51
89000 -- [-431.416] (-432.134) (-436.711) (-432.416) * (-429.094) (-434.380) (-429.838) [-431.615] -- 0:00:51
89500 -- [-432.120] (-429.706) (-436.591) (-430.628) * (-428.979) [-433.795] (-431.079) (-430.396) -- 0:00:50
90000 -- [-431.597] (-430.220) (-438.795) (-430.512) * [-429.120] (-432.072) (-430.648) (-429.876) -- 0:00:50
Average standard deviation of split frequencies: 0.025997
90500 -- [-429.284] (-431.860) (-433.100) (-429.323) * [-431.593] (-430.556) (-429.942) (-429.045) -- 0:00:50
91000 -- (-431.219) (-435.135) (-432.368) [-429.035] * [-429.477] (-431.035) (-433.859) (-432.964) -- 0:00:49
91500 -- (-429.154) [-433.999] (-433.001) (-433.108) * (-429.661) (-434.408) (-429.739) [-432.366] -- 0:00:49
92000 -- [-429.368] (-431.676) (-442.117) (-429.548) * [-429.224] (-436.598) (-431.163) (-431.765) -- 0:00:49
92500 -- (-429.471) (-429.294) (-432.018) [-428.914] * (-431.883) [-432.311] (-429.887) (-429.843) -- 0:00:49
93000 -- [-430.926] (-430.557) (-435.371) (-431.690) * (-431.767) (-433.017) [-431.252] (-430.007) -- 0:00:48
93500 -- [-432.949] (-431.258) (-432.114) (-432.975) * (-430.214) (-434.667) [-430.276] (-429.953) -- 0:00:48
94000 -- (-431.548) (-435.503) (-430.057) [-429.352] * (-432.287) (-430.083) [-429.609] (-429.924) -- 0:00:48
94500 -- (-431.353) (-429.289) (-433.169) [-429.343] * (-429.741) (-431.784) (-430.215) [-429.769] -- 0:00:47
95000 -- (-432.488) (-430.638) [-430.598] (-434.746) * (-430.270) (-431.675) (-430.458) [-429.526] -- 0:00:47
Average standard deviation of split frequencies: 0.025916
95500 -- (-431.331) (-434.844) (-430.972) [-430.382] * (-430.039) (-434.833) (-429.603) [-429.488] -- 0:00:47
96000 -- (-431.517) (-430.443) [-429.597] (-430.883) * (-431.257) (-430.994) (-430.802) [-430.205] -- 0:00:47
96500 -- (-429.143) (-431.202) [-429.302] (-430.056) * (-430.318) (-429.928) [-431.150] (-434.344) -- 0:00:46
97000 -- (-429.625) (-431.248) (-429.459) [-430.747] * (-430.405) (-437.684) (-433.204) [-429.950] -- 0:00:46
97500 -- (-431.277) [-430.567] (-430.606) (-430.175) * (-430.440) (-435.012) (-432.446) [-431.879] -- 0:00:46
98000 -- (-435.260) (-432.452) (-430.933) [-428.937] * (-430.067) (-437.416) (-430.460) [-429.341] -- 0:00:55
98500 -- (-430.372) (-430.975) (-431.228) [-432.480] * (-428.865) [-430.074] (-430.125) (-429.696) -- 0:00:54
99000 -- (-432.985) (-431.106) (-431.778) [-429.497] * (-432.574) (-432.122) (-429.457) [-431.372] -- 0:00:54
99500 -- [-431.943] (-432.529) (-432.577) (-428.948) * (-429.808) [-433.266] (-429.474) (-431.110) -- 0:00:54
100000 -- (-430.640) (-430.838) (-430.554) [-429.568] * [-432.065] (-433.061) (-431.530) (-431.076) -- 0:00:54
Average standard deviation of split frequencies: 0.026995
100500 -- (-431.402) (-430.973) (-430.410) [-430.508] * [-430.495] (-430.179) (-430.229) (-430.200) -- 0:00:53
101000 -- (-432.829) (-429.861) (-432.120) [-432.511] * (-431.210) (-433.066) [-430.357] (-429.037) -- 0:00:53
101500 -- (-439.942) (-429.974) [-431.124] (-432.249) * [-431.390] (-431.914) (-431.297) (-430.963) -- 0:00:53
102000 -- (-437.874) (-431.156) [-431.759] (-431.734) * [-431.613] (-431.278) (-434.391) (-432.390) -- 0:00:52
102500 -- (-434.285) [-432.101] (-432.837) (-432.676) * (-432.025) [-431.313] (-432.209) (-430.745) -- 0:00:52
103000 -- (-434.165) [-430.935] (-431.511) (-430.674) * (-429.829) (-430.800) [-429.307] (-431.628) -- 0:00:52
103500 -- (-430.876) (-431.426) [-431.596] (-431.638) * (-429.226) [-433.132] (-430.290) (-436.459) -- 0:00:51
104000 -- (-432.886) (-431.391) [-429.860] (-436.250) * [-430.453] (-435.091) (-431.446) (-432.579) -- 0:00:51
104500 -- (-431.933) (-432.429) [-431.168] (-433.195) * (-429.886) (-433.225) [-430.282] (-431.191) -- 0:00:51
105000 -- (-431.788) (-430.071) [-428.751] (-434.715) * (-433.793) (-436.373) (-430.008) [-430.315] -- 0:00:51
Average standard deviation of split frequencies: 0.022236
105500 -- (-430.151) [-431.411] (-432.294) (-433.568) * (-430.090) (-432.298) [-431.614] (-433.396) -- 0:00:50
106000 -- [-430.335] (-431.433) (-433.700) (-429.758) * (-432.409) [-430.897] (-431.694) (-430.066) -- 0:00:50
106500 -- (-430.657) [-434.137] (-430.519) (-435.852) * (-429.770) [-429.957] (-430.715) (-431.374) -- 0:00:50
107000 -- [-430.219] (-433.877) (-434.017) (-433.833) * (-429.055) (-432.540) (-430.171) [-429.902] -- 0:00:50
107500 -- [-429.484] (-433.039) (-429.878) (-431.030) * (-433.487) [-432.856] (-431.314) (-432.375) -- 0:00:49
108000 -- (-431.071) (-433.350) (-431.896) [-431.078] * (-430.744) [-428.810] (-433.583) (-431.078) -- 0:00:49
108500 -- (-429.723) [-431.553] (-430.658) (-433.078) * (-429.759) (-430.884) (-430.293) [-433.777] -- 0:00:49
109000 -- (-430.515) (-433.781) (-429.833) [-434.248] * [-429.927] (-429.696) (-433.831) (-433.655) -- 0:00:49
109500 -- (-432.362) (-432.962) [-434.049] (-432.953) * (-433.556) (-432.535) [-431.750] (-433.413) -- 0:00:48
110000 -- (-431.616) (-432.292) [-431.264] (-429.112) * [-429.454] (-430.783) (-432.329) (-432.386) -- 0:00:48
Average standard deviation of split frequencies: 0.019405
110500 -- (-430.707) (-429.526) [-430.935] (-433.212) * (-432.867) [-430.595] (-431.951) (-432.132) -- 0:00:48
111000 -- (-434.339) [-429.094] (-434.118) (-430.576) * (-430.854) [-432.056] (-435.074) (-432.509) -- 0:00:48
111500 -- [-430.216] (-430.518) (-430.808) (-432.298) * (-433.093) (-429.773) [-432.122] (-430.781) -- 0:00:47
112000 -- (-431.510) (-429.881) [-433.020] (-429.836) * (-432.227) (-430.508) (-432.590) [-430.617] -- 0:00:47
112500 -- (-431.452) (-433.628) [-431.515] (-429.131) * [-434.025] (-429.768) (-431.350) (-429.874) -- 0:00:47
113000 -- (-430.104) (-431.592) [-430.810] (-430.606) * (-432.856) [-429.883] (-436.015) (-430.652) -- 0:00:47
113500 -- (-430.319) (-431.699) [-437.184] (-429.611) * (-432.030) (-431.313) [-435.674] (-437.423) -- 0:00:46
114000 -- [-430.643] (-435.339) (-432.849) (-434.391) * (-430.875) [-431.937] (-431.582) (-430.325) -- 0:00:46
114500 -- [-435.620] (-434.651) (-432.842) (-430.889) * (-429.434) (-435.046) [-432.839] (-430.179) -- 0:00:54
115000 -- (-432.371) (-429.804) [-429.821] (-430.511) * [-436.449] (-431.375) (-429.673) (-432.998) -- 0:00:53
Average standard deviation of split frequencies: 0.020319
115500 -- (-433.019) (-430.726) (-431.509) [-430.775] * (-428.757) (-432.576) (-429.474) [-431.116] -- 0:00:53
116000 -- (-432.548) (-431.504) [-430.979] (-434.960) * (-429.973) (-433.251) [-431.484] (-430.489) -- 0:00:53
116500 -- [-431.045] (-430.817) (-429.738) (-431.464) * (-431.632) (-431.805) [-430.658] (-439.019) -- 0:00:53
117000 -- [-429.866] (-430.363) (-429.893) (-430.038) * (-431.185) (-431.818) (-434.232) [-431.919] -- 0:00:52
117500 -- (-429.223) [-429.933] (-429.066) (-429.248) * (-432.047) [-431.467] (-432.073) (-431.611) -- 0:00:52
118000 -- (-431.175) (-429.670) [-430.680] (-430.278) * (-430.579) (-430.930) [-430.223] (-431.254) -- 0:00:52
118500 -- (-431.010) (-430.468) (-429.457) [-431.641] * (-429.979) (-430.304) (-432.370) [-431.467] -- 0:00:52
119000 -- (-431.500) (-430.970) [-429.955] (-430.456) * (-429.484) (-430.698) [-433.502] (-433.080) -- 0:00:51
119500 -- [-430.656] (-430.096) (-429.806) (-431.701) * (-430.649) (-429.404) (-429.442) [-431.895] -- 0:00:51
120000 -- (-430.707) [-431.057] (-429.657) (-432.088) * (-430.217) [-428.902] (-429.557) (-430.169) -- 0:00:51
Average standard deviation of split frequencies: 0.022823
120500 -- (-434.974) (-433.231) (-430.150) [-432.086] * (-432.223) (-431.602) (-430.288) [-431.976] -- 0:00:51
121000 -- (-432.778) [-430.054] (-429.238) (-431.466) * (-431.185) [-429.649] (-431.272) (-431.629) -- 0:00:50
121500 -- (-433.369) [-431.880] (-430.928) (-430.471) * (-431.430) [-430.540] (-430.394) (-430.062) -- 0:00:50
122000 -- (-429.562) (-430.495) (-434.055) [-432.555] * (-430.653) (-431.263) (-432.398) [-432.727] -- 0:00:50
122500 -- (-429.371) (-430.434) (-432.237) [-434.667] * (-430.645) (-430.892) (-433.700) [-435.528] -- 0:00:50
123000 -- (-431.512) (-432.008) [-430.997] (-430.108) * (-429.491) [-431.173] (-429.713) (-433.870) -- 0:00:49
123500 -- [-429.864] (-432.054) (-432.202) (-430.378) * (-434.769) (-429.804) [-431.548] (-433.083) -- 0:00:49
124000 -- (-430.639) (-430.038) [-432.574] (-430.828) * (-433.573) (-429.467) (-432.834) [-430.473] -- 0:00:49
124500 -- (-432.583) [-430.611] (-433.786) (-431.157) * (-431.185) (-432.548) [-428.927] (-431.812) -- 0:00:49
125000 -- (-431.282) (-429.807) (-431.204) [-432.162] * (-429.690) [-430.313] (-430.888) (-431.105) -- 0:00:49
Average standard deviation of split frequencies: 0.021023
125500 -- (-431.041) [-430.174] (-435.230) (-430.804) * (-429.637) [-429.850] (-432.353) (-429.327) -- 0:00:48
126000 -- [-430.399] (-429.811) (-432.546) (-432.227) * (-431.721) (-432.913) (-431.278) [-429.180] -- 0:00:48
126500 -- (-429.513) [-429.378] (-433.371) (-431.047) * (-431.805) (-428.936) (-431.317) [-431.950] -- 0:00:48
127000 -- (-432.480) (-429.754) [-429.482] (-429.526) * (-430.459) [-429.270] (-430.662) (-429.855) -- 0:00:48
127500 -- (-431.779) (-432.861) [-429.216] (-429.250) * (-430.568) [-429.695] (-432.740) (-430.644) -- 0:00:47
128000 -- (-429.868) (-431.339) [-430.710] (-434.797) * (-429.916) (-431.749) (-430.110) [-430.486] -- 0:00:47
128500 -- (-429.317) [-434.629] (-431.592) (-436.019) * (-430.177) (-435.094) (-431.306) [-436.213] -- 0:00:47
129000 -- (-429.271) (-430.901) [-432.941] (-436.106) * (-436.112) [-431.504] (-433.484) (-432.670) -- 0:00:47
129500 -- [-430.088] (-430.346) (-429.654) (-431.974) * (-430.805) (-432.165) [-433.554] (-429.344) -- 0:00:47
130000 -- (-436.705) (-436.438) (-432.151) [-432.677] * (-431.508) (-429.274) (-433.831) [-430.484] -- 0:00:46
Average standard deviation of split frequencies: 0.021285
130500 -- (-438.788) (-431.610) [-431.813] (-432.132) * [-434.122] (-429.485) (-433.455) (-430.895) -- 0:00:46
131000 -- (-431.487) [-430.808] (-430.686) (-430.677) * (-431.335) [-429.508] (-434.075) (-431.161) -- 0:00:53
131500 -- (-431.641) (-431.491) (-431.952) [-434.734] * (-429.411) [-432.153] (-430.200) (-430.318) -- 0:00:52
132000 -- (-429.518) (-431.065) [-432.585] (-430.826) * (-429.958) (-430.759) [-432.222] (-433.347) -- 0:00:52
132500 -- (-433.895) [-431.414] (-431.012) (-435.792) * [-431.713] (-431.143) (-429.737) (-429.898) -- 0:00:52
133000 -- [-432.088] (-430.148) (-430.751) (-429.492) * (-434.587) (-431.792) [-429.650] (-429.076) -- 0:00:52
133500 -- (-430.425) (-430.437) (-433.451) [-429.864] * (-439.998) [-430.911] (-430.447) (-429.785) -- 0:00:51
134000 -- [-429.089] (-432.506) (-430.604) (-430.597) * (-429.823) [-431.152] (-431.313) (-433.812) -- 0:00:51
134500 -- [-430.841] (-430.755) (-431.770) (-433.551) * (-430.025) (-429.683) [-430.101] (-431.779) -- 0:00:51
135000 -- [-429.999] (-434.156) (-429.466) (-430.023) * (-432.401) (-431.000) (-432.026) [-432.059] -- 0:00:51
Average standard deviation of split frequencies: 0.021317
135500 -- [-428.760] (-434.251) (-431.997) (-432.201) * (-429.767) (-433.119) (-432.557) [-435.338] -- 0:00:51
136000 -- (-432.466) (-432.651) (-434.589) [-431.023] * (-430.128) (-432.473) (-432.644) [-429.628] -- 0:00:50
136500 -- (-431.343) (-433.488) (-432.836) [-429.997] * [-431.059] (-430.994) (-430.499) (-429.751) -- 0:00:50
137000 -- (-434.903) [-429.765] (-430.141) (-430.267) * (-434.379) [-430.848] (-430.180) (-431.308) -- 0:00:50
137500 -- (-430.528) [-431.022] (-429.924) (-434.439) * (-432.875) (-430.365) [-433.429] (-430.857) -- 0:00:50
138000 -- (-432.792) [-432.928] (-437.692) (-431.054) * (-434.195) [-432.711] (-430.522) (-432.128) -- 0:00:49
138500 -- (-432.604) (-431.327) (-430.311) [-432.485] * (-439.623) [-430.355] (-437.699) (-430.040) -- 0:00:49
139000 -- (-433.106) [-428.797] (-430.020) (-428.939) * (-432.645) (-435.825) [-430.984] (-432.814) -- 0:00:49
139500 -- (-431.635) (-433.340) [-431.287] (-429.253) * [-432.468] (-432.161) (-430.716) (-435.576) -- 0:00:49
140000 -- (-432.725) (-431.890) (-432.396) [-430.604] * (-432.579) [-436.891] (-431.663) (-433.135) -- 0:00:49
Average standard deviation of split frequencies: 0.022118
140500 -- (-430.518) (-433.376) (-433.921) [-430.924] * [-429.642] (-435.293) (-431.108) (-431.909) -- 0:00:48
141000 -- (-429.137) [-430.282] (-434.451) (-432.343) * (-434.121) (-432.571) (-430.821) [-431.935] -- 0:00:48
141500 -- [-430.384] (-431.263) (-429.911) (-431.664) * (-431.270) [-429.359] (-430.521) (-432.389) -- 0:00:48
142000 -- [-430.998] (-429.955) (-430.995) (-431.699) * (-431.644) [-429.812] (-429.814) (-432.800) -- 0:00:48
142500 -- (-430.471) (-432.390) (-431.883) [-430.318] * (-431.982) [-430.078] (-430.506) (-430.155) -- 0:00:48
143000 -- [-430.999] (-431.601) (-429.296) (-429.388) * (-432.680) [-430.210] (-431.935) (-430.940) -- 0:00:47
143500 -- (-433.986) (-429.308) (-433.406) [-430.470] * (-429.723) (-429.181) [-431.736] (-429.806) -- 0:00:47
144000 -- [-429.994] (-431.804) (-433.344) (-431.270) * (-430.047) [-435.493] (-432.434) (-430.397) -- 0:00:47
144500 -- (-430.159) (-432.331) [-430.271] (-432.640) * (-431.931) [-430.532] (-431.678) (-433.512) -- 0:00:47
145000 -- (-432.292) (-433.371) (-432.054) [-429.694] * (-429.290) [-430.828] (-429.534) (-430.211) -- 0:00:47
Average standard deviation of split frequencies: 0.020664
145500 -- (-430.297) [-431.816] (-435.190) (-430.192) * (-433.908) [-431.032] (-430.910) (-433.492) -- 0:00:46
146000 -- (-433.238) [-429.667] (-437.590) (-432.283) * (-431.525) (-438.855) (-432.426) [-428.903] -- 0:00:46
146500 -- (-433.141) (-429.653) (-437.896) [-431.082] * [-430.991] (-429.230) (-429.076) (-430.609) -- 0:00:46
147000 -- [-431.532] (-429.302) (-437.610) (-433.437) * (-430.972) [-428.914] (-430.526) (-430.298) -- 0:00:46
147500 -- (-431.482) (-430.880) [-430.042] (-429.631) * [-430.216] (-430.585) (-429.296) (-432.268) -- 0:00:46
148000 -- (-430.233) (-429.612) [-431.273] (-431.072) * (-430.307) (-430.616) [-429.110] (-429.358) -- 0:00:51
148500 -- (-429.637) (-434.763) [-431.626] (-431.576) * (-430.244) [-429.802] (-438.379) (-435.332) -- 0:00:51
149000 -- (-430.073) (-429.074) [-433.308] (-431.659) * (-433.287) (-430.579) [-436.351] (-431.596) -- 0:00:51
149500 -- [-431.319] (-432.322) (-431.374) (-431.638) * (-428.896) (-439.518) [-433.375] (-429.622) -- 0:00:51
150000 -- (-430.638) (-435.938) [-430.948] (-434.996) * [-431.338] (-430.884) (-429.577) (-432.014) -- 0:00:51
Average standard deviation of split frequencies: 0.022396
150500 -- (-432.618) (-431.260) [-430.379] (-430.116) * (-430.296) [-430.176] (-429.951) (-431.912) -- 0:00:50
151000 -- (-434.851) [-436.107] (-432.087) (-431.767) * (-431.116) [-430.243] (-429.583) (-431.205) -- 0:00:50
151500 -- (-430.597) (-433.029) [-432.049] (-429.755) * (-434.199) (-431.063) [-430.063] (-430.962) -- 0:00:50
152000 -- (-430.736) (-432.679) [-429.026] (-431.323) * (-439.575) [-431.029] (-429.959) (-432.681) -- 0:00:50
152500 -- (-431.463) (-434.807) [-429.639] (-431.609) * (-430.550) (-429.818) [-429.003] (-433.472) -- 0:00:50
153000 -- [-429.450] (-436.508) (-437.001) (-433.766) * (-430.243) [-429.799] (-428.852) (-433.269) -- 0:00:49
153500 -- [-430.177] (-432.308) (-434.179) (-430.598) * (-433.885) (-430.184) (-430.992) [-432.321] -- 0:00:49
154000 -- (-430.382) [-431.079] (-434.252) (-429.122) * (-434.285) (-434.921) (-434.757) [-432.903] -- 0:00:49
154500 -- [-432.834] (-430.357) (-430.279) (-432.485) * (-432.361) [-431.689] (-432.366) (-431.851) -- 0:00:49
155000 -- (-433.718) (-431.350) [-430.675] (-439.741) * (-436.439) (-432.901) [-429.335] (-434.121) -- 0:00:49
Average standard deviation of split frequencies: 0.021455
155500 -- [-429.241] (-429.352) (-429.408) (-430.082) * (-432.889) (-430.353) (-431.404) [-434.726] -- 0:00:48
156000 -- (-433.992) [-429.275] (-431.322) (-431.765) * (-430.174) (-431.598) [-430.501] (-430.028) -- 0:00:48
156500 -- [-432.235] (-433.546) (-429.888) (-431.702) * (-432.630) [-431.193] (-435.493) (-434.665) -- 0:00:48
157000 -- (-434.935) (-430.734) [-429.668] (-436.282) * (-429.286) (-429.879) [-434.956] (-431.824) -- 0:00:48
157500 -- (-430.987) (-430.294) (-430.027) [-435.587] * [-430.698] (-432.740) (-431.549) (-430.600) -- 0:00:48
158000 -- (-430.313) [-429.097] (-430.935) (-430.910) * (-431.885) (-429.885) (-433.791) [-430.225] -- 0:00:47
158500 -- (-430.801) (-432.279) (-431.168) [-430.034] * [-430.639] (-431.511) (-432.219) (-429.079) -- 0:00:47
159000 -- (-433.480) (-433.023) [-430.268] (-432.125) * (-429.248) (-432.044) (-429.987) [-429.379] -- 0:00:47
159500 -- (-433.587) (-434.720) (-430.819) [-430.835] * (-433.740) (-432.494) [-429.543] (-433.196) -- 0:00:47
160000 -- (-431.748) (-429.837) (-429.409) [-431.248] * [-430.383] (-430.829) (-431.313) (-431.079) -- 0:00:47
Average standard deviation of split frequencies: 0.017913
160500 -- (-431.295) (-430.717) [-430.044] (-432.728) * (-432.594) [-430.114] (-433.395) (-430.205) -- 0:00:47
161000 -- (-433.089) (-429.722) (-430.341) [-431.029] * (-434.165) [-430.549] (-429.098) (-434.041) -- 0:00:46
161500 -- (-430.796) (-431.158) (-431.098) [-429.226] * (-436.528) (-431.289) (-430.635) [-430.173] -- 0:00:46
162000 -- [-432.604] (-434.162) (-429.879) (-430.466) * (-431.045) [-432.193] (-430.733) (-430.754) -- 0:00:46
162500 -- [-429.121] (-432.777) (-429.567) (-430.554) * (-432.919) (-430.581) [-430.499] (-430.241) -- 0:00:46
163000 -- (-429.109) [-429.891] (-429.510) (-433.465) * (-436.901) [-429.302] (-430.482) (-429.878) -- 0:00:46
163500 -- (-428.881) [-430.260] (-432.487) (-431.205) * (-431.399) (-430.419) [-433.021] (-432.080) -- 0:00:46
164000 -- (-430.168) (-429.086) [-430.778] (-431.873) * (-432.209) (-438.863) (-429.638) [-430.468] -- 0:00:45
164500 -- (-430.437) (-429.552) (-429.499) [-431.187] * (-431.136) (-431.280) (-430.503) [-429.936] -- 0:00:45
165000 -- [-430.274] (-431.843) (-430.792) (-431.006) * (-432.128) (-430.447) (-430.338) [-430.307] -- 0:00:50
Average standard deviation of split frequencies: 0.017935
165500 -- (-429.568) (-432.183) (-431.504) [-433.466] * [-430.142] (-432.436) (-432.463) (-430.149) -- 0:00:50
166000 -- (-429.775) (-434.492) [-434.068] (-431.145) * [-433.173] (-431.122) (-435.219) (-430.400) -- 0:00:50
166500 -- (-429.893) (-432.868) [-429.380] (-433.510) * (-433.844) (-431.142) [-432.281] (-431.550) -- 0:00:50
167000 -- [-431.992] (-431.338) (-432.427) (-430.911) * (-432.258) [-429.974] (-430.357) (-433.591) -- 0:00:49
167500 -- (-431.313) (-430.312) [-430.969] (-429.808) * [-430.044] (-429.786) (-430.352) (-432.407) -- 0:00:49
168000 -- [-429.755] (-433.738) (-434.052) (-434.134) * (-432.481) (-433.638) (-428.989) [-429.692] -- 0:00:49
168500 -- (-429.931) (-432.379) (-431.272) [-430.366] * (-428.897) (-430.248) (-430.225) [-430.245] -- 0:00:49
169000 -- (-431.767) (-431.966) [-432.264] (-431.067) * (-430.262) (-432.037) (-429.622) [-431.732] -- 0:00:49
169500 -- (-431.337) (-430.078) [-430.990] (-429.837) * (-431.046) (-430.240) [-430.382] (-429.283) -- 0:00:48
170000 -- (-433.373) [-430.358] (-431.426) (-433.224) * (-431.304) [-432.121] (-436.089) (-432.973) -- 0:00:48
Average standard deviation of split frequencies: 0.018753
170500 -- (-430.671) (-430.473) [-430.097] (-430.891) * (-429.941) (-431.130) [-429.500] (-430.021) -- 0:00:48
171000 -- (-430.093) (-430.427) [-432.601] (-429.927) * (-431.195) [-431.764] (-429.875) (-429.627) -- 0:00:48
171500 -- (-433.421) [-430.984] (-431.762) (-431.103) * [-431.265] (-434.529) (-429.310) (-432.385) -- 0:00:48
172000 -- (-431.646) (-432.105) [-429.510] (-431.545) * (-433.103) [-432.435] (-428.935) (-429.120) -- 0:00:48
172500 -- (-429.306) (-431.277) (-430.081) [-430.006] * (-430.995) [-430.584] (-430.488) (-429.362) -- 0:00:47
173000 -- (-430.265) (-431.643) [-429.903] (-431.612) * [-431.777] (-431.637) (-434.227) (-430.590) -- 0:00:47
173500 -- (-432.405) [-429.490] (-429.166) (-431.167) * (-430.819) (-432.484) [-431.340] (-429.943) -- 0:00:47
174000 -- (-439.552) (-432.223) [-432.191] (-435.220) * (-429.671) (-430.463) [-429.421] (-429.537) -- 0:00:47
174500 -- (-429.412) (-432.112) [-429.755] (-437.390) * (-430.574) (-435.981) [-431.605] (-433.038) -- 0:00:47
175000 -- (-429.811) (-432.919) (-431.914) [-431.786] * (-433.007) [-430.596] (-431.837) (-432.782) -- 0:00:47
Average standard deviation of split frequencies: 0.019172
175500 -- (-430.151) (-428.910) (-432.944) [-429.621] * (-433.963) (-432.398) [-432.597] (-435.086) -- 0:00:46
176000 -- (-431.361) (-430.638) [-434.840] (-432.871) * (-431.332) (-430.853) (-430.760) [-430.188] -- 0:00:46
176500 -- [-435.035] (-431.760) (-431.983) (-431.709) * (-433.686) (-430.657) [-431.483] (-429.116) -- 0:00:46
177000 -- (-432.517) [-433.354] (-433.028) (-429.944) * (-434.395) (-430.955) [-431.394] (-430.483) -- 0:00:46
177500 -- (-430.159) [-429.750] (-433.401) (-429.805) * (-431.718) (-430.418) [-428.837] (-432.097) -- 0:00:46
178000 -- (-437.976) (-431.361) [-434.611] (-430.272) * (-431.605) (-430.794) [-430.582] (-431.396) -- 0:00:46
178500 -- (-431.364) [-434.086] (-437.820) (-431.894) * (-429.262) [-431.958] (-432.075) (-433.016) -- 0:00:46
179000 -- (-429.720) (-433.723) (-431.769) [-430.072] * (-430.747) (-433.437) [-432.469] (-430.200) -- 0:00:45
179500 -- [-429.706] (-438.545) (-430.285) (-435.094) * (-432.672) (-431.838) [-433.819] (-431.450) -- 0:00:45
180000 -- (-437.040) (-433.899) [-432.325] (-432.934) * [-429.658] (-430.671) (-430.043) (-433.052) -- 0:00:45
Average standard deviation of split frequencies: 0.019493
180500 -- (-432.082) (-435.923) [-431.061] (-432.468) * (-430.370) [-430.292] (-432.314) (-433.906) -- 0:00:45
181000 -- (-430.943) (-432.294) (-430.076) [-429.712] * [-430.978] (-429.587) (-432.318) (-430.902) -- 0:00:45
181500 -- (-430.639) (-430.511) [-430.034] (-431.328) * (-431.534) (-431.824) [-429.811] (-436.933) -- 0:00:45
182000 -- (-430.782) [-432.011] (-434.326) (-431.706) * [-429.844] (-431.996) (-430.419) (-430.454) -- 0:00:49
182500 -- (-432.948) [-432.749] (-429.662) (-432.544) * (-430.565) (-431.573) [-433.524] (-435.670) -- 0:00:49
183000 -- [-432.751] (-431.867) (-432.434) (-431.825) * (-432.517) [-430.664] (-432.556) (-429.843) -- 0:00:49
183500 -- [-433.514] (-429.846) (-432.767) (-431.072) * [-433.072] (-430.798) (-431.899) (-430.995) -- 0:00:48
184000 -- (-432.174) [-429.765] (-429.645) (-433.277) * (-431.774) (-431.455) [-429.898] (-430.205) -- 0:00:48
184500 -- [-433.674] (-429.895) (-432.522) (-430.262) * (-429.433) (-430.881) [-432.966] (-434.017) -- 0:00:48
185000 -- (-431.824) (-429.764) [-429.759] (-434.959) * [-430.300] (-432.185) (-432.672) (-430.190) -- 0:00:48
Average standard deviation of split frequencies: 0.020142
185500 -- [-429.728] (-434.609) (-431.449) (-430.199) * (-429.459) (-432.329) (-430.420) [-431.300] -- 0:00:48
186000 -- [-431.562] (-432.018) (-429.836) (-433.451) * (-433.715) (-434.028) (-429.700) [-432.980] -- 0:00:48
186500 -- (-432.821) (-430.160) [-429.815] (-431.212) * [-432.475] (-433.796) (-431.754) (-432.144) -- 0:00:47
187000 -- [-434.286] (-429.838) (-432.154) (-432.741) * (-431.757) (-437.500) [-431.405] (-429.567) -- 0:00:47
187500 -- (-434.148) [-430.257] (-431.310) (-432.818) * (-431.539) (-432.918) [-433.227] (-433.994) -- 0:00:47
188000 -- (-430.510) [-429.873] (-432.572) (-430.112) * (-430.343) [-433.828] (-431.493) (-430.461) -- 0:00:47
188500 -- [-431.107] (-433.098) (-431.060) (-430.456) * (-429.872) (-431.405) [-429.293] (-430.075) -- 0:00:47
189000 -- [-430.353] (-433.961) (-435.196) (-431.603) * (-430.210) [-436.006] (-431.398) (-431.305) -- 0:00:47
189500 -- (-428.983) (-429.762) (-432.533) [-434.327] * (-431.714) (-431.712) (-432.360) [-432.306] -- 0:00:47
190000 -- (-430.680) [-430.605] (-431.284) (-431.241) * (-429.702) [-433.732] (-434.375) (-434.066) -- 0:00:46
Average standard deviation of split frequencies: 0.019779
190500 -- (-431.220) (-431.032) [-430.080] (-437.043) * [-431.088] (-434.573) (-430.976) (-431.996) -- 0:00:46
191000 -- (-430.117) (-430.891) [-430.466] (-428.765) * (-430.796) (-431.529) (-435.526) [-431.702] -- 0:00:46
191500 -- (-430.040) (-434.231) [-429.605] (-430.817) * (-430.461) (-431.618) [-431.361] (-429.480) -- 0:00:46
192000 -- (-429.447) (-430.838) (-430.908) [-430.754] * (-428.997) [-430.237] (-429.922) (-432.962) -- 0:00:46
192500 -- (-430.539) (-430.114) [-431.907] (-429.862) * (-431.796) (-431.132) (-431.417) [-430.006] -- 0:00:46
193000 -- (-430.170) [-430.864] (-432.076) (-429.500) * [-429.378] (-432.527) (-433.555) (-431.871) -- 0:00:45
193500 -- (-429.531) [-429.884] (-431.777) (-429.876) * (-432.598) [-430.362] (-430.470) (-431.896) -- 0:00:45
194000 -- (-429.504) [-430.655] (-435.898) (-431.146) * (-429.249) (-431.444) (-432.262) [-431.868] -- 0:00:45
194500 -- (-432.963) [-430.972] (-432.488) (-431.255) * (-430.941) (-431.542) (-433.193) [-432.545] -- 0:00:45
195000 -- (-435.715) (-435.622) [-433.441] (-432.487) * (-430.750) (-430.510) [-429.124] (-431.410) -- 0:00:45
Average standard deviation of split frequencies: 0.018840
195500 -- (-437.625) (-432.469) [-430.488] (-431.021) * (-434.419) (-430.408) (-433.554) [-430.855] -- 0:00:45
196000 -- (-430.680) (-432.069) [-429.514] (-433.911) * (-433.420) (-429.184) [-432.538] (-429.315) -- 0:00:45
196500 -- [-432.817] (-430.306) (-432.512) (-436.947) * [-432.982] (-428.890) (-430.009) (-429.187) -- 0:00:44
197000 -- (-429.787) (-430.096) (-434.459) [-432.280] * (-430.952) (-429.452) [-429.643] (-432.477) -- 0:00:44
197500 -- [-429.959] (-432.770) (-431.966) (-435.877) * (-435.048) [-433.929] (-429.924) (-430.756) -- 0:00:44
198000 -- [-430.065] (-432.832) (-432.047) (-431.960) * (-434.185) [-430.817] (-432.586) (-437.969) -- 0:00:44
198500 -- (-432.213) (-431.616) (-429.866) [-430.072] * [-431.475] (-435.051) (-430.380) (-435.348) -- 0:00:44
199000 -- (-433.351) (-431.849) [-430.917] (-431.593) * (-429.401) (-431.664) (-432.196) [-430.922] -- 0:00:48
199500 -- [-429.932] (-430.688) (-430.584) (-431.322) * (-429.742) (-431.011) (-430.872) [-430.627] -- 0:00:48
200000 -- (-433.629) (-430.738) (-430.713) [-433.422] * (-435.691) [-429.279] (-434.381) (-430.589) -- 0:00:48
Average standard deviation of split frequencies: 0.019070
200500 -- [-430.898] (-431.870) (-432.731) (-430.019) * [-439.947] (-429.040) (-431.225) (-433.108) -- 0:00:47
201000 -- (-431.105) (-431.603) [-433.276] (-432.058) * (-433.376) (-429.994) [-431.005] (-430.811) -- 0:00:47
201500 -- [-433.387] (-429.414) (-430.102) (-431.118) * (-432.385) (-430.595) [-429.339] (-429.354) -- 0:00:47
202000 -- (-430.981) (-435.923) [-433.032] (-429.538) * (-430.126) [-431.114] (-430.931) (-437.280) -- 0:00:47
202500 -- (-430.011) (-429.946) (-429.603) [-430.951] * [-429.561] (-434.135) (-432.272) (-431.335) -- 0:00:47
203000 -- (-430.931) (-430.676) [-430.396] (-429.670) * (-432.298) (-430.590) (-431.265) [-429.194] -- 0:00:47
203500 -- (-431.254) (-430.385) [-430.526] (-434.896) * [-430.501] (-433.808) (-431.587) (-429.230) -- 0:00:46
204000 -- (-429.970) [-432.301] (-434.673) (-435.364) * (-429.523) (-432.708) (-431.751) [-436.171] -- 0:00:46
204500 -- (-431.057) [-431.732] (-433.950) (-431.414) * (-430.840) (-429.984) (-431.233) [-433.588] -- 0:00:46
205000 -- [-437.037] (-431.001) (-429.655) (-430.862) * (-430.464) (-436.397) [-429.982] (-431.105) -- 0:00:46
Average standard deviation of split frequencies: 0.016781
205500 -- (-437.697) (-430.769) [-430.339] (-430.057) * (-431.086) [-431.694] (-432.224) (-430.176) -- 0:00:46
206000 -- [-432.295] (-431.385) (-432.604) (-431.477) * [-432.368] (-430.009) (-432.078) (-431.034) -- 0:00:46
206500 -- (-433.771) (-430.092) [-432.019] (-429.046) * [-430.016] (-433.025) (-430.603) (-431.826) -- 0:00:46
207000 -- [-431.781] (-434.643) (-430.338) (-430.082) * [-429.682] (-432.751) (-429.966) (-430.269) -- 0:00:45
207500 -- (-429.758) [-432.553] (-431.399) (-431.116) * (-429.015) (-429.365) [-431.653] (-431.204) -- 0:00:45
208000 -- (-430.282) (-429.844) (-433.117) [-429.789] * (-431.246) (-435.920) (-430.988) [-432.001] -- 0:00:45
208500 -- [-431.496] (-429.413) (-431.308) (-430.151) * [-434.757] (-430.920) (-430.619) (-431.208) -- 0:00:45
209000 -- (-431.570) (-433.544) [-429.818] (-434.044) * (-432.233) (-432.767) [-429.833] (-430.116) -- 0:00:45
209500 -- [-430.867] (-430.235) (-431.329) (-429.916) * (-430.870) (-429.648) (-431.718) [-430.411] -- 0:00:45
210000 -- (-432.160) (-435.914) (-431.176) [-430.032] * [-431.640] (-436.272) (-430.126) (-429.425) -- 0:00:45
Average standard deviation of split frequencies: 0.015795
210500 -- (-429.419) (-437.135) [-432.412] (-433.625) * (-431.065) (-435.367) (-429.862) [-429.957] -- 0:00:45
211000 -- (-433.937) [-430.596] (-432.389) (-432.674) * (-429.690) (-437.629) [-432.942] (-430.538) -- 0:00:44
211500 -- (-435.314) (-429.999) [-431.051] (-429.581) * [-431.085] (-431.324) (-432.269) (-431.006) -- 0:00:44
212000 -- (-431.550) (-430.738) [-429.494] (-432.968) * (-435.995) (-432.612) (-433.535) [-430.248] -- 0:00:44
212500 -- (-431.498) (-434.161) [-431.644] (-430.923) * (-429.090) (-430.220) [-430.421] (-429.617) -- 0:00:44
213000 -- (-432.826) (-430.293) [-429.996] (-432.476) * [-432.952] (-431.894) (-429.850) (-430.023) -- 0:00:44
213500 -- (-431.178) (-432.523) [-431.809] (-430.538) * (-431.445) [-431.724] (-430.202) (-430.000) -- 0:00:44
214000 -- (-431.411) [-430.317] (-431.275) (-432.485) * [-431.129] (-429.856) (-431.543) (-429.855) -- 0:00:44
214500 -- [-430.944] (-431.405) (-429.495) (-433.720) * (-431.068) (-431.001) [-430.928] (-429.413) -- 0:00:43
215000 -- (-430.962) [-430.132] (-433.081) (-429.147) * (-430.287) (-429.096) [-431.199] (-430.605) -- 0:00:43
Average standard deviation of split frequencies: 0.015405
215500 -- (-432.269) (-429.977) (-430.394) [-429.024] * (-433.665) (-433.603) (-433.439) [-430.670] -- 0:00:43
216000 -- (-433.475) (-430.460) (-430.936) [-431.430] * [-431.040] (-432.162) (-430.267) (-431.960) -- 0:00:47
216500 -- [-433.327] (-431.787) (-432.704) (-431.021) * [-432.846] (-431.030) (-434.263) (-433.158) -- 0:00:47
217000 -- (-430.540) (-429.798) [-432.568] (-431.113) * (-431.303) (-430.385) [-432.634] (-429.986) -- 0:00:46
217500 -- (-433.180) (-436.808) [-432.917] (-430.055) * (-430.918) (-432.048) (-429.162) [-429.706] -- 0:00:46
218000 -- (-431.982) [-430.828] (-429.658) (-432.625) * (-430.096) (-432.448) (-431.852) [-431.837] -- 0:00:46
218500 -- (-430.846) (-433.680) [-433.275] (-433.103) * [-430.604] (-434.311) (-432.633) (-435.497) -- 0:00:46
219000 -- (-430.317) (-431.593) [-429.039] (-433.787) * (-429.954) (-429.841) [-432.324] (-436.615) -- 0:00:46
219500 -- [-432.223] (-430.435) (-434.694) (-431.421) * (-429.961) [-432.305] (-430.101) (-431.524) -- 0:00:46
220000 -- [-431.436] (-431.140) (-437.856) (-429.458) * (-433.122) (-431.226) (-433.034) [-430.662] -- 0:00:46
Average standard deviation of split frequencies: 0.015331
220500 -- (-433.610) (-433.835) (-437.078) [-431.168] * (-430.539) (-429.692) [-430.606] (-429.753) -- 0:00:45
221000 -- (-435.380) (-432.755) (-434.256) [-429.726] * (-434.274) (-431.588) (-431.082) [-430.836] -- 0:00:45
221500 -- (-436.630) (-437.476) [-430.320] (-431.538) * (-435.276) (-431.327) [-430.915] (-430.297) -- 0:00:45
222000 -- (-432.100) [-429.180] (-430.691) (-430.791) * (-430.078) (-429.189) [-430.435] (-430.624) -- 0:00:45
222500 -- [-431.392] (-433.244) (-430.162) (-432.520) * [-432.972] (-430.426) (-430.450) (-430.282) -- 0:00:45
223000 -- (-429.169) [-429.297] (-431.258) (-432.187) * (-434.794) (-432.428) (-436.511) [-430.777] -- 0:00:45
223500 -- (-429.749) [-430.577] (-431.811) (-431.199) * (-431.894) (-430.508) (-431.227) [-432.431] -- 0:00:45
224000 -- (-429.553) (-429.905) (-432.550) [-431.062] * [-429.514] (-431.701) (-429.931) (-430.927) -- 0:00:45
224500 -- (-430.030) [-431.207] (-434.971) (-433.358) * (-429.921) (-429.653) (-433.047) [-431.789] -- 0:00:44
225000 -- [-431.113] (-433.466) (-430.711) (-430.737) * (-430.337) (-431.808) [-429.455] (-430.346) -- 0:00:44
Average standard deviation of split frequencies: 0.015180
225500 -- [-433.066] (-437.441) (-431.377) (-429.805) * (-430.101) (-431.212) [-429.792] (-431.274) -- 0:00:44
226000 -- (-431.156) (-436.724) (-433.667) [-429.698] * (-431.838) (-432.161) (-430.807) [-432.826] -- 0:00:44
226500 -- (-430.530) (-430.160) (-433.647) [-429.531] * (-431.599) [-429.955] (-429.609) (-433.041) -- 0:00:44
227000 -- (-430.775) (-431.341) [-431.101] (-432.207) * (-429.802) (-432.293) [-428.894] (-438.468) -- 0:00:44
227500 -- [-431.398] (-429.192) (-430.653) (-431.334) * (-431.244) (-431.839) [-430.104] (-431.932) -- 0:00:44
228000 -- [-430.045] (-431.571) (-429.428) (-434.197) * (-431.577) [-432.807] (-429.294) (-429.787) -- 0:00:44
228500 -- (-433.840) [-430.318] (-429.216) (-429.834) * (-432.563) (-431.150) (-439.402) [-430.454] -- 0:00:43
229000 -- (-433.191) (-432.753) (-430.694) [-429.817] * (-433.006) (-433.972) (-432.758) [-429.643] -- 0:00:43
229500 -- (-430.200) (-432.378) [-430.737] (-433.325) * (-432.280) (-430.376) (-429.737) [-430.001] -- 0:00:43
230000 -- [-431.499] (-434.035) (-430.350) (-431.180) * [-433.295] (-432.182) (-430.581) (-430.886) -- 0:00:43
Average standard deviation of split frequencies: 0.014760
230500 -- [-430.821] (-430.210) (-433.763) (-432.179) * (-431.120) (-431.500) [-432.386] (-433.644) -- 0:00:43
231000 -- (-430.383) [-432.339] (-430.059) (-437.452) * (-430.485) [-429.908] (-432.203) (-428.896) -- 0:00:43
231500 -- [-429.856] (-430.039) (-432.633) (-438.041) * (-430.824) (-431.985) (-431.415) [-434.054] -- 0:00:43
232000 -- (-429.105) [-432.864] (-429.510) (-436.941) * [-431.978] (-433.209) (-432.321) (-431.888) -- 0:00:43
232500 -- [-429.695] (-432.245) (-429.574) (-434.070) * [-435.170] (-434.059) (-434.472) (-431.386) -- 0:00:42
233000 -- (-429.345) [-431.199] (-431.202) (-430.739) * (-431.181) [-431.094] (-432.009) (-435.705) -- 0:00:46
233500 -- (-430.497) [-435.185] (-432.391) (-431.669) * (-434.747) (-432.592) [-429.266] (-431.294) -- 0:00:45
234000 -- (-431.371) (-432.491) (-432.051) [-430.517] * (-432.047) (-431.243) [-430.588] (-432.772) -- 0:00:45
234500 -- [-430.332] (-430.474) (-433.141) (-431.131) * (-430.650) (-430.159) (-431.267) [-431.997] -- 0:00:45
235000 -- (-431.051) (-431.931) [-429.910] (-430.184) * [-428.811] (-430.067) (-431.168) (-432.991) -- 0:00:45
Average standard deviation of split frequencies: 0.015425
235500 -- [-430.784] (-430.122) (-431.543) (-431.588) * [-429.667] (-435.021) (-435.511) (-431.786) -- 0:00:45
236000 -- (-430.266) (-429.323) (-434.665) [-430.651] * [-430.686] (-432.489) (-430.619) (-431.495) -- 0:00:45
236500 -- (-436.113) (-431.465) (-430.183) [-430.192] * (-432.128) (-432.181) (-430.135) [-432.371] -- 0:00:45
237000 -- [-436.535] (-431.690) (-429.843) (-433.046) * (-433.833) [-432.145] (-432.944) (-431.973) -- 0:00:45
237500 -- [-435.917] (-431.822) (-430.193) (-430.340) * (-431.412) (-430.421) [-430.424] (-432.432) -- 0:00:44
238000 -- (-435.990) (-431.802) [-430.697] (-430.245) * (-432.823) (-430.394) [-436.109] (-430.878) -- 0:00:44
238500 -- (-434.083) (-429.783) [-430.036] (-431.169) * (-439.878) (-430.766) [-430.624] (-432.749) -- 0:00:44
239000 -- (-433.702) [-431.785] (-430.588) (-430.095) * (-433.471) (-432.113) (-433.962) [-429.565] -- 0:00:44
239500 -- [-431.310] (-435.877) (-434.267) (-429.382) * (-433.045) [-429.781] (-432.649) (-430.241) -- 0:00:44
240000 -- (-430.473) (-431.266) (-438.496) [-430.621] * (-430.950) (-430.980) [-431.377] (-433.376) -- 0:00:44
Average standard deviation of split frequencies: 0.013814
240500 -- [-432.694] (-431.167) (-430.693) (-430.524) * (-430.266) (-431.305) (-431.532) [-432.763] -- 0:00:44
241000 -- (-432.853) [-431.519] (-431.804) (-431.871) * [-431.124] (-433.125) (-431.523) (-430.503) -- 0:00:44
241500 -- [-431.715] (-431.196) (-430.818) (-432.382) * (-432.232) (-431.843) (-432.493) [-431.276] -- 0:00:43
242000 -- (-434.273) (-432.954) [-431.126] (-430.949) * (-431.386) (-429.698) [-432.907] (-434.162) -- 0:00:43
242500 -- [-436.649] (-429.867) (-430.513) (-430.754) * [-431.243] (-432.714) (-431.979) (-432.509) -- 0:00:43
243000 -- [-431.493] (-428.933) (-429.889) (-434.400) * (-431.005) (-429.963) (-431.703) [-430.528] -- 0:00:43
243500 -- [-430.129] (-429.959) (-431.648) (-434.183) * (-431.053) (-429.724) [-432.042] (-431.600) -- 0:00:43
244000 -- (-432.150) [-429.243] (-433.274) (-430.197) * (-431.604) [-430.492] (-433.542) (-433.330) -- 0:00:43
244500 -- (-431.940) (-431.160) (-434.135) [-430.534] * [-432.197] (-432.604) (-430.850) (-432.755) -- 0:00:43
245000 -- (-436.106) (-432.569) (-434.544) [-434.273] * (-433.749) (-429.287) [-430.260] (-433.135) -- 0:00:43
Average standard deviation of split frequencies: 0.012607
245500 -- [-431.773] (-434.708) (-435.321) (-432.127) * (-430.872) (-434.399) (-428.910) [-433.079] -- 0:00:43
246000 -- (-434.243) (-432.984) [-434.747] (-432.485) * (-430.428) (-433.008) [-429.549] (-432.741) -- 0:00:42
246500 -- (-436.253) (-430.109) (-429.067) [-432.131] * [-431.825] (-435.826) (-430.329) (-432.582) -- 0:00:42
247000 -- (-432.106) (-431.516) (-430.546) [-431.438] * [-430.683] (-432.980) (-433.284) (-431.338) -- 0:00:42
247500 -- [-432.183] (-432.026) (-430.948) (-433.378) * (-431.816) (-429.600) (-431.706) [-431.900] -- 0:00:42
248000 -- (-432.027) (-434.595) (-431.886) [-433.234] * (-432.484) (-431.491) [-431.058] (-436.268) -- 0:00:42
248500 -- (-432.026) (-430.815) (-429.974) [-432.189] * (-430.830) (-430.550) (-432.232) [-433.689] -- 0:00:42
249000 -- (-430.142) (-430.637) [-430.590] (-437.516) * [-429.479] (-437.244) (-431.198) (-436.310) -- 0:00:42
249500 -- [-430.657] (-430.803) (-430.829) (-434.043) * (-429.198) (-434.827) (-433.852) [-430.589] -- 0:00:42
250000 -- (-432.205) [-433.230] (-430.166) (-430.293) * [-432.421] (-431.552) (-436.067) (-433.280) -- 0:00:45
Average standard deviation of split frequencies: 0.013791
250500 -- (-429.713) [-429.958] (-431.560) (-432.934) * [-434.940] (-431.036) (-433.157) (-431.323) -- 0:00:44
251000 -- [-429.972] (-432.703) (-432.132) (-433.097) * (-433.071) (-433.338) [-430.763] (-431.345) -- 0:00:44
251500 -- (-430.911) (-433.693) [-430.999] (-431.838) * (-433.133) (-432.642) (-432.928) [-430.110] -- 0:00:44
252000 -- (-429.465) (-431.610) (-432.423) [-433.353] * (-434.294) (-435.279) [-430.159] (-431.319) -- 0:00:44
252500 -- [-430.299] (-436.297) (-431.600) (-434.738) * (-429.136) [-430.020] (-435.397) (-431.538) -- 0:00:44
253000 -- [-430.141] (-434.545) (-430.053) (-433.961) * (-432.703) [-428.977] (-434.830) (-429.695) -- 0:00:44
253500 -- (-432.245) (-431.333) (-430.580) [-431.415] * (-430.825) (-431.060) (-432.488) [-431.234] -- 0:00:44
254000 -- (-431.899) [-431.705] (-430.811) (-431.023) * [-431.773] (-429.991) (-430.566) (-431.580) -- 0:00:44
254500 -- (-431.588) (-429.178) [-433.209] (-429.267) * (-430.932) [-429.216] (-431.863) (-432.176) -- 0:00:43
255000 -- (-432.269) (-430.195) (-430.501) [-431.458] * [-434.167] (-431.315) (-431.383) (-431.427) -- 0:00:43
Average standard deviation of split frequencies: 0.013811
255500 -- [-430.399] (-433.284) (-429.124) (-435.013) * (-428.888) (-432.098) [-430.494] (-429.729) -- 0:00:43
256000 -- (-432.926) [-432.039] (-429.697) (-432.101) * [-429.871] (-432.851) (-430.912) (-434.793) -- 0:00:43
256500 -- (-431.840) [-433.488] (-429.438) (-431.029) * (-432.347) (-431.964) [-430.197] (-436.044) -- 0:00:43
257000 -- (-431.174) [-433.398] (-431.680) (-429.608) * [-431.378] (-432.869) (-429.356) (-431.747) -- 0:00:43
257500 -- [-433.631] (-432.500) (-433.450) (-432.151) * (-432.395) [-430.330] (-430.474) (-429.633) -- 0:00:43
258000 -- (-435.975) (-431.261) (-434.627) [-430.403] * (-430.221) [-429.965] (-433.971) (-434.086) -- 0:00:43
258500 -- (-431.878) (-430.767) [-433.991] (-433.375) * (-430.934) (-431.957) [-435.035] (-434.280) -- 0:00:43
259000 -- (-430.489) (-431.379) (-430.125) [-431.695] * (-431.684) (-430.551) [-431.631] (-433.171) -- 0:00:42
259500 -- [-430.024] (-441.749) (-432.799) (-429.820) * [-430.628] (-432.913) (-429.996) (-429.659) -- 0:00:42
260000 -- [-430.282] (-429.383) (-432.654) (-432.737) * (-429.396) [-431.067] (-431.556) (-432.870) -- 0:00:42
Average standard deviation of split frequencies: 0.012553
260500 -- (-429.675) (-429.813) [-429.997] (-433.419) * (-431.476) [-430.374] (-431.334) (-431.448) -- 0:00:42
261000 -- (-432.364) (-429.272) [-432.086] (-431.450) * (-437.550) [-432.194] (-432.082) (-433.099) -- 0:00:42
261500 -- (-431.364) [-429.288] (-437.657) (-432.716) * (-438.304) (-431.073) [-430.847] (-432.282) -- 0:00:42
262000 -- [-429.145] (-430.418) (-430.530) (-432.654) * (-430.268) [-433.209] (-430.339) (-431.390) -- 0:00:42
262500 -- (-432.038) [-431.060] (-430.734) (-433.751) * (-429.723) (-433.132) (-431.117) [-431.943] -- 0:00:42
263000 -- (-429.620) (-430.440) (-430.119) [-431.372] * [-431.645] (-434.248) (-430.790) (-433.842) -- 0:00:42
263500 -- (-430.528) [-431.417] (-430.201) (-431.914) * (-430.082) (-432.044) (-429.195) [-432.503] -- 0:00:41
264000 -- (-433.260) [-429.283] (-431.273) (-435.462) * [-432.691] (-432.658) (-431.763) (-434.727) -- 0:00:41
264500 -- (-432.396) [-429.722] (-435.859) (-435.986) * (-431.861) [-430.923] (-431.046) (-432.276) -- 0:00:41
265000 -- [-431.437] (-431.590) (-430.193) (-434.211) * [-430.548] (-430.602) (-430.198) (-430.412) -- 0:00:41
Average standard deviation of split frequencies: 0.014670
265500 -- (-431.672) (-431.654) (-431.175) [-431.787] * (-434.656) (-431.177) [-435.174] (-431.430) -- 0:00:41
266000 -- (-430.661) (-431.158) [-435.013] (-432.378) * [-431.298] (-430.133) (-430.410) (-430.130) -- 0:00:41
266500 -- (-429.815) [-429.538] (-432.699) (-434.047) * (-429.986) [-429.757] (-431.608) (-429.479) -- 0:00:41
267000 -- [-429.788] (-429.653) (-431.406) (-436.198) * (-431.987) [-429.499] (-431.531) (-429.909) -- 0:00:43
267500 -- (-430.234) (-432.108) [-430.949] (-435.593) * (-429.885) (-430.251) (-430.112) [-430.173] -- 0:00:43
268000 -- (-430.803) (-430.094) (-431.870) [-431.396] * (-430.581) (-432.397) (-433.985) [-431.629] -- 0:00:43
268500 -- (-434.129) (-431.276) (-431.347) [-430.309] * (-431.280) (-432.025) (-429.300) [-433.638] -- 0:00:43
269000 -- (-430.385) (-431.153) [-431.114] (-432.196) * [-432.192] (-435.163) (-430.734) (-431.101) -- 0:00:43
269500 -- (-430.261) (-431.379) [-429.083] (-430.903) * (-432.525) (-432.056) (-430.364) [-429.994] -- 0:00:43
270000 -- (-429.224) (-429.422) [-429.560] (-435.352) * [-431.289] (-431.148) (-429.909) (-429.874) -- 0:00:43
Average standard deviation of split frequencies: 0.015265
270500 -- (-430.794) (-431.265) [-432.052] (-430.751) * (-432.099) (-434.424) [-429.767] (-434.361) -- 0:00:43
271000 -- (-431.116) [-430.230] (-430.657) (-430.721) * [-430.537] (-430.368) (-429.752) (-440.141) -- 0:00:43
271500 -- (-429.401) (-430.242) [-430.194] (-429.887) * (-430.591) (-431.660) [-429.550] (-430.370) -- 0:00:42
272000 -- (-432.443) [-431.508] (-431.830) (-431.869) * (-431.568) [-430.985] (-429.938) (-434.008) -- 0:00:42
272500 -- [-431.815] (-430.485) (-430.924) (-431.925) * (-432.582) (-431.696) [-429.131] (-431.282) -- 0:00:42
273000 -- (-431.473) (-431.722) [-431.049] (-432.115) * (-432.212) [-431.153] (-432.181) (-431.587) -- 0:00:42
273500 -- (-430.163) (-429.908) (-435.601) [-432.061] * (-429.593) (-430.539) (-432.956) [-430.439] -- 0:00:42
274000 -- [-430.404] (-430.967) (-430.670) (-430.915) * (-430.749) [-430.072] (-430.428) (-435.625) -- 0:00:42
274500 -- (-430.892) [-429.266] (-431.154) (-433.944) * (-431.005) (-434.393) (-429.545) [-433.062] -- 0:00:42
275000 -- [-429.909] (-430.166) (-429.864) (-432.081) * (-433.341) [-430.239] (-429.155) (-430.812) -- 0:00:42
Average standard deviation of split frequencies: 0.015070
275500 -- [-431.279] (-429.556) (-433.516) (-431.491) * (-432.873) (-431.584) (-429.717) [-430.879] -- 0:00:42
276000 -- [-433.048] (-430.743) (-430.474) (-429.992) * (-432.646) (-434.665) (-431.352) [-430.336] -- 0:00:41
276500 -- (-434.744) (-432.536) (-433.432) [-431.447] * [-432.034] (-433.891) (-430.825) (-430.402) -- 0:00:41
277000 -- (-432.227) (-434.516) [-431.182] (-431.375) * (-432.723) [-431.429] (-433.428) (-429.267) -- 0:00:41
277500 -- [-431.721] (-435.776) (-433.357) (-429.908) * (-433.222) (-431.148) (-433.979) [-431.054] -- 0:00:41
278000 -- (-432.656) (-432.376) (-430.918) [-429.609] * (-430.212) (-429.549) [-429.993] (-430.229) -- 0:00:41
278500 -- (-432.588) (-430.223) (-431.330) [-431.286] * (-432.260) (-431.323) (-430.572) [-432.130] -- 0:00:41
279000 -- [-429.352] (-429.684) (-432.720) (-429.098) * (-430.273) [-431.484] (-430.478) (-430.353) -- 0:00:41
279500 -- (-429.411) (-433.950) [-432.177] (-431.525) * [-430.364] (-432.548) (-432.902) (-431.196) -- 0:00:41
280000 -- (-431.723) (-432.193) [-431.731] (-430.744) * (-431.621) (-431.001) (-430.331) [-429.967] -- 0:00:41
Average standard deviation of split frequencies: 0.014622
280500 -- [-431.576] (-433.339) (-435.704) (-430.232) * (-432.339) [-433.748] (-429.293) (-430.561) -- 0:00:41
281000 -- (-431.866) (-429.831) [-431.151] (-433.304) * (-434.358) [-432.473] (-430.396) (-430.395) -- 0:00:40
281500 -- (-433.467) [-429.273] (-430.076) (-431.977) * (-432.629) (-430.156) (-429.976) [-431.582] -- 0:00:40
282000 -- (-431.019) (-429.322) [-431.866] (-433.911) * [-431.169] (-433.413) (-430.743) (-430.284) -- 0:00:40
282500 -- (-431.158) (-431.303) (-430.251) [-432.506] * [-431.277] (-431.128) (-431.040) (-430.207) -- 0:00:40
283000 -- [-429.769] (-429.620) (-431.769) (-430.584) * [-429.830] (-432.339) (-430.321) (-434.025) -- 0:00:40
283500 -- (-428.932) (-431.291) (-432.778) [-431.210] * [-429.965] (-435.740) (-437.339) (-431.309) -- 0:00:40
284000 -- (-429.365) (-432.304) (-431.193) [-429.525] * [-433.493] (-432.393) (-431.809) (-430.863) -- 0:00:40
284500 -- (-431.381) (-432.257) (-434.789) [-430.375] * (-433.889) (-430.895) [-431.146] (-439.491) -- 0:00:42
285000 -- (-428.982) (-431.947) (-431.031) [-431.923] * (-432.864) (-429.513) (-429.797) [-436.866] -- 0:00:42
Average standard deviation of split frequencies: 0.014640
285500 -- (-429.851) [-429.750] (-432.480) (-433.816) * (-431.344) [-431.015] (-430.914) (-435.217) -- 0:00:42
286000 -- [-431.157] (-429.685) (-432.047) (-429.797) * [-432.832] (-431.271) (-433.655) (-438.245) -- 0:00:42
286500 -- (-430.496) [-430.299] (-431.384) (-432.725) * [-430.062] (-429.709) (-433.786) (-430.929) -- 0:00:42
287000 -- (-431.122) (-430.706) (-429.968) [-430.609] * [-431.808] (-439.575) (-431.489) (-430.908) -- 0:00:42
287500 -- [-429.686] (-431.790) (-429.517) (-437.212) * [-432.666] (-434.194) (-429.418) (-429.030) -- 0:00:42
288000 -- (-430.639) (-429.360) [-429.194] (-431.991) * [-429.456] (-431.310) (-433.487) (-430.509) -- 0:00:42
288500 -- (-431.497) [-429.249] (-432.529) (-430.657) * (-433.868) (-428.948) (-430.049) [-432.213] -- 0:00:41
289000 -- (-434.638) (-429.874) [-428.911] (-429.242) * (-431.289) (-432.619) (-429.976) [-436.998] -- 0:00:41
289500 -- (-435.764) [-431.535] (-430.534) (-433.735) * (-434.810) (-432.849) [-429.475] (-431.268) -- 0:00:41
290000 -- (-430.674) (-429.957) [-430.966] (-430.908) * [-436.398] (-431.148) (-430.763) (-431.938) -- 0:00:41
Average standard deviation of split frequencies: 0.015073
290500 -- (-429.918) (-434.499) [-430.784] (-430.466) * (-432.706) (-434.136) [-429.206] (-431.177) -- 0:00:41
291000 -- [-430.900] (-435.755) (-435.003) (-430.316) * (-433.604) [-430.719] (-434.319) (-430.689) -- 0:00:41
291500 -- (-434.314) (-430.671) [-430.270] (-431.175) * (-432.258) (-431.747) (-429.850) [-431.941] -- 0:00:41
292000 -- (-431.013) [-431.967] (-434.767) (-431.192) * (-430.832) [-433.120] (-429.970) (-433.681) -- 0:00:41
292500 -- [-428.949] (-434.770) (-429.872) (-432.433) * (-431.843) [-431.374] (-429.319) (-431.214) -- 0:00:41
293000 -- (-431.345) (-431.697) [-429.720] (-435.380) * (-433.669) (-431.352) [-431.912] (-433.174) -- 0:00:41
293500 -- [-430.775] (-437.544) (-429.957) (-430.996) * (-432.446) (-429.496) (-430.262) [-430.892] -- 0:00:40
294000 -- (-429.951) [-432.620] (-432.714) (-431.443) * [-431.217] (-433.165) (-431.991) (-431.686) -- 0:00:40
294500 -- (-430.107) (-432.440) [-433.022] (-432.020) * (-432.868) [-435.328] (-429.954) (-429.406) -- 0:00:40
295000 -- (-431.282) (-429.769) [-429.532] (-431.543) * (-432.061) [-433.583] (-432.144) (-431.126) -- 0:00:40
Average standard deviation of split frequencies: 0.016675
295500 -- (-433.873) (-434.371) (-431.101) [-430.994] * (-431.388) (-437.963) (-434.801) [-430.150] -- 0:00:40
296000 -- (-431.513) [-428.962] (-429.241) (-429.587) * [-429.417] (-432.649) (-434.570) (-433.821) -- 0:00:40
296500 -- (-430.288) (-429.566) [-430.081] (-431.832) * (-429.707) (-430.797) (-431.913) [-429.738] -- 0:00:40
297000 -- [-431.833] (-431.886) (-431.269) (-432.719) * (-431.277) (-430.707) [-431.347] (-430.845) -- 0:00:40
297500 -- (-432.238) (-435.251) (-430.395) [-431.942] * (-429.899) [-429.590] (-430.495) (-431.207) -- 0:00:40
298000 -- (-434.790) (-431.667) (-431.360) [-431.569] * [-430.871] (-432.954) (-431.068) (-429.780) -- 0:00:40
298500 -- (-431.780) (-435.804) (-432.457) [-430.017] * [-430.891] (-434.020) (-430.044) (-429.324) -- 0:00:39
299000 -- (-430.213) [-430.349] (-431.673) (-433.533) * [-432.113] (-429.854) (-430.187) (-431.241) -- 0:00:39
299500 -- (-431.372) [-430.503] (-429.889) (-435.580) * [-430.694] (-431.157) (-431.653) (-429.634) -- 0:00:39
300000 -- (-430.841) (-431.898) (-432.709) [-428.883] * (-432.041) [-431.593] (-429.382) (-430.603) -- 0:00:39
Average standard deviation of split frequencies: 0.015771
300500 -- (-431.599) [-431.815] (-431.457) (-432.714) * (-429.651) (-431.142) (-432.016) [-430.195] -- 0:00:39
301000 -- [-432.372] (-429.117) (-431.051) (-432.170) * [-432.765] (-430.241) (-432.713) (-430.180) -- 0:00:39
301500 -- (-430.945) (-429.936) [-428.830] (-430.404) * [-430.105] (-431.737) (-429.823) (-429.900) -- 0:00:41
302000 -- (-430.728) [-432.111] (-433.294) (-432.504) * (-432.363) (-431.108) [-433.230] (-432.028) -- 0:00:41
302500 -- (-430.428) (-431.143) (-433.939) [-430.628] * (-430.775) [-428.904] (-430.949) (-429.863) -- 0:00:41
303000 -- [-429.785] (-430.684) (-431.526) (-431.070) * [-429.474] (-429.438) (-431.042) (-430.138) -- 0:00:41
303500 -- (-431.898) (-434.647) (-430.869) [-431.289] * (-431.638) (-431.592) (-430.297) [-430.691] -- 0:00:41
304000 -- (-431.738) (-435.009) (-433.293) [-429.754] * (-429.250) [-431.340] (-430.527) (-431.472) -- 0:00:41
304500 -- (-432.506) (-430.239) (-431.899) [-430.262] * (-434.944) (-431.955) [-432.256] (-429.919) -- 0:00:41
305000 -- (-439.938) (-431.521) (-432.028) [-431.657] * (-432.576) (-432.610) (-433.114) [-429.667] -- 0:00:41
Average standard deviation of split frequencies: 0.015858
305500 -- [-430.611] (-433.131) (-429.033) (-431.876) * (-430.008) (-432.044) [-435.322] (-429.654) -- 0:00:40
306000 -- (-431.911) (-434.425) [-431.133] (-432.744) * [-430.299] (-433.710) (-434.791) (-434.822) -- 0:00:40
306500 -- (-431.360) [-432.416] (-431.963) (-435.824) * (-431.525) (-432.987) [-432.340] (-434.347) -- 0:00:40
307000 -- (-428.870) (-432.268) (-429.645) [-430.693] * [-432.030] (-432.922) (-430.306) (-431.877) -- 0:00:40
307500 -- [-428.864] (-432.753) (-431.863) (-430.328) * [-430.725] (-435.875) (-437.393) (-431.934) -- 0:00:40
308000 -- [-429.685] (-430.277) (-429.975) (-429.812) * (-434.945) (-431.613) (-432.893) [-431.644] -- 0:00:40
308500 -- (-429.877) (-433.997) [-431.889] (-429.656) * (-431.385) (-439.550) (-429.217) [-429.301] -- 0:00:40
309000 -- (-434.039) [-433.294] (-430.329) (-429.199) * (-430.490) [-441.036] (-430.062) (-428.909) -- 0:00:40
309500 -- (-432.929) (-437.646) (-431.182) [-431.051] * (-431.460) (-430.867) (-430.747) [-429.807] -- 0:00:40
310000 -- (-429.460) [-432.267] (-433.960) (-434.205) * (-432.363) (-430.881) [-429.308] (-429.075) -- 0:00:40
Average standard deviation of split frequencies: 0.017227
310500 -- (-430.717) (-434.498) [-429.685] (-431.057) * (-428.955) (-431.677) (-432.336) [-430.495] -- 0:00:39
311000 -- (-429.755) (-433.414) (-432.100) [-432.116] * (-433.582) [-429.606] (-432.547) (-430.084) -- 0:00:39
311500 -- [-431.551] (-430.119) (-429.216) (-429.688) * [-430.048] (-432.550) (-431.547) (-435.198) -- 0:00:39
312000 -- (-431.035) (-433.583) [-430.153] (-432.057) * (-431.345) (-435.207) (-431.146) [-429.995] -- 0:00:39
312500 -- (-432.528) [-431.731] (-429.807) (-430.123) * [-430.400] (-434.655) (-432.690) (-431.578) -- 0:00:39
313000 -- (-431.619) [-430.952] (-432.771) (-430.867) * (-432.835) [-430.514] (-430.419) (-433.348) -- 0:00:39
313500 -- [-430.339] (-430.897) (-431.310) (-431.092) * [-429.735] (-429.556) (-433.317) (-434.295) -- 0:00:39
314000 -- [-431.454] (-430.628) (-430.998) (-433.698) * [-429.317] (-431.862) (-432.434) (-430.963) -- 0:00:39
314500 -- [-432.917] (-433.443) (-431.359) (-431.542) * (-430.220) [-434.513] (-431.263) (-430.898) -- 0:00:39
315000 -- (-432.073) (-431.882) [-430.950] (-432.709) * [-430.988] (-434.369) (-430.378) (-430.710) -- 0:00:39
Average standard deviation of split frequencies: 0.016936
315500 -- (-430.497) (-428.981) (-431.050) [-430.788] * [-430.174] (-431.652) (-429.633) (-429.354) -- 0:00:39
316000 -- (-433.163) [-428.989] (-432.460) (-430.655) * (-429.625) (-437.571) [-431.369] (-430.390) -- 0:00:38
316500 -- (-436.207) (-437.113) [-432.551] (-429.177) * (-429.891) (-436.299) (-433.338) [-429.644] -- 0:00:38
317000 -- (-431.194) (-430.567) (-430.228) [-429.785] * [-429.170] (-432.905) (-429.483) (-430.955) -- 0:00:38
317500 -- (-434.177) (-430.230) [-431.558] (-430.502) * (-436.320) (-430.419) [-430.846] (-432.522) -- 0:00:38
318000 -- (-429.781) (-430.060) (-432.901) [-430.659] * (-432.039) (-431.558) (-430.328) [-435.992] -- 0:00:38
318500 -- (-437.366) (-431.470) (-431.003) [-432.529] * [-431.103] (-435.422) (-433.130) (-433.708) -- 0:00:40
319000 -- (-431.880) (-432.651) [-429.076] (-436.026) * (-431.810) (-433.766) (-429.453) [-431.554] -- 0:00:40
319500 -- (-434.804) (-433.214) (-430.102) [-431.446] * [-429.300] (-430.531) (-432.313) (-434.535) -- 0:00:40
320000 -- (-429.132) [-433.148] (-430.041) (-430.562) * (-430.313) (-429.882) (-432.719) [-431.994] -- 0:00:40
Average standard deviation of split frequencies: 0.017209
320500 -- (-428.970) (-433.533) (-436.163) [-431.032] * (-431.456) (-431.369) [-431.176] (-430.331) -- 0:00:40
321000 -- (-431.729) (-431.454) (-431.606) [-429.950] * [-428.768] (-433.310) (-430.303) (-433.997) -- 0:00:40
321500 -- (-431.110) (-429.454) (-432.226) [-434.219] * (-431.829) (-436.062) (-433.587) [-434.009] -- 0:00:40
322000 -- [-432.617] (-429.549) (-437.977) (-432.420) * (-431.168) (-431.012) (-430.719) [-431.221] -- 0:00:40
322500 -- (-430.752) [-429.917] (-435.726) (-430.707) * [-429.913] (-429.259) (-433.120) (-433.071) -- 0:00:39
323000 -- [-433.363] (-430.695) (-434.723) (-434.597) * (-429.560) (-429.488) (-434.049) [-429.262] -- 0:00:39
323500 -- (-432.738) (-429.932) [-429.394] (-429.517) * (-431.055) (-434.691) (-433.876) [-430.925] -- 0:00:39
324000 -- [-430.463] (-431.544) (-430.694) (-437.327) * (-429.899) (-432.972) (-435.385) [-429.523] -- 0:00:39
324500 -- (-429.703) (-430.780) (-430.948) [-434.270] * (-434.388) (-433.002) [-432.913] (-432.429) -- 0:00:39
325000 -- (-436.624) [-430.492] (-434.202) (-435.126) * (-433.147) [-430.735] (-433.265) (-432.794) -- 0:00:39
Average standard deviation of split frequencies: 0.016502
325500 -- (-430.107) [-431.624] (-432.942) (-439.845) * [-438.862] (-430.306) (-430.104) (-430.208) -- 0:00:39
326000 -- (-430.738) (-429.800) (-429.955) [-432.230] * (-432.323) (-430.484) [-430.003] (-430.864) -- 0:00:39
326500 -- [-430.382] (-431.190) (-431.430) (-431.886) * (-429.924) (-431.507) (-434.052) [-433.096] -- 0:00:39
327000 -- (-434.432) [-430.452] (-429.455) (-429.917) * (-430.473) (-430.256) [-433.722] (-430.856) -- 0:00:39
327500 -- (-430.239) [-430.094] (-428.912) (-429.649) * (-430.962) (-429.896) (-429.630) [-428.736] -- 0:00:39
328000 -- (-431.425) (-429.153) [-430.597] (-430.186) * (-432.717) (-430.368) (-429.106) [-429.054] -- 0:00:38
328500 -- (-429.558) (-433.471) [-429.504] (-431.980) * [-432.636] (-430.508) (-431.621) (-430.920) -- 0:00:38
329000 -- (-436.848) (-431.477) (-430.402) [-432.683] * (-430.749) [-432.551] (-430.499) (-429.761) -- 0:00:38
329500 -- (-433.229) (-432.115) (-433.242) [-432.805] * (-431.062) (-434.226) (-431.355) [-432.433] -- 0:00:38
330000 -- [-429.549] (-436.176) (-429.052) (-430.305) * [-431.802] (-433.067) (-429.381) (-433.603) -- 0:00:38
Average standard deviation of split frequencies: 0.017558
330500 -- (-436.063) (-432.851) [-430.102] (-429.913) * (-429.982) (-431.250) (-431.096) [-432.448] -- 0:00:38
331000 -- (-433.893) (-433.766) [-431.401] (-431.184) * (-429.936) [-429.527] (-434.375) (-429.331) -- 0:00:38
331500 -- (-434.975) (-430.106) [-433.071] (-430.526) * (-431.841) [-430.378] (-435.908) (-429.782) -- 0:00:38
332000 -- (-431.952) (-430.191) (-430.973) [-431.197] * [-432.289] (-429.122) (-432.104) (-433.966) -- 0:00:38
332500 -- [-429.604] (-431.461) (-432.965) (-430.053) * (-430.553) (-429.119) (-431.313) [-432.656] -- 0:00:38
333000 -- (-430.763) [-431.426] (-430.376) (-441.944) * (-430.405) (-432.856) [-430.808] (-431.580) -- 0:00:38
333500 -- (-430.937) (-431.990) [-431.153] (-435.378) * [-430.080] (-434.555) (-433.398) (-433.100) -- 0:00:37
334000 -- (-429.579) [-433.187] (-431.598) (-434.483) * (-431.951) (-430.030) (-431.501) [-430.390] -- 0:00:37
334500 -- [-434.769] (-432.970) (-432.007) (-431.301) * (-431.805) (-438.785) (-433.162) [-431.194] -- 0:00:37
335000 -- (-432.317) (-429.646) (-430.274) [-429.906] * (-429.613) (-431.616) [-432.984] (-430.397) -- 0:00:37
Average standard deviation of split frequencies: 0.017537
335500 -- [-432.336] (-430.610) (-433.137) (-429.485) * (-431.725) (-432.241) [-431.364] (-430.217) -- 0:00:37
336000 -- [-432.525] (-431.146) (-432.382) (-429.340) * [-433.408] (-431.158) (-430.271) (-430.668) -- 0:00:39
336500 -- [-429.819] (-430.255) (-429.964) (-429.214) * (-430.427) (-430.657) (-432.478) [-430.483] -- 0:00:39
337000 -- (-429.756) (-435.789) (-429.758) [-432.400] * (-429.519) [-432.824] (-433.244) (-430.243) -- 0:00:39
337500 -- (-429.195) (-433.629) (-429.720) [-431.040] * (-430.779) (-432.425) (-430.133) [-431.956] -- 0:00:39
338000 -- (-433.474) (-433.077) (-433.089) [-432.587] * (-430.591) [-432.129] (-437.371) (-429.662) -- 0:00:39
338500 -- (-430.133) [-429.874] (-430.439) (-430.884) * (-432.175) (-432.033) (-434.768) [-429.339] -- 0:00:39
339000 -- (-429.606) (-429.998) (-429.172) [-431.732] * (-430.231) (-430.633) [-431.720] (-429.639) -- 0:00:38
339500 -- (-431.245) (-431.595) [-428.799] (-429.675) * (-432.096) (-430.406) (-433.346) [-429.907] -- 0:00:38
340000 -- (-433.554) (-435.294) [-429.366] (-430.963) * (-435.739) (-436.116) [-431.342] (-431.821) -- 0:00:38
Average standard deviation of split frequencies: 0.018353
340500 -- (-432.939) (-430.160) (-430.069) [-434.336] * (-430.414) (-433.511) [-431.880] (-433.770) -- 0:00:38
341000 -- (-431.626) (-429.140) (-429.599) [-430.899] * (-430.181) (-432.634) (-431.827) [-430.767] -- 0:00:38
341500 -- [-431.832] (-430.036) (-431.676) (-432.319) * (-430.502) [-430.043] (-434.568) (-430.520) -- 0:00:38
342000 -- (-431.068) [-429.591] (-432.546) (-431.978) * (-433.260) (-431.623) [-431.206] (-431.474) -- 0:00:38
342500 -- (-430.639) [-429.901] (-432.954) (-431.281) * (-429.342) (-433.937) [-430.350] (-429.655) -- 0:00:38
343000 -- (-432.911) [-433.892] (-433.576) (-429.157) * (-430.573) (-433.821) (-433.049) [-430.320] -- 0:00:38
343500 -- (-432.811) (-431.894) [-431.079] (-430.901) * [-429.430] (-430.385) (-433.625) (-430.635) -- 0:00:38
344000 -- (-430.905) (-430.898) [-429.731] (-431.229) * (-429.180) (-431.164) [-431.183] (-432.478) -- 0:00:38
344500 -- (-432.801) (-430.468) [-430.061] (-430.881) * (-430.602) (-430.215) (-433.062) [-431.761] -- 0:00:38
345000 -- (-433.381) [-430.664] (-430.273) (-433.341) * (-428.788) (-429.763) [-430.543] (-432.237) -- 0:00:37
Average standard deviation of split frequencies: 0.017783
345500 -- (-430.772) (-430.421) [-430.518] (-432.744) * (-430.736) (-432.934) (-429.772) [-431.372] -- 0:00:37
346000 -- (-430.778) (-432.416) [-429.820] (-433.735) * (-430.964) [-429.391] (-430.705) (-430.274) -- 0:00:37
346500 -- (-438.879) (-433.674) [-430.283] (-432.448) * (-432.004) (-429.901) [-430.486] (-438.304) -- 0:00:37
347000 -- [-431.018] (-436.220) (-432.061) (-430.202) * (-429.516) (-429.641) (-430.057) [-429.081] -- 0:00:37
347500 -- [-432.079] (-429.786) (-432.536) (-437.209) * (-430.029) (-432.178) [-429.323] (-433.503) -- 0:00:37
348000 -- (-432.364) (-428.806) (-432.310) [-433.215] * [-431.293] (-430.210) (-432.925) (-430.911) -- 0:00:37
348500 -- (-430.598) (-430.416) (-432.571) [-432.463] * (-431.854) [-431.943] (-433.433) (-430.543) -- 0:00:37
349000 -- [-432.978] (-431.588) (-431.202) (-430.013) * [-431.642] (-430.599) (-431.262) (-429.536) -- 0:00:37
349500 -- [-429.680] (-431.913) (-430.670) (-431.018) * (-431.097) (-429.677) [-429.644] (-430.055) -- 0:00:37
350000 -- (-432.599) [-429.718] (-430.308) (-431.163) * (-432.918) (-432.250) [-432.947] (-432.666) -- 0:00:37
Average standard deviation of split frequencies: 0.017405
350500 -- (-433.878) [-430.236] (-431.710) (-431.684) * (-433.249) [-430.474] (-431.369) (-434.061) -- 0:00:37
351000 -- (-433.212) (-429.892) [-430.903] (-430.351) * [-433.939] (-434.273) (-430.683) (-433.137) -- 0:00:36
351500 -- (-431.622) [-436.463] (-431.033) (-429.045) * (-430.407) (-435.700) (-429.139) [-430.646] -- 0:00:36
352000 -- (-430.739) (-432.151) [-431.859] (-431.644) * (-433.812) [-431.574] (-430.800) (-434.924) -- 0:00:36
352500 -- (-430.962) (-429.674) (-429.752) [-429.140] * [-429.384] (-430.791) (-432.373) (-430.383) -- 0:00:36
353000 -- (-433.986) (-433.237) (-431.668) [-429.301] * (-429.478) [-430.530] (-430.061) (-431.297) -- 0:00:38
353500 -- (-435.321) (-429.395) [-433.388] (-429.387) * [-433.428] (-430.669) (-429.730) (-429.638) -- 0:00:38
354000 -- (-431.459) (-429.700) [-430.493] (-433.307) * (-429.195) (-434.370) [-430.164] (-430.461) -- 0:00:38
354500 -- [-433.184] (-433.475) (-429.944) (-430.630) * [-430.878] (-432.796) (-432.405) (-433.278) -- 0:00:38
355000 -- (-435.266) (-430.896) (-429.520) [-429.873] * (-430.488) [-431.748] (-432.887) (-432.235) -- 0:00:38
Average standard deviation of split frequencies: 0.017632
355500 -- (-431.813) (-431.015) [-433.140] (-435.719) * (-430.206) [-430.404] (-430.272) (-429.786) -- 0:00:38
356000 -- [-431.706] (-434.561) (-431.112) (-429.920) * (-431.380) (-429.666) [-433.697] (-432.061) -- 0:00:37
356500 -- (-436.276) [-434.527] (-432.316) (-430.877) * (-429.168) [-431.179] (-431.486) (-429.850) -- 0:00:37
357000 -- (-433.293) (-430.692) (-431.385) [-430.766] * [-431.091] (-431.109) (-431.835) (-429.524) -- 0:00:37
357500 -- (-430.459) (-429.724) (-433.652) [-434.171] * (-432.433) (-431.894) [-429.894] (-432.136) -- 0:00:37
358000 -- (-429.180) [-433.159] (-429.786) (-431.862) * (-429.898) (-429.129) [-432.096] (-430.251) -- 0:00:37
358500 -- (-430.568) (-438.258) (-432.217) [-432.847] * (-437.401) (-431.716) [-433.806] (-431.436) -- 0:00:37
359000 -- (-430.880) [-430.250] (-431.248) (-432.699) * [-431.466] (-430.556) (-430.512) (-432.543) -- 0:00:37
359500 -- (-432.613) (-429.349) (-436.098) [-432.639] * (-432.130) (-430.821) (-430.807) [-433.943] -- 0:00:37
360000 -- (-431.429) (-430.547) [-430.775] (-430.662) * (-432.157) (-429.480) (-432.737) [-431.067] -- 0:00:37
Average standard deviation of split frequencies: 0.018023
360500 -- (-437.687) (-431.074) (-430.175) [-429.053] * [-431.410] (-433.460) (-430.478) (-433.909) -- 0:00:37
361000 -- [-430.236] (-436.033) (-433.492) (-434.410) * (-429.628) (-431.825) [-432.105] (-431.612) -- 0:00:37
361500 -- (-432.994) (-429.989) [-430.463] (-429.758) * (-430.139) (-431.323) (-430.774) [-430.571] -- 0:00:37
362000 -- (-429.357) (-429.664) (-434.545) [-429.030] * [-429.823] (-433.824) (-432.135) (-431.658) -- 0:00:37
362500 -- (-429.172) (-429.882) [-430.886] (-430.286) * (-431.341) [-432.137] (-431.361) (-432.402) -- 0:00:36
363000 -- [-429.797] (-429.888) (-433.925) (-429.673) * (-430.966) [-432.837] (-431.476) (-431.525) -- 0:00:36
363500 -- (-429.750) [-430.610] (-429.457) (-429.526) * [-429.712] (-430.885) (-431.018) (-430.417) -- 0:00:36
364000 -- (-436.303) (-432.060) (-432.798) [-429.880] * [-433.014] (-432.015) (-431.183) (-429.971) -- 0:00:36
364500 -- (-438.829) [-429.286] (-429.684) (-431.434) * (-429.089) (-431.195) (-430.535) [-430.954] -- 0:00:36
365000 -- [-429.769] (-431.513) (-429.740) (-431.516) * (-430.924) (-438.801) [-429.808] (-432.165) -- 0:00:36
Average standard deviation of split frequencies: 0.016873
365500 -- [-432.196] (-431.619) (-429.750) (-429.370) * (-430.168) (-434.107) [-429.852] (-429.547) -- 0:00:36
366000 -- (-431.848) (-432.045) [-432.878] (-431.100) * (-430.128) (-433.360) (-431.785) [-429.306] -- 0:00:36
366500 -- (-430.838) (-432.647) [-432.797] (-430.959) * (-430.395) [-430.102] (-429.844) (-432.711) -- 0:00:36
367000 -- (-431.845) (-433.916) (-432.381) [-433.595] * [-432.946] (-429.953) (-429.940) (-431.156) -- 0:00:36
367500 -- (-433.160) (-431.336) [-429.881] (-429.700) * [-433.967] (-430.281) (-432.084) (-431.593) -- 0:00:36
368000 -- (-435.510) (-429.662) [-429.691] (-433.190) * [-433.437] (-430.683) (-432.785) (-432.947) -- 0:00:36
368500 -- [-431.664] (-431.711) (-431.534) (-430.161) * (-429.650) (-430.935) (-429.855) [-436.318] -- 0:00:35
369000 -- [-432.742] (-434.439) (-432.072) (-431.405) * (-430.460) (-432.034) (-438.722) [-433.400] -- 0:00:35
369500 -- [-431.292] (-428.985) (-431.565) (-435.418) * [-429.260] (-430.305) (-433.471) (-433.139) -- 0:00:35
370000 -- (-432.207) [-433.874] (-434.920) (-430.349) * (-430.433) (-432.263) (-430.391) [-431.834] -- 0:00:35
Average standard deviation of split frequencies: 0.016667
370500 -- (-431.100) [-431.538] (-432.629) (-437.233) * (-430.143) (-434.720) (-433.429) [-430.398] -- 0:00:37
371000 -- (-433.143) [-431.332] (-432.772) (-440.952) * (-432.730) (-430.893) (-434.656) [-429.961] -- 0:00:37
371500 -- (-432.957) [-431.392] (-432.271) (-436.332) * (-430.579) [-433.374] (-434.403) (-433.522) -- 0:00:37
372000 -- (-430.492) (-433.264) [-430.888] (-435.839) * (-429.596) (-431.556) (-432.149) [-431.374] -- 0:00:37
372500 -- (-430.820) (-429.497) [-432.078] (-435.366) * (-430.929) [-430.853] (-436.872) (-429.569) -- 0:00:37
373000 -- (-432.871) (-432.583) [-429.841] (-431.745) * [-432.456] (-431.142) (-432.582) (-430.742) -- 0:00:36
373500 -- [-429.175] (-439.451) (-431.047) (-430.767) * [-432.723] (-429.622) (-432.832) (-431.083) -- 0:00:36
374000 -- (-432.648) [-429.971] (-431.690) (-429.881) * (-433.078) (-431.254) [-429.415] (-430.855) -- 0:00:36
374500 -- (-430.567) (-434.503) (-436.615) [-430.051] * (-435.910) (-429.649) (-432.601) [-431.526] -- 0:00:36
375000 -- (-429.657) [-431.268] (-434.046) (-435.232) * (-429.720) [-430.023] (-431.627) (-431.735) -- 0:00:36
Average standard deviation of split frequencies: 0.016628
375500 -- (-430.948) (-431.457) [-429.749] (-431.766) * [-429.957] (-430.330) (-429.943) (-432.947) -- 0:00:36
376000 -- (-430.635) (-431.487) [-430.220] (-432.088) * [-432.514] (-430.404) (-429.471) (-430.350) -- 0:00:36
376500 -- (-431.082) (-430.866) (-431.817) [-430.151] * (-430.388) [-432.284] (-432.060) (-429.677) -- 0:00:36
377000 -- (-430.097) (-438.584) [-429.974] (-428.896) * [-430.872] (-432.487) (-431.631) (-430.974) -- 0:00:36
377500 -- (-432.932) [-432.264] (-429.557) (-432.425) * [-430.561] (-431.942) (-431.724) (-429.789) -- 0:00:36
378000 -- (-437.057) (-430.707) (-430.905) [-434.189] * (-431.128) (-432.213) [-431.250] (-429.280) -- 0:00:36
378500 -- (-437.462) (-429.104) (-433.455) [-430.428] * (-429.980) [-429.167] (-430.741) (-430.758) -- 0:00:36
379000 -- (-429.722) (-432.523) [-431.296] (-429.920) * (-429.031) (-431.778) (-429.762) [-432.166] -- 0:00:36
379500 -- (-436.143) [-432.921] (-429.569) (-433.746) * (-431.449) (-430.298) [-431.133] (-431.049) -- 0:00:35
380000 -- [-429.606] (-429.286) (-430.245) (-430.728) * [-432.961] (-429.624) (-433.736) (-433.686) -- 0:00:35
Average standard deviation of split frequencies: 0.017062
380500 -- (-429.870) [-429.412] (-432.020) (-433.324) * (-430.274) [-429.426] (-432.498) (-432.620) -- 0:00:35
381000 -- [-430.624] (-429.654) (-429.907) (-432.754) * [-431.270] (-429.697) (-430.156) (-430.349) -- 0:00:35
381500 -- [-436.054] (-431.470) (-429.579) (-435.465) * [-431.062] (-429.751) (-430.487) (-434.811) -- 0:00:35
382000 -- (-432.044) (-432.047) (-431.146) [-431.360] * (-430.439) [-432.341] (-430.692) (-433.217) -- 0:00:35
382500 -- (-429.783) (-432.443) [-430.541] (-431.044) * (-430.859) (-430.442) (-429.669) [-430.593] -- 0:00:35
383000 -- (-429.391) [-429.117] (-430.794) (-430.191) * [-430.593] (-429.571) (-429.459) (-431.366) -- 0:00:35
383500 -- (-431.175) (-431.497) (-429.845) [-431.262] * (-431.020) (-431.886) [-430.011] (-432.350) -- 0:00:35
384000 -- (-431.887) (-433.930) (-431.599) [-429.576] * (-432.544) (-432.689) (-430.546) [-430.842] -- 0:00:35
384500 -- (-430.075) [-430.538] (-429.171) (-429.133) * (-430.326) (-430.081) [-430.933] (-431.788) -- 0:00:35
385000 -- (-430.123) (-433.582) [-432.350] (-430.132) * (-433.718) [-429.518] (-430.550) (-432.199) -- 0:00:35
Average standard deviation of split frequencies: 0.015944
385500 -- (-432.870) (-436.616) (-430.585) [-433.580] * (-430.974) (-432.356) [-430.170] (-430.234) -- 0:00:35
386000 -- (-431.481) (-432.860) [-431.321] (-429.760) * (-429.754) [-431.833] (-430.782) (-431.099) -- 0:00:34
386500 -- (-431.634) (-430.182) (-437.153) [-430.765] * (-431.910) (-431.148) (-430.221) [-429.413] -- 0:00:34
387000 -- [-429.781] (-432.170) (-432.194) (-432.153) * [-434.234] (-432.334) (-429.809) (-433.960) -- 0:00:34
387500 -- (-430.380) [-429.410] (-432.809) (-432.361) * (-431.319) (-432.090) (-429.783) [-434.060] -- 0:00:36
388000 -- [-431.602] (-431.540) (-432.056) (-432.799) * (-434.569) (-429.785) [-429.826] (-431.968) -- 0:00:36
388500 -- [-430.172] (-431.232) (-433.249) (-433.775) * (-433.231) (-430.439) [-432.056] (-432.338) -- 0:00:36
389000 -- (-430.043) [-429.774] (-431.397) (-431.633) * [-429.246] (-431.571) (-436.457) (-434.207) -- 0:00:36
389500 -- (-429.670) (-431.076) [-429.618] (-432.050) * (-433.090) (-431.354) [-430.783] (-433.265) -- 0:00:36
390000 -- [-433.715] (-431.968) (-428.869) (-436.327) * (-432.536) (-429.784) [-430.428] (-434.342) -- 0:00:35
Average standard deviation of split frequencies: 0.015403
390500 -- [-432.436] (-430.518) (-429.650) (-435.417) * (-429.883) (-429.512) (-431.519) [-429.003] -- 0:00:35
391000 -- [-432.965] (-434.813) (-431.875) (-430.379) * (-431.909) (-430.178) [-433.047] (-432.214) -- 0:00:35
391500 -- [-430.788] (-434.169) (-430.693) (-430.645) * (-430.598) [-430.686] (-433.197) (-433.781) -- 0:00:35
392000 -- (-432.421) (-430.547) (-433.237) [-430.648] * (-431.985) (-432.690) (-430.174) [-430.499] -- 0:00:35
392500 -- (-429.732) (-432.971) (-430.721) [-433.086] * [-430.598] (-433.426) (-429.657) (-429.012) -- 0:00:35
393000 -- [-429.153] (-432.671) (-431.539) (-432.947) * (-433.864) (-433.060) (-429.504) [-430.037] -- 0:00:35
393500 -- (-430.911) [-435.951] (-430.924) (-433.803) * (-432.763) (-431.784) [-429.708] (-429.184) -- 0:00:35
394000 -- [-429.935] (-429.367) (-429.877) (-433.138) * (-432.147) (-431.221) [-430.008] (-432.436) -- 0:00:35
394500 -- [-430.017] (-431.515) (-432.640) (-430.323) * [-430.426] (-429.366) (-432.636) (-429.442) -- 0:00:35
395000 -- (-432.566) (-430.365) [-429.385] (-431.836) * (-434.425) (-430.542) [-430.160] (-430.746) -- 0:00:35
Average standard deviation of split frequencies: 0.015335
395500 -- (-429.691) (-432.327) (-430.025) [-431.004] * (-439.592) [-431.603] (-430.888) (-430.858) -- 0:00:35
396000 -- (-431.365) [-430.793] (-430.222) (-430.403) * (-432.321) [-431.877] (-431.401) (-430.581) -- 0:00:35
396500 -- (-430.756) (-430.197) (-429.606) [-432.081] * (-430.766) (-434.809) (-429.946) [-428.809] -- 0:00:35
397000 -- (-431.160) (-431.745) (-432.164) [-429.615] * (-431.864) [-431.052] (-434.920) (-429.286) -- 0:00:34
397500 -- [-430.779] (-429.359) (-432.291) (-430.311) * (-430.160) (-432.064) [-430.633] (-430.756) -- 0:00:34
398000 -- (-434.410) (-429.682) [-431.375] (-431.124) * (-430.734) (-431.914) (-431.630) [-430.307] -- 0:00:34
398500 -- (-430.207) [-430.553] (-431.216) (-430.357) * (-430.018) (-435.060) (-431.552) [-429.789] -- 0:00:34
399000 -- (-429.512) [-430.629] (-431.453) (-431.430) * (-430.426) [-430.610] (-429.994) (-434.700) -- 0:00:34
399500 -- (-430.073) (-434.084) (-432.406) [-429.724] * [-430.408] (-430.709) (-430.051) (-433.814) -- 0:00:34
400000 -- (-430.838) (-430.525) (-430.456) [-431.297] * (-435.527) [-431.030] (-430.635) (-432.016) -- 0:00:34
Average standard deviation of split frequencies: 0.015088
400500 -- (-430.026) (-431.963) (-431.221) [-430.266] * (-432.593) [-432.597] (-434.890) (-430.889) -- 0:00:34
401000 -- (-430.192) (-431.002) [-430.831] (-431.090) * (-434.655) [-432.630] (-433.036) (-431.127) -- 0:00:34
401500 -- [-430.010] (-429.887) (-433.890) (-431.121) * (-431.406) [-432.380] (-431.201) (-429.945) -- 0:00:34
402000 -- (-434.665) (-433.577) [-431.921] (-433.781) * (-432.735) [-431.556] (-429.076) (-432.398) -- 0:00:34
402500 -- (-434.769) (-429.352) (-433.016) [-431.319] * (-431.635) [-429.673] (-433.632) (-433.464) -- 0:00:34
403000 -- (-433.051) (-430.566) (-433.077) [-431.844] * (-430.496) [-433.360] (-433.423) (-429.400) -- 0:00:34
403500 -- (-435.305) (-434.257) [-433.699] (-430.404) * (-431.232) [-430.207] (-439.997) (-430.320) -- 0:00:34
404000 -- (-435.200) [-429.527] (-432.716) (-433.213) * (-430.821) (-429.076) (-433.454) [-432.742] -- 0:00:33
404500 -- [-441.638] (-430.017) (-430.530) (-433.378) * [-431.508] (-429.089) (-433.627) (-432.195) -- 0:00:33
405000 -- [-431.942] (-434.231) (-431.839) (-431.511) * (-431.173) [-430.806] (-433.714) (-430.044) -- 0:00:35
Average standard deviation of split frequencies: 0.015997
405500 -- [-430.466] (-430.394) (-433.495) (-430.565) * (-431.433) (-429.397) (-429.754) [-433.102] -- 0:00:35
406000 -- [-430.192] (-431.619) (-430.270) (-429.398) * (-431.317) (-432.735) [-431.750] (-433.156) -- 0:00:35
406500 -- [-429.992] (-431.200) (-429.902) (-431.422) * [-430.327] (-430.366) (-432.545) (-436.488) -- 0:00:35
407000 -- (-430.090) (-433.400) (-429.770) [-434.391] * [-433.030] (-431.152) (-435.713) (-432.132) -- 0:00:34
407500 -- (-434.098) (-433.096) (-434.330) [-431.284] * (-431.770) [-432.042] (-429.705) (-429.466) -- 0:00:34
408000 -- [-431.648] (-436.791) (-430.606) (-430.012) * (-432.349) (-429.498) [-432.207] (-435.700) -- 0:00:34
408500 -- (-429.213) (-439.153) [-433.217] (-429.563) * (-432.293) [-432.297] (-431.629) (-439.812) -- 0:00:34
409000 -- [-430.861] (-429.439) (-431.252) (-429.715) * (-432.458) (-430.609) (-430.713) [-431.566] -- 0:00:34
409500 -- (-432.711) [-432.366] (-434.297) (-433.544) * (-431.639) (-438.565) (-429.166) [-431.895] -- 0:00:34
410000 -- (-431.525) [-430.668] (-431.407) (-429.924) * (-432.073) (-431.523) (-431.177) [-429.391] -- 0:00:34
Average standard deviation of split frequencies: 0.016003
410500 -- (-433.123) (-431.506) [-430.988] (-430.676) * (-432.809) (-431.388) (-432.919) [-430.444] -- 0:00:34
411000 -- (-432.097) (-432.489) (-432.037) [-432.192] * (-433.116) [-432.412] (-432.373) (-429.920) -- 0:00:34
411500 -- [-430.025] (-431.180) (-429.684) (-430.940) * (-432.451) (-431.197) [-429.670] (-431.962) -- 0:00:34
412000 -- (-437.731) (-432.889) (-431.878) [-432.004] * (-430.871) (-432.759) (-432.435) [-430.185] -- 0:00:34
412500 -- (-432.246) (-430.998) (-435.042) [-430.955] * [-429.451] (-433.791) (-430.753) (-430.785) -- 0:00:34
413000 -- (-429.885) (-435.645) (-433.033) [-430.537] * (-440.030) (-434.289) [-432.838] (-431.582) -- 0:00:34
413500 -- [-430.581] (-429.221) (-430.035) (-431.587) * [-438.307] (-430.501) (-430.259) (-432.763) -- 0:00:34
414000 -- (-434.064) [-429.134] (-431.092) (-431.793) * (-434.059) (-433.617) [-429.953] (-431.656) -- 0:00:33
414500 -- (-430.720) (-431.193) [-431.637] (-431.396) * (-432.191) (-432.831) (-429.240) [-437.227] -- 0:00:33
415000 -- (-429.163) (-430.010) (-430.982) [-434.672] * (-431.316) (-430.608) (-429.089) [-430.472] -- 0:00:33
Average standard deviation of split frequencies: 0.016368
415500 -- (-428.969) (-432.099) (-432.490) [-430.812] * [-429.344] (-431.070) (-429.553) (-430.759) -- 0:00:33
416000 -- (-431.050) [-430.656] (-433.385) (-430.467) * (-431.551) [-429.294] (-432.024) (-433.421) -- 0:00:33
416500 -- (-432.686) (-431.636) [-430.403] (-430.879) * (-430.182) [-429.212] (-430.911) (-430.250) -- 0:00:33
417000 -- (-433.813) (-434.462) (-433.910) [-429.790] * (-429.672) (-429.584) (-431.118) [-429.688] -- 0:00:33
417500 -- (-430.361) (-433.657) [-430.613] (-429.644) * (-431.874) (-430.367) (-434.160) [-432.393] -- 0:00:33
418000 -- (-432.782) (-431.517) (-429.909) [-429.787] * (-433.854) [-430.059] (-432.629) (-430.268) -- 0:00:33
418500 -- (-432.990) (-431.323) (-429.962) [-430.229] * [-430.033] (-431.476) (-433.715) (-431.318) -- 0:00:33
419000 -- (-436.790) (-433.877) (-431.684) [-431.668] * (-429.736) [-430.417] (-429.280) (-433.794) -- 0:00:33
419500 -- [-436.351] (-433.170) (-433.835) (-429.953) * [-430.382] (-432.093) (-430.145) (-429.687) -- 0:00:33
420000 -- (-431.643) (-429.245) [-431.045] (-429.594) * (-430.905) (-431.876) [-429.535] (-429.684) -- 0:00:33
Average standard deviation of split frequencies: 0.016373
420500 -- (-430.711) [-429.210] (-431.547) (-430.479) * (-429.942) [-431.816] (-429.990) (-429.288) -- 0:00:33
421000 -- [-432.484] (-430.522) (-430.104) (-433.644) * [-431.996] (-430.997) (-431.848) (-429.905) -- 0:00:33
421500 -- (-434.756) (-432.159) [-430.495] (-430.057) * (-437.160) (-432.177) [-433.758] (-432.961) -- 0:00:32
422000 -- (-434.890) (-433.926) (-430.803) [-430.392] * (-433.049) (-430.112) [-433.817] (-429.331) -- 0:00:34
422500 -- (-434.145) (-433.338) (-436.710) [-429.449] * [-430.832] (-432.024) (-430.429) (-430.802) -- 0:00:34
423000 -- (-434.612) (-436.605) [-430.072] (-430.712) * [-430.246] (-429.142) (-429.863) (-433.819) -- 0:00:34
423500 -- (-431.371) (-429.050) (-431.598) [-435.042] * (-432.090) (-429.923) (-428.964) [-431.523] -- 0:00:34
424000 -- (-434.689) (-429.169) (-430.686) [-429.229] * [-432.641] (-431.565) (-429.339) (-430.539) -- 0:00:33
424500 -- (-429.286) (-433.415) (-430.330) [-429.240] * (-433.330) (-433.994) [-430.789] (-429.975) -- 0:00:33
425000 -- (-428.802) (-429.802) (-432.729) [-429.652] * [-432.355] (-438.733) (-434.047) (-431.303) -- 0:00:33
Average standard deviation of split frequencies: 0.016353
425500 -- (-429.423) (-431.504) (-437.894) [-429.204] * (-432.323) [-432.400] (-433.546) (-431.334) -- 0:00:33
426000 -- (-431.090) (-433.377) (-433.278) [-430.099] * (-432.475) (-430.608) (-433.729) [-429.978] -- 0:00:33
426500 -- (-429.204) [-431.569] (-433.220) (-433.063) * (-431.512) (-429.595) [-430.734] (-430.254) -- 0:00:33
427000 -- (-430.261) (-431.939) [-431.007] (-429.013) * (-430.265) [-431.633] (-430.816) (-430.998) -- 0:00:33
427500 -- [-431.104] (-430.704) (-430.933) (-432.553) * (-431.901) (-432.413) (-429.949) [-432.500] -- 0:00:33
428000 -- (-432.792) (-431.087) (-432.585) [-432.859] * (-431.968) (-431.973) [-429.547] (-430.975) -- 0:00:33
428500 -- (-434.437) (-430.007) (-431.477) [-429.978] * (-431.263) (-436.075) [-430.618] (-429.574) -- 0:00:33
429000 -- [-432.040] (-430.125) (-431.412) (-432.107) * (-431.778) (-430.826) (-431.917) [-430.141] -- 0:00:33
429500 -- (-430.074) (-432.171) (-431.090) [-430.469] * (-432.317) (-433.896) (-431.980) [-431.801] -- 0:00:33
430000 -- (-429.019) (-433.978) (-433.206) [-429.673] * (-429.903) (-434.583) [-429.418] (-431.235) -- 0:00:33
Average standard deviation of split frequencies: 0.016662
430500 -- (-429.491) (-430.309) [-434.034] (-431.898) * (-431.354) (-429.442) [-432.371] (-433.269) -- 0:00:33
431000 -- (-431.548) (-432.725) (-429.200) [-432.160] * (-430.302) (-432.105) (-434.191) [-429.218] -- 0:00:33
431500 -- [-431.525] (-431.396) (-431.682) (-429.806) * [-431.632] (-432.898) (-433.335) (-431.211) -- 0:00:32
432000 -- (-432.797) (-429.936) [-431.865] (-432.068) * (-433.984) (-432.525) [-430.052] (-430.175) -- 0:00:32
432500 -- [-433.067] (-429.699) (-429.777) (-433.835) * [-433.443] (-432.126) (-431.032) (-435.130) -- 0:00:32
433000 -- [-432.919] (-430.649) (-429.770) (-431.363) * (-430.834) (-431.439) (-430.638) [-430.440] -- 0:00:32
433500 -- (-433.887) (-433.290) (-429.764) [-431.018] * (-431.472) [-431.649] (-432.596) (-430.820) -- 0:00:32
434000 -- [-431.708] (-433.753) (-431.573) (-430.063) * [-432.050] (-433.315) (-430.440) (-432.033) -- 0:00:32
434500 -- (-430.177) (-430.258) (-432.974) [-433.784] * (-432.408) [-432.009] (-430.739) (-428.991) -- 0:00:32
435000 -- (-429.663) [-432.042] (-432.503) (-433.894) * (-432.358) (-433.179) [-430.031] (-429.633) -- 0:00:32
Average standard deviation of split frequencies: 0.015709
435500 -- (-431.035) (-434.018) [-432.907] (-433.580) * (-432.572) [-432.206] (-429.923) (-430.887) -- 0:00:32
436000 -- (-430.111) (-433.593) [-431.151] (-430.231) * (-441.623) (-430.777) [-430.599] (-433.712) -- 0:00:32
436500 -- (-430.164) (-438.439) [-431.208] (-434.154) * (-431.743) [-435.026] (-432.193) (-430.188) -- 0:00:32
437000 -- (-433.664) (-430.656) [-430.487] (-430.932) * [-430.177] (-430.597) (-429.281) (-431.798) -- 0:00:32
437500 -- [-431.426] (-430.298) (-430.160) (-431.967) * (-430.456) (-431.950) (-429.110) [-430.555] -- 0:00:32
438000 -- (-430.366) (-433.162) [-429.664] (-434.290) * (-429.999) [-430.835] (-430.050) (-431.119) -- 0:00:33
438500 -- (-432.777) (-437.473) [-431.211] (-435.141) * (-430.038) (-433.359) (-429.454) [-429.670] -- 0:00:33
439000 -- (-431.060) (-441.477) [-430.386] (-434.548) * [-431.120] (-431.148) (-430.721) (-433.115) -- 0:00:33
439500 -- [-432.652] (-431.229) (-432.520) (-430.534) * [-430.551] (-430.045) (-431.136) (-432.904) -- 0:00:33
440000 -- (-428.900) (-430.218) (-433.866) [-430.066] * [-432.622] (-429.892) (-434.799) (-431.135) -- 0:00:33
Average standard deviation of split frequencies: 0.015039
440500 -- [-432.574] (-430.960) (-433.019) (-430.045) * (-430.653) (-429.687) (-432.216) [-432.190] -- 0:00:33
441000 -- (-430.695) (-429.519) [-433.930] (-430.773) * (-430.330) (-431.077) (-433.023) [-436.025] -- 0:00:32
441500 -- (-432.568) [-432.802] (-434.804) (-433.736) * [-430.078] (-430.682) (-430.025) (-431.917) -- 0:00:32
442000 -- (-432.319) (-436.586) (-435.214) [-431.050] * (-431.205) (-429.821) [-429.484] (-434.833) -- 0:00:32
442500 -- (-433.672) (-430.825) [-431.307] (-433.608) * (-433.557) [-429.604] (-429.875) (-431.715) -- 0:00:32
443000 -- (-433.718) [-429.294] (-431.993) (-438.822) * (-432.924) (-431.115) [-430.468] (-431.809) -- 0:00:32
443500 -- (-433.695) (-429.727) (-429.200) [-430.496] * [-431.101] (-430.208) (-429.661) (-429.980) -- 0:00:32
444000 -- (-431.433) (-430.597) (-428.856) [-429.694] * (-431.192) [-430.577] (-433.591) (-431.555) -- 0:00:32
444500 -- (-430.680) [-432.772] (-431.672) (-431.561) * (-431.196) (-429.678) [-433.478] (-429.558) -- 0:00:32
445000 -- [-432.303] (-431.489) (-429.669) (-431.893) * (-429.738) (-437.819) (-431.581) [-433.332] -- 0:00:32
Average standard deviation of split frequencies: 0.014915
445500 -- (-430.694) (-429.421) (-429.571) [-429.807] * (-432.649) (-429.560) [-431.031] (-432.590) -- 0:00:32
446000 -- (-429.686) (-429.500) [-430.538] (-434.346) * [-431.431] (-431.087) (-433.485) (-434.833) -- 0:00:32
446500 -- (-429.835) (-431.828) [-428.761] (-431.978) * [-430.225] (-430.779) (-430.550) (-433.213) -- 0:00:32
447000 -- [-429.701] (-430.905) (-431.500) (-431.958) * [-432.098] (-431.684) (-429.312) (-430.164) -- 0:00:32
447500 -- (-431.041) [-430.415] (-432.091) (-430.608) * [-432.625] (-430.283) (-435.828) (-431.999) -- 0:00:32
448000 -- (-431.112) (-433.270) [-431.444] (-430.634) * (-430.112) (-429.810) (-429.229) [-430.767] -- 0:00:32
448500 -- (-431.924) (-435.794) [-430.263] (-430.299) * (-436.139) [-434.226] (-431.242) (-434.551) -- 0:00:31
449000 -- (-429.911) [-431.418] (-430.289) (-432.039) * (-432.221) (-429.705) (-429.650) [-432.806] -- 0:00:31
449500 -- (-431.896) (-431.193) (-432.476) [-431.088] * [-429.829] (-430.379) (-429.420) (-431.509) -- 0:00:31
450000 -- (-433.083) [-430.216] (-431.260) (-429.790) * [-432.274] (-431.403) (-431.106) (-433.170) -- 0:00:31
Average standard deviation of split frequencies: 0.015075
450500 -- [-429.284] (-433.918) (-430.037) (-433.902) * (-432.848) (-430.666) (-430.290) [-429.498] -- 0:00:31
451000 -- (-432.305) (-432.640) (-431.379) [-433.965] * (-429.686) (-431.086) (-431.033) [-430.846] -- 0:00:31
451500 -- [-434.179] (-431.537) (-432.657) (-429.342) * [-432.238] (-429.689) (-429.936) (-430.908) -- 0:00:31
452000 -- [-430.502] (-431.116) (-431.037) (-432.442) * (-433.050) (-429.522) (-430.113) [-431.589] -- 0:00:31
452500 -- [-432.569] (-434.534) (-431.880) (-432.315) * (-432.234) (-429.186) [-433.477] (-431.587) -- 0:00:31
453000 -- (-430.348) (-430.197) (-430.094) [-435.144] * [-432.470] (-431.263) (-436.856) (-437.618) -- 0:00:31
453500 -- (-429.622) (-429.929) (-431.350) [-431.795] * [-431.667] (-435.046) (-431.682) (-432.139) -- 0:00:31
454000 -- (-432.453) (-431.041) [-430.946] (-429.893) * (-431.786) [-431.778] (-432.671) (-429.330) -- 0:00:31
454500 -- (-433.725) [-432.155] (-432.174) (-430.742) * (-429.535) (-431.988) [-429.928] (-430.144) -- 0:00:32
455000 -- (-431.783) (-432.912) (-432.843) [-432.493] * (-430.612) [-429.061] (-429.233) (-430.602) -- 0:00:32
Average standard deviation of split frequencies: 0.015507
455500 -- (-430.280) (-430.882) [-430.980] (-433.891) * (-430.129) (-434.537) [-433.589] (-434.132) -- 0:00:32
456000 -- [-430.348] (-435.954) (-431.162) (-431.015) * (-431.556) (-431.749) [-432.821] (-430.779) -- 0:00:32
456500 -- (-429.705) (-432.986) (-433.228) [-433.825] * [-429.965] (-430.091) (-430.064) (-430.839) -- 0:00:32
457000 -- [-428.856] (-436.435) (-430.910) (-430.012) * (-430.054) [-430.021] (-430.833) (-433.650) -- 0:00:32
457500 -- (-430.512) (-431.240) [-432.710] (-433.911) * (-431.820) (-431.467) [-431.472] (-432.160) -- 0:00:32
458000 -- (-435.291) (-432.370) [-430.582] (-430.608) * (-432.550) [-430.236] (-430.341) (-436.986) -- 0:00:31
458500 -- (-430.196) [-431.957] (-435.076) (-430.072) * (-431.951) (-433.464) [-432.291] (-431.344) -- 0:00:31
459000 -- (-430.788) (-437.352) [-431.882] (-431.131) * (-430.282) [-430.467] (-431.410) (-434.787) -- 0:00:31
459500 -- (-430.095) [-432.733] (-436.903) (-433.894) * [-428.792] (-432.739) (-431.393) (-436.883) -- 0:00:31
460000 -- [-430.578] (-430.195) (-431.728) (-429.921) * (-430.847) [-430.599] (-431.396) (-431.943) -- 0:00:31
Average standard deviation of split frequencies: 0.014454
460500 -- (-430.782) (-431.186) [-430.091] (-430.011) * (-434.028) (-431.467) (-430.031) [-430.965] -- 0:00:31
461000 -- [-428.862] (-431.878) (-432.446) (-430.898) * [-429.992] (-430.607) (-430.610) (-431.542) -- 0:00:31
461500 -- (-429.294) [-430.253] (-430.235) (-430.678) * (-432.337) [-431.923] (-432.046) (-433.432) -- 0:00:31
462000 -- [-430.813] (-429.384) (-430.577) (-429.556) * (-430.150) (-435.968) (-433.604) [-431.562] -- 0:00:31
462500 -- (-429.919) (-430.141) (-432.748) [-430.143] * (-431.255) (-431.626) (-430.521) [-431.794] -- 0:00:31
463000 -- [-429.912] (-431.252) (-432.960) (-429.449) * (-429.180) [-432.513] (-431.905) (-432.030) -- 0:00:31
463500 -- (-430.269) (-430.164) [-431.079] (-432.466) * (-431.511) (-432.666) [-431.403] (-435.317) -- 0:00:31
464000 -- (-431.078) (-430.680) (-431.737) [-430.386] * (-432.920) [-429.540] (-431.326) (-430.599) -- 0:00:31
464500 -- (-432.663) (-430.566) [-433.130] (-429.745) * (-433.985) (-430.567) [-429.709] (-433.108) -- 0:00:31
465000 -- (-430.181) [-432.259] (-433.103) (-429.189) * (-432.200) (-430.005) [-429.818] (-429.023) -- 0:00:31
Average standard deviation of split frequencies: 0.015118
465500 -- (-433.078) [-430.875] (-431.171) (-435.051) * (-431.653) (-429.348) [-430.374] (-430.185) -- 0:00:31
466000 -- (-429.061) [-430.258] (-430.750) (-435.122) * (-430.767) (-429.893) [-429.538] (-430.149) -- 0:00:30
466500 -- (-432.930) (-429.918) (-429.709) [-432.368] * (-429.373) (-429.101) [-431.792] (-430.227) -- 0:00:30
467000 -- (-434.375) [-431.615] (-431.501) (-431.027) * (-429.462) (-431.442) [-429.163] (-429.732) -- 0:00:30
467500 -- (-433.566) (-433.576) [-431.566] (-429.765) * [-431.740] (-433.036) (-431.700) (-432.458) -- 0:00:30
468000 -- (-432.157) (-430.778) [-434.112] (-433.567) * (-429.663) (-434.244) [-431.932] (-430.155) -- 0:00:30
468500 -- (-431.360) (-430.532) (-435.232) [-431.128] * (-431.737) [-430.200] (-433.568) (-430.270) -- 0:00:30
469000 -- (-439.407) (-431.804) [-431.578] (-433.648) * (-430.825) (-432.834) (-429.886) [-428.997] -- 0:00:30
469500 -- [-430.972] (-429.584) (-433.233) (-431.258) * (-435.701) (-430.599) (-434.214) [-429.261] -- 0:00:30
470000 -- (-432.132) (-430.504) [-433.381] (-430.665) * (-431.298) (-433.750) (-433.963) [-429.328] -- 0:00:30
Average standard deviation of split frequencies: 0.015495
470500 -- (-429.501) (-430.585) (-430.737) [-433.016] * [-430.890] (-433.955) (-432.562) (-430.937) -- 0:00:30
471000 -- [-432.975] (-431.280) (-432.301) (-429.070) * [-434.318] (-429.896) (-432.093) (-438.182) -- 0:00:30
471500 -- [-430.690] (-430.816) (-431.292) (-432.300) * (-431.591) [-431.303] (-431.175) (-432.806) -- 0:00:30
472000 -- (-431.108) (-429.479) [-434.857] (-431.679) * (-430.337) [-429.899] (-431.851) (-433.588) -- 0:00:31
472500 -- (-430.398) [-430.357] (-429.069) (-435.907) * (-432.649) [-431.595] (-435.456) (-430.061) -- 0:00:31
473000 -- [-429.881] (-431.041) (-429.159) (-431.506) * (-432.179) (-436.737) (-432.314) [-429.403] -- 0:00:31
473500 -- (-431.470) (-429.557) (-432.924) [-430.198] * (-429.824) [-431.176] (-429.443) (-430.052) -- 0:00:31
474000 -- (-432.250) [-430.572] (-432.523) (-430.983) * (-429.079) [-429.601] (-430.027) (-429.490) -- 0:00:31
474500 -- [-435.999] (-435.387) (-430.266) (-431.736) * (-429.978) [-431.329] (-432.052) (-431.264) -- 0:00:31
475000 -- (-430.736) (-430.746) [-429.966] (-432.743) * [-430.384] (-430.455) (-434.386) (-429.962) -- 0:00:30
Average standard deviation of split frequencies: 0.015496
475500 -- [-432.210] (-430.222) (-431.102) (-436.788) * (-432.351) [-430.113] (-429.000) (-430.004) -- 0:00:30
476000 -- (-434.055) [-430.866] (-430.948) (-432.355) * (-430.088) [-431.285] (-429.454) (-432.830) -- 0:00:30
476500 -- (-431.188) (-429.661) (-432.011) [-429.877] * (-428.876) (-430.603) (-431.391) [-432.446] -- 0:00:30
477000 -- (-429.611) [-430.299] (-432.299) (-429.814) * (-431.153) (-432.554) [-431.227] (-432.113) -- 0:00:30
477500 -- (-431.812) (-429.538) [-433.203] (-432.154) * (-432.514) (-431.469) (-430.869) [-428.888] -- 0:00:30
478000 -- (-430.793) (-429.866) (-438.225) [-430.074] * (-430.362) [-430.564] (-432.139) (-430.792) -- 0:00:30
478500 -- (-429.091) [-431.341] (-429.923) (-429.105) * (-430.613) [-432.362] (-431.872) (-432.748) -- 0:00:30
479000 -- (-432.771) (-429.636) [-428.878] (-429.686) * (-431.916) (-432.245) [-431.788] (-432.803) -- 0:00:30
479500 -- (-429.083) [-431.881] (-431.149) (-430.120) * (-433.682) [-432.885] (-432.487) (-430.382) -- 0:00:30
480000 -- (-429.067) (-431.629) [-430.833] (-430.661) * [-434.765] (-430.694) (-431.067) (-433.447) -- 0:00:30
Average standard deviation of split frequencies: 0.015403
480500 -- [-433.486] (-435.642) (-435.901) (-429.814) * (-431.508) (-431.430) (-431.434) [-430.835] -- 0:00:30
481000 -- (-433.360) (-429.858) (-431.219) [-430.924] * (-435.882) (-429.969) [-431.192] (-436.881) -- 0:00:30
481500 -- (-429.571) (-432.869) [-431.850] (-430.675) * (-430.520) [-437.447] (-429.603) (-430.862) -- 0:00:30
482000 -- [-429.196] (-431.259) (-430.169) (-429.929) * (-431.382) (-433.485) (-430.121) [-432.314] -- 0:00:30
482500 -- [-428.891] (-437.855) (-429.088) (-429.616) * (-436.070) [-431.006] (-430.659) (-433.210) -- 0:00:30
483000 -- [-429.130] (-433.455) (-432.013) (-430.888) * [-430.400] (-432.754) (-431.688) (-434.293) -- 0:00:29
483500 -- [-429.452] (-430.934) (-430.676) (-431.598) * (-433.039) (-431.013) (-433.486) [-432.342] -- 0:00:29
484000 -- [-430.471] (-430.896) (-429.105) (-431.275) * (-431.724) (-432.115) [-433.415] (-429.875) -- 0:00:29
484500 -- [-432.956] (-433.827) (-429.159) (-434.411) * (-430.944) (-432.860) (-432.070) [-430.585] -- 0:00:29
485000 -- (-432.462) [-432.331] (-430.897) (-431.912) * (-433.203) (-430.529) (-430.815) [-432.239] -- 0:00:29
Average standard deviation of split frequencies: 0.015748
485500 -- (-434.312) (-429.354) (-433.218) [-431.085] * (-429.176) (-429.673) [-430.277] (-430.893) -- 0:00:29
486000 -- (-432.227) [-429.214] (-438.296) (-434.746) * (-432.384) [-429.873] (-431.275) (-429.395) -- 0:00:29
486500 -- (-433.839) [-429.152] (-432.508) (-430.768) * (-434.652) (-432.426) (-429.675) [-431.743] -- 0:00:29
487000 -- (-431.123) [-431.560] (-433.573) (-430.544) * (-433.281) (-431.227) [-432.220] (-429.589) -- 0:00:29
487500 -- (-429.638) [-432.582] (-429.829) (-433.716) * [-430.757] (-433.281) (-436.428) (-429.423) -- 0:00:29
488000 -- (-431.510) [-429.375] (-430.977) (-429.948) * [-431.757] (-430.557) (-433.709) (-432.112) -- 0:00:29
488500 -- (-430.163) (-429.919) (-431.751) [-430.161] * (-432.031) (-432.576) [-429.359] (-432.170) -- 0:00:29
489000 -- (-432.531) (-433.165) (-431.127) [-432.099] * (-429.752) (-429.476) [-429.828] (-431.361) -- 0:00:29
489500 -- (-431.089) (-431.391) (-432.924) [-433.289] * (-429.507) (-431.697) [-428.761] (-430.247) -- 0:00:30
490000 -- [-431.995] (-429.196) (-430.765) (-434.303) * (-430.073) (-433.044) [-429.017] (-428.869) -- 0:00:30
Average standard deviation of split frequencies: 0.015994
490500 -- (-434.573) (-429.665) [-431.844] (-431.349) * (-429.819) (-433.037) [-430.085] (-429.867) -- 0:00:30
491000 -- [-431.966] (-434.964) (-430.652) (-433.853) * (-436.896) (-432.770) [-432.151] (-433.615) -- 0:00:30
491500 -- (-432.064) (-431.700) [-429.366] (-433.215) * (-432.153) [-430.816] (-432.860) (-433.393) -- 0:00:30
492000 -- (-432.603) (-433.817) [-429.377] (-435.739) * (-437.370) (-431.981) [-431.647] (-432.493) -- 0:00:29
492500 -- (-430.702) (-430.130) (-430.585) [-429.402] * (-434.164) (-430.517) [-429.176] (-434.459) -- 0:00:29
493000 -- (-432.220) [-429.716] (-430.188) (-429.442) * (-435.324) (-430.788) [-434.033] (-431.287) -- 0:00:29
493500 -- [-432.588] (-430.472) (-432.219) (-428.856) * (-431.913) (-432.187) (-431.464) [-431.874] -- 0:00:29
494000 -- [-435.852] (-430.495) (-432.791) (-429.699) * (-434.343) (-432.638) (-430.627) [-429.671] -- 0:00:29
494500 -- (-431.629) [-432.621] (-432.580) (-433.930) * (-431.148) (-432.022) [-430.936] (-431.180) -- 0:00:29
495000 -- [-432.634] (-432.569) (-434.041) (-430.615) * (-433.000) (-433.215) (-430.139) [-429.230] -- 0:00:29
Average standard deviation of split frequencies: 0.015933
495500 -- (-430.204) (-431.953) [-431.655] (-430.655) * (-433.154) (-429.905) (-431.253) [-430.128] -- 0:00:29
496000 -- (-431.462) (-432.120) (-432.792) [-429.105] * [-429.938] (-430.234) (-430.500) (-431.839) -- 0:00:29
496500 -- [-433.937] (-430.016) (-429.922) (-433.531) * (-431.837) [-430.234] (-429.596) (-433.297) -- 0:00:29
497000 -- (-430.336) [-433.112] (-430.393) (-431.461) * (-432.874) (-431.460) [-431.466] (-431.423) -- 0:00:29
497500 -- [-429.927] (-430.430) (-429.374) (-430.184) * [-431.281] (-434.710) (-431.265) (-433.271) -- 0:00:29
498000 -- (-431.521) (-432.068) (-432.002) [-431.171] * (-429.884) (-429.705) [-431.314] (-431.474) -- 0:00:29
498500 -- (-431.826) [-430.312] (-431.982) (-430.238) * (-430.879) (-431.673) (-434.945) [-432.276] -- 0:00:29
499000 -- (-431.222) (-434.654) [-432.993] (-434.645) * (-431.846) (-432.591) (-429.891) [-430.412] -- 0:00:29
499500 -- (-431.468) [-432.750] (-432.406) (-432.123) * [-429.363] (-429.321) (-433.535) (-431.528) -- 0:00:29
500000 -- (-430.052) (-431.383) [-432.263] (-434.266) * (-432.308) [-429.471] (-436.345) (-431.279) -- 0:00:29
Average standard deviation of split frequencies: 0.015674
500500 -- (-432.009) [-432.343] (-432.789) (-430.046) * (-433.942) (-431.322) [-432.368] (-433.201) -- 0:00:28
501000 -- (-437.257) (-430.860) [-430.007] (-430.443) * (-433.923) [-431.019] (-432.006) (-430.377) -- 0:00:28
501500 -- (-428.931) (-430.855) (-429.088) [-429.247] * (-430.436) [-434.637] (-432.231) (-430.087) -- 0:00:28
502000 -- [-431.644] (-433.050) (-434.131) (-431.856) * (-430.966) (-431.505) (-433.993) [-434.985] -- 0:00:28
502500 -- (-431.031) (-436.075) (-430.733) [-430.823] * (-440.920) [-433.251] (-430.838) (-434.281) -- 0:00:28
503000 -- (-433.504) [-431.345] (-429.329) (-430.944) * (-434.913) (-432.716) (-430.739) [-429.248] -- 0:00:28
503500 -- (-431.370) (-432.926) (-430.338) [-429.850] * (-433.433) [-430.541] (-433.408) (-435.041) -- 0:00:28
504000 -- [-429.518] (-430.893) (-429.779) (-429.493) * (-434.619) (-431.116) [-431.308] (-431.470) -- 0:00:28
504500 -- (-428.849) (-432.311) [-430.894] (-430.235) * (-431.389) (-433.452) [-430.914] (-430.831) -- 0:00:28
505000 -- (-428.888) (-432.782) (-431.365) [-432.240] * (-430.212) (-434.467) (-429.281) [-429.800] -- 0:00:28
Average standard deviation of split frequencies: 0.015605
505500 -- (-433.618) (-434.969) (-430.721) [-432.411] * [-434.952] (-435.169) (-430.579) (-432.805) -- 0:00:28
506000 -- (-432.187) (-429.472) (-430.902) [-431.707] * [-429.939] (-429.669) (-434.790) (-434.512) -- 0:00:28
506500 -- (-433.351) (-430.033) (-430.081) [-431.387] * (-429.235) [-429.715] (-432.522) (-430.783) -- 0:00:29
507000 -- (-431.289) [-430.504] (-430.694) (-433.016) * (-429.817) (-428.754) (-431.579) [-431.004] -- 0:00:29
507500 -- (-433.765) (-430.995) (-432.998) [-430.520] * (-429.550) (-430.767) (-433.537) [-429.780] -- 0:00:29
508000 -- (-431.697) [-430.114] (-429.244) (-434.078) * (-431.962) [-432.620] (-431.580) (-436.710) -- 0:00:29
508500 -- [-429.820] (-433.494) (-430.659) (-430.986) * (-430.479) (-431.452) (-430.449) [-432.180] -- 0:00:28
509000 -- (-430.321) [-429.614] (-429.528) (-430.808) * [-430.638] (-432.618) (-430.814) (-431.025) -- 0:00:28
509500 -- (-430.974) (-428.910) [-431.092] (-430.694) * (-431.664) (-430.571) [-430.885] (-429.926) -- 0:00:28
510000 -- (-434.696) (-432.336) (-432.979) [-431.208] * (-429.598) [-432.678] (-432.645) (-430.787) -- 0:00:28
Average standard deviation of split frequencies: 0.015520
510500 -- [-430.768] (-430.904) (-431.202) (-431.344) * (-431.350) [-431.870] (-429.552) (-431.932) -- 0:00:28
511000 -- [-431.191] (-429.415) (-430.398) (-430.820) * (-434.224) (-431.823) [-430.557] (-429.672) -- 0:00:28
511500 -- (-430.777) (-433.783) [-432.091] (-430.096) * (-431.080) (-435.743) [-431.463] (-429.417) -- 0:00:28
512000 -- (-430.905) (-435.085) (-429.637) [-435.138] * (-429.629) [-429.866] (-433.876) (-429.379) -- 0:00:28
512500 -- [-430.737] (-432.124) (-431.645) (-434.427) * (-430.663) [-428.718] (-431.251) (-430.137) -- 0:00:28
513000 -- (-433.289) (-431.333) (-431.060) [-430.555] * (-431.177) (-429.391) [-430.137] (-431.561) -- 0:00:28
513500 -- (-429.826) (-433.286) (-430.422) [-433.380] * (-431.967) (-432.460) (-432.243) [-433.938] -- 0:00:28
514000 -- (-429.258) (-435.673) (-432.982) [-431.103] * [-429.892] (-429.705) (-434.500) (-433.522) -- 0:00:28
514500 -- (-429.607) (-432.903) [-430.690] (-429.629) * [-430.434] (-435.854) (-434.775) (-434.494) -- 0:00:28
515000 -- (-431.341) (-434.143) [-430.777] (-431.488) * [-430.057] (-433.073) (-431.195) (-431.360) -- 0:00:28
Average standard deviation of split frequencies: 0.016102
515500 -- (-433.014) (-432.171) [-429.087] (-429.968) * [-429.005] (-431.268) (-436.632) (-432.504) -- 0:00:28
516000 -- [-430.028] (-432.514) (-433.236) (-436.591) * (-430.551) (-430.175) (-431.043) [-433.617] -- 0:00:28
516500 -- (-434.118) (-430.770) (-432.311) [-430.562] * (-430.250) [-429.851] (-430.903) (-430.038) -- 0:00:28
517000 -- (-430.629) (-431.015) (-429.412) [-432.938] * [-431.303] (-430.435) (-431.885) (-429.888) -- 0:00:28
517500 -- [-429.475] (-430.615) (-429.763) (-430.092) * [-429.411] (-429.310) (-431.553) (-431.417) -- 0:00:27
518000 -- (-431.274) [-430.148] (-429.552) (-431.646) * [-431.642] (-430.093) (-431.188) (-431.836) -- 0:00:27
518500 -- (-429.189) (-432.293) (-430.106) [-429.582] * (-431.236) (-429.970) (-429.111) [-429.827] -- 0:00:27
519000 -- (-433.006) (-431.427) (-431.714) [-432.235] * (-429.752) (-433.143) [-430.552] (-431.187) -- 0:00:27
519500 -- (-429.725) [-432.047] (-433.986) (-431.421) * (-440.542) (-430.775) (-433.976) [-430.095] -- 0:00:27
520000 -- (-431.687) [-431.384] (-430.854) (-430.660) * (-430.365) [-430.267] (-430.886) (-432.473) -- 0:00:27
Average standard deviation of split frequencies: 0.015844
520500 -- (-430.253) (-431.665) [-430.614] (-432.556) * (-430.125) (-430.194) (-431.729) [-432.542] -- 0:00:27
521000 -- (-434.325) (-430.031) [-429.546] (-431.753) * [-430.052] (-432.247) (-433.113) (-434.468) -- 0:00:27
521500 -- (-429.445) [-431.158] (-430.097) (-431.558) * [-429.539] (-430.645) (-429.554) (-431.073) -- 0:00:27
522000 -- (-430.732) [-431.120] (-430.069) (-430.219) * (-430.188) (-431.008) [-429.365] (-430.578) -- 0:00:27
522500 -- (-432.304) (-429.507) (-430.730) [-432.437] * [-429.765] (-431.701) (-431.077) (-430.583) -- 0:00:27
523000 -- [-430.010] (-429.984) (-429.732) (-435.457) * (-431.209) (-431.108) [-432.678] (-431.197) -- 0:00:27
523500 -- (-430.984) (-429.275) [-433.674] (-432.495) * (-430.523) [-430.374] (-434.013) (-432.856) -- 0:00:27
524000 -- (-429.981) [-432.911] (-431.442) (-430.798) * (-431.223) (-431.753) [-434.382] (-431.959) -- 0:00:28
524500 -- [-432.212] (-429.103) (-432.831) (-431.134) * (-430.403) (-431.199) [-434.275] (-432.542) -- 0:00:28
525000 -- (-430.115) [-430.877] (-430.945) (-430.749) * (-431.147) (-437.418) (-437.275) [-430.098] -- 0:00:28
Average standard deviation of split frequencies: 0.016343
525500 -- [-431.921] (-429.932) (-430.036) (-433.434) * [-429.284] (-430.309) (-433.280) (-430.578) -- 0:00:27
526000 -- (-435.580) (-430.294) (-431.034) [-431.908] * [-431.366] (-431.320) (-430.702) (-432.145) -- 0:00:27
526500 -- (-429.849) (-429.586) (-432.971) [-430.096] * (-432.846) (-429.909) [-430.707] (-433.195) -- 0:00:27
527000 -- (-432.498) (-435.607) [-432.211] (-430.081) * (-436.577) [-430.254] (-433.234) (-431.723) -- 0:00:27
527500 -- [-430.326] (-429.868) (-434.207) (-434.047) * (-431.705) (-430.273) (-434.993) [-432.636] -- 0:00:27
528000 -- [-431.390] (-429.587) (-431.338) (-431.974) * (-431.508) (-430.842) (-429.411) [-431.245] -- 0:00:27
528500 -- [-429.925] (-430.063) (-435.146) (-431.290) * (-429.907) (-431.227) (-429.790) [-430.994] -- 0:00:27
529000 -- (-430.897) (-429.883) (-434.164) [-432.177] * [-429.675] (-434.891) (-431.502) (-430.687) -- 0:00:27
529500 -- (-431.267) (-430.240) (-429.005) [-430.205] * [-430.733] (-432.820) (-431.365) (-429.891) -- 0:00:27
530000 -- (-428.798) (-432.602) [-430.241] (-430.145) * (-429.359) (-431.915) (-433.058) [-429.332] -- 0:00:27
Average standard deviation of split frequencies: 0.016565
530500 -- [-433.326] (-429.591) (-430.599) (-429.593) * (-431.313) [-430.352] (-431.841) (-430.509) -- 0:00:27
531000 -- (-432.531) (-429.786) (-432.547) [-431.852] * (-433.633) (-433.051) (-432.379) [-430.056] -- 0:00:27
531500 -- (-434.727) (-430.884) (-432.688) [-429.843] * (-430.334) (-430.956) (-430.313) [-430.431] -- 0:00:27
532000 -- [-429.460] (-430.764) (-431.096) (-431.790) * (-430.262) (-433.337) [-429.482] (-430.389) -- 0:00:27
532500 -- [-431.316] (-430.307) (-430.577) (-430.985) * (-429.151) (-433.005) [-431.085] (-433.829) -- 0:00:27
533000 -- [-430.254] (-430.309) (-432.890) (-434.213) * [-434.525] (-432.018) (-430.898) (-430.986) -- 0:00:27
533500 -- [-430.014] (-432.964) (-430.397) (-434.945) * (-433.500) (-431.985) [-429.208] (-431.733) -- 0:00:27
534000 -- (-429.259) [-431.415] (-430.583) (-430.114) * (-434.434) (-433.142) (-431.209) [-430.092] -- 0:00:27
534500 -- [-429.660] (-432.238) (-433.463) (-433.928) * (-430.722) (-433.050) (-434.451) [-432.328] -- 0:00:26
535000 -- (-430.628) (-430.537) [-430.607] (-430.316) * (-433.641) (-430.254) [-430.913] (-435.965) -- 0:00:26
Average standard deviation of split frequencies: 0.016762
535500 -- (-430.270) (-431.392) [-429.508] (-431.568) * [-432.446] (-429.815) (-434.002) (-430.355) -- 0:00:26
536000 -- (-432.379) (-431.112) [-430.162] (-431.029) * (-429.710) (-432.620) (-429.210) [-429.890] -- 0:00:26
536500 -- (-429.738) (-435.283) (-432.163) [-431.770] * [-428.702] (-429.348) (-431.194) (-433.810) -- 0:00:26
537000 -- [-431.529] (-429.340) (-431.609) (-437.348) * (-430.172) [-431.535] (-433.089) (-434.469) -- 0:00:26
537500 -- (-435.192) (-430.762) [-430.559] (-429.175) * [-433.963] (-431.988) (-432.830) (-431.861) -- 0:00:26
538000 -- (-431.566) [-428.994] (-429.718) (-432.615) * [-431.950] (-431.556) (-430.637) (-432.306) -- 0:00:26
538500 -- (-432.531) (-431.149) [-429.199] (-432.010) * [-432.108] (-431.488) (-430.324) (-432.260) -- 0:00:26
539000 -- [-430.833] (-432.080) (-431.320) (-432.578) * [-431.621] (-430.452) (-434.917) (-430.152) -- 0:00:26
539500 -- [-430.743] (-430.516) (-431.345) (-432.394) * (-430.527) (-432.079) (-430.005) [-432.600] -- 0:00:26
540000 -- [-430.644] (-428.920) (-430.490) (-430.431) * [-430.866] (-431.316) (-434.036) (-434.829) -- 0:00:26
Average standard deviation of split frequencies: 0.016457
540500 -- (-434.266) (-430.270) (-431.991) [-429.282] * [-430.723] (-434.084) (-431.210) (-431.483) -- 0:00:26
541000 -- (-430.786) [-429.552] (-431.252) (-429.745) * (-431.113) (-430.177) [-432.612] (-431.392) -- 0:00:27
541500 -- (-429.232) [-431.123] (-433.213) (-431.647) * (-433.596) (-429.727) (-430.358) [-430.913] -- 0:00:27
542000 -- (-429.834) (-433.347) (-431.965) [-429.998] * (-430.744) (-430.492) [-430.238] (-430.613) -- 0:00:27
542500 -- [-431.287] (-430.765) (-433.222) (-431.433) * (-431.816) [-429.802] (-431.274) (-430.290) -- 0:00:26
543000 -- (-435.031) [-431.799] (-431.976) (-430.961) * (-434.101) (-431.143) [-429.383] (-431.651) -- 0:00:26
543500 -- (-429.229) [-430.373] (-429.604) (-433.132) * (-431.953) (-430.864) [-430.428] (-431.106) -- 0:00:26
544000 -- [-429.176] (-434.227) (-430.478) (-431.518) * [-435.429] (-431.509) (-429.512) (-432.452) -- 0:00:26
544500 -- (-429.743) [-429.026] (-430.295) (-437.041) * (-430.544) (-432.316) (-431.806) [-431.412] -- 0:00:26
545000 -- (-429.901) (-434.200) [-430.308] (-430.858) * (-431.283) (-431.660) (-430.496) [-431.093] -- 0:00:26
Average standard deviation of split frequencies: 0.016861
545500 -- [-429.953] (-429.702) (-429.777) (-432.532) * (-431.874) [-431.104] (-429.759) (-429.427) -- 0:00:26
546000 -- (-432.392) (-431.573) (-431.506) [-430.920] * [-432.964] (-431.184) (-432.986) (-429.301) -- 0:00:26
546500 -- (-434.250) (-431.180) (-430.028) [-431.011] * (-434.218) [-431.622] (-431.867) (-429.684) -- 0:00:26
547000 -- (-433.251) [-431.308] (-429.002) (-429.629) * (-432.930) [-431.549] (-431.630) (-429.319) -- 0:00:26
547500 -- (-430.945) (-430.939) [-430.106] (-431.090) * (-431.580) (-429.970) [-431.252] (-431.971) -- 0:00:26
548000 -- (-429.793) (-434.514) [-429.887] (-431.154) * (-432.284) [-432.493] (-435.470) (-432.410) -- 0:00:26
548500 -- [-432.325] (-430.518) (-431.937) (-430.704) * (-433.443) (-429.269) [-432.083] (-430.791) -- 0:00:26
549000 -- (-433.693) [-430.929] (-432.056) (-430.917) * [-432.076] (-431.683) (-431.420) (-431.971) -- 0:00:26
549500 -- [-431.477] (-430.109) (-433.092) (-429.418) * (-430.588) [-430.927] (-432.048) (-429.305) -- 0:00:26
550000 -- [-430.142] (-429.558) (-429.708) (-429.995) * (-430.449) (-433.067) (-432.807) [-429.066] -- 0:00:26
Average standard deviation of split frequencies: 0.017787
550500 -- [-433.202] (-432.523) (-430.277) (-430.435) * (-432.215) [-432.416] (-431.554) (-435.278) -- 0:00:26
551000 -- (-434.694) (-434.540) [-432.714] (-431.746) * [-429.144] (-430.334) (-434.398) (-435.218) -- 0:00:26
551500 -- (-430.783) (-434.203) [-430.683] (-429.325) * (-430.155) (-432.623) [-432.882] (-432.140) -- 0:00:26
552000 -- (-431.178) [-430.360] (-431.183) (-429.563) * (-430.593) [-431.633] (-435.200) (-432.239) -- 0:00:25
552500 -- (-430.407) (-429.672) [-430.748] (-430.408) * (-434.267) [-429.915] (-431.227) (-432.102) -- 0:00:25
553000 -- (-429.612) [-433.197] (-431.106) (-430.487) * (-431.128) [-433.137] (-431.552) (-431.667) -- 0:00:25
553500 -- (-429.914) [-431.669] (-432.333) (-430.363) * [-431.476] (-429.052) (-432.859) (-431.080) -- 0:00:25
554000 -- [-431.387] (-430.551) (-432.300) (-429.875) * (-431.539) (-431.733) (-431.054) [-431.953] -- 0:00:25
554500 -- (-429.962) (-434.022) (-430.455) [-429.839] * (-429.787) [-429.959] (-430.431) (-430.427) -- 0:00:25
555000 -- (-433.400) [-430.046] (-432.878) (-429.644) * (-431.906) [-430.433] (-436.011) (-429.707) -- 0:00:25
Average standard deviation of split frequencies: 0.017475
555500 -- (-433.858) (-430.041) (-432.496) [-431.717] * (-432.824) (-431.569) (-429.939) [-431.368] -- 0:00:25
556000 -- (-431.527) (-430.847) [-431.252] (-431.354) * (-431.038) (-430.650) (-432.317) [-429.178] -- 0:00:25
556500 -- (-431.308) (-431.422) [-431.543] (-429.660) * (-429.904) (-433.980) (-433.689) [-429.848] -- 0:00:25
557000 -- [-431.178] (-431.698) (-430.690) (-434.714) * (-431.476) (-438.557) [-431.468] (-432.852) -- 0:00:25
557500 -- (-432.279) (-431.104) (-431.728) [-430.812] * (-433.975) [-433.014] (-429.954) (-432.494) -- 0:00:25
558000 -- (-438.226) (-433.693) (-432.287) [-433.722] * (-431.026) [-430.562] (-433.252) (-430.922) -- 0:00:25
558500 -- (-433.650) (-433.276) (-429.886) [-431.132] * (-431.148) (-432.799) [-432.221] (-430.065) -- 0:00:26
559000 -- (-435.720) (-431.644) [-431.787] (-429.801) * (-430.428) (-433.900) (-433.160) [-430.096] -- 0:00:26
559500 -- (-432.825) (-432.916) (-432.615) [-430.003] * (-432.007) (-431.031) (-431.701) [-429.904] -- 0:00:25
560000 -- (-429.479) (-431.553) [-431.889] (-433.423) * (-429.341) (-429.440) [-432.378] (-430.514) -- 0:00:25
Average standard deviation of split frequencies: 0.018170
560500 -- [-429.185] (-432.032) (-430.448) (-430.115) * (-431.315) [-435.389] (-432.699) (-430.146) -- 0:00:25
561000 -- (-429.201) (-435.636) [-430.055] (-429.376) * (-430.841) (-432.364) (-430.117) [-433.378] -- 0:00:25
561500 -- (-431.241) (-433.616) [-429.938] (-430.823) * (-436.087) [-432.380] (-430.485) (-433.132) -- 0:00:25
562000 -- (-429.997) (-431.998) (-433.179) [-431.236] * (-431.084) (-433.830) (-431.276) [-433.482] -- 0:00:25
562500 -- (-430.854) (-429.722) (-430.249) [-430.984] * (-433.002) (-432.284) [-429.286] (-433.148) -- 0:00:25
563000 -- (-431.203) [-429.687] (-430.016) (-430.252) * (-430.154) [-432.303] (-433.203) (-437.059) -- 0:00:25
563500 -- (-433.709) (-429.209) (-431.285) [-429.837] * (-433.694) (-431.342) (-429.573) [-430.921] -- 0:00:25
564000 -- (-433.783) (-432.278) (-433.443) [-430.003] * (-433.273) [-430.386] (-430.008) (-429.666) -- 0:00:25
564500 -- (-433.229) [-432.768] (-431.913) (-431.380) * (-435.662) [-429.635] (-429.269) (-435.675) -- 0:00:25
565000 -- (-430.617) (-430.610) [-432.644] (-429.699) * (-432.777) (-430.940) [-432.418] (-434.486) -- 0:00:25
Average standard deviation of split frequencies: 0.018761
565500 -- [-430.800] (-431.326) (-436.492) (-431.960) * [-430.990] (-430.175) (-431.017) (-432.245) -- 0:00:25
566000 -- (-431.188) (-429.575) (-430.931) [-432.042] * [-430.795] (-432.288) (-430.344) (-430.791) -- 0:00:25
566500 -- (-430.945) (-432.130) (-438.890) [-433.093] * [-432.548] (-433.037) (-429.986) (-432.415) -- 0:00:25
567000 -- [-430.892] (-432.038) (-434.287) (-436.243) * (-431.987) (-431.900) [-429.802] (-430.155) -- 0:00:25
567500 -- (-433.167) [-430.235] (-431.128) (-435.293) * (-430.886) (-437.338) [-431.364] (-431.873) -- 0:00:25
568000 -- [-429.801] (-431.203) (-430.369) (-430.897) * (-430.174) (-431.292) (-430.106) [-432.660] -- 0:00:25
568500 -- (-431.903) (-434.328) [-430.549] (-430.682) * (-431.362) (-431.326) (-429.948) [-429.761] -- 0:00:25
569000 -- (-432.402) (-430.680) [-434.020] (-431.691) * (-429.136) [-433.095] (-431.051) (-429.891) -- 0:00:24
569500 -- (-429.918) [-430.358] (-435.658) (-430.829) * [-432.171] (-429.919) (-428.785) (-429.511) -- 0:00:24
570000 -- [-430.082] (-432.604) (-430.781) (-432.411) * (-431.761) [-430.324] (-429.644) (-429.659) -- 0:00:24
Average standard deviation of split frequencies: 0.018816
570500 -- [-430.468] (-434.179) (-433.108) (-430.760) * [-431.047] (-433.193) (-433.238) (-433.005) -- 0:00:24
571000 -- (-432.435) (-433.035) [-430.168] (-431.038) * (-433.434) [-429.585] (-433.428) (-434.580) -- 0:00:24
571500 -- (-434.131) (-431.554) [-429.573] (-431.951) * [-431.910] (-432.351) (-430.584) (-431.269) -- 0:00:24
572000 -- (-430.909) [-431.308] (-434.603) (-437.032) * [-430.282] (-432.347) (-431.471) (-431.196) -- 0:00:24
572500 -- [-429.329] (-430.224) (-429.942) (-434.005) * [-433.020] (-429.737) (-430.397) (-429.707) -- 0:00:24
573000 -- (-433.724) (-435.345) [-430.171] (-430.895) * (-432.451) (-431.634) (-430.740) [-430.478] -- 0:00:24
573500 -- (-430.199) [-431.781] (-429.270) (-433.818) * (-429.797) (-441.606) [-430.580] (-432.045) -- 0:00:24
574000 -- (-430.471) (-431.751) [-429.308] (-431.791) * (-430.741) (-434.619) (-433.327) [-431.083] -- 0:00:24
574500 -- [-431.009] (-430.046) (-433.787) (-430.861) * (-431.776) (-431.709) (-429.606) [-430.316] -- 0:00:24
575000 -- [-436.720] (-429.721) (-431.011) (-431.662) * [-432.422] (-430.402) (-430.401) (-431.197) -- 0:00:24
Average standard deviation of split frequencies: 0.019005
575500 -- (-430.367) (-430.556) [-430.437] (-431.350) * (-432.983) (-435.456) (-430.482) [-432.160] -- 0:00:25
576000 -- (-431.520) (-431.449) (-432.995) [-430.862] * (-433.737) [-431.388] (-430.599) (-431.688) -- 0:00:25
576500 -- (-430.796) (-435.324) [-429.799] (-430.098) * [-432.478] (-429.736) (-431.294) (-430.734) -- 0:00:24
577000 -- (-433.935) (-434.977) (-430.122) [-434.431] * (-431.534) [-431.806] (-429.518) (-432.464) -- 0:00:24
577500 -- (-430.346) (-430.618) [-431.044] (-430.088) * [-431.585] (-431.512) (-431.433) (-432.842) -- 0:00:24
578000 -- [-429.783] (-432.812) (-429.558) (-431.339) * (-431.447) [-433.064] (-430.212) (-430.876) -- 0:00:24
578500 -- (-429.735) (-433.374) (-433.735) [-432.097] * (-431.118) (-430.714) [-430.726] (-430.321) -- 0:00:24
579000 -- [-432.045] (-429.804) (-431.070) (-430.348) * (-430.757) (-431.221) [-430.524] (-433.480) -- 0:00:24
579500 -- (-430.348) (-430.724) (-439.910) [-432.233] * [-433.332] (-435.208) (-430.151) (-431.850) -- 0:00:24
580000 -- (-429.635) (-431.981) [-431.529] (-430.679) * (-431.315) (-431.223) [-430.950] (-430.399) -- 0:00:24
Average standard deviation of split frequencies: 0.018537
580500 -- (-430.844) (-431.084) (-429.431) [-429.048] * (-433.622) (-431.088) [-429.819] (-431.520) -- 0:00:24
581000 -- (-431.932) (-432.111) [-434.061] (-430.018) * (-435.319) [-430.965] (-431.893) (-431.261) -- 0:00:24
581500 -- (-431.305) [-430.118] (-434.801) (-437.376) * (-431.639) (-432.422) (-433.069) [-432.150] -- 0:00:24
582000 -- (-430.369) (-429.690) (-431.381) [-434.182] * (-431.464) [-431.342] (-429.097) (-430.851) -- 0:00:24
582500 -- (-430.310) (-429.343) [-430.224] (-429.519) * (-430.813) [-431.141] (-429.789) (-430.321) -- 0:00:24
583000 -- [-433.705] (-431.528) (-430.115) (-430.469) * [-430.702] (-432.740) (-429.913) (-431.492) -- 0:00:24
583500 -- (-431.709) (-430.025) (-431.373) [-431.254] * [-429.933] (-430.238) (-429.261) (-429.867) -- 0:00:24
584000 -- (-431.860) (-430.242) [-431.060] (-433.578) * (-430.131) [-430.828] (-430.274) (-430.456) -- 0:00:24
584500 -- (-429.848) (-436.207) (-433.829) [-431.069] * [-431.736] (-430.622) (-431.138) (-433.747) -- 0:00:24
585000 -- [-432.182] (-431.584) (-432.152) (-431.363) * (-435.672) [-430.000] (-430.049) (-430.689) -- 0:00:24
Average standard deviation of split frequencies: 0.018770
585500 -- (-433.249) (-431.834) (-433.159) [-430.760] * (-432.887) [-430.326] (-430.005) (-441.812) -- 0:00:24
586000 -- (-432.233) (-430.096) (-429.977) [-431.839] * (-431.189) (-431.964) [-429.681] (-432.264) -- 0:00:24
586500 -- (-432.534) (-430.856) [-430.013] (-434.186) * (-433.102) (-430.665) [-434.315] (-429.849) -- 0:00:23
587000 -- (-429.672) [-433.499] (-430.454) (-432.148) * (-429.715) (-435.439) [-435.111] (-431.704) -- 0:00:23
587500 -- (-429.803) (-430.525) (-431.220) [-431.690] * (-429.789) [-433.041] (-432.476) (-433.721) -- 0:00:23
588000 -- (-428.940) [-429.785] (-431.335) (-430.595) * (-433.395) (-430.605) (-430.778) [-432.960] -- 0:00:23
588500 -- (-432.965) [-431.860] (-431.853) (-428.802) * (-431.887) [-429.739] (-432.329) (-440.001) -- 0:00:23
589000 -- (-433.240) (-429.775) [-433.045] (-429.536) * [-431.449] (-430.171) (-430.361) (-430.381) -- 0:00:23
589500 -- (-430.148) (-429.094) [-430.676] (-430.376) * (-429.717) [-432.670] (-433.950) (-430.695) -- 0:00:23
590000 -- (-431.315) [-431.139] (-431.858) (-431.716) * [-431.641] (-432.895) (-430.546) (-429.770) -- 0:00:23
Average standard deviation of split frequencies: 0.018356
590500 -- (-431.521) [-431.059] (-429.911) (-436.301) * (-430.375) (-430.105) (-430.704) [-430.511] -- 0:00:23
591000 -- (-433.213) (-429.807) (-429.277) [-435.552] * (-431.293) (-435.745) (-432.709) [-430.000] -- 0:00:23
591500 -- (-433.328) [-429.589] (-430.895) (-431.881) * (-432.860) (-430.561) [-435.273] (-429.609) -- 0:00:23
592000 -- (-436.600) (-430.675) (-435.198) [-430.655] * (-431.152) (-432.448) [-430.435] (-434.227) -- 0:00:23
592500 -- [-432.386] (-430.304) (-429.865) (-437.576) * (-428.989) [-431.834] (-430.414) (-431.240) -- 0:00:24
593000 -- (-436.274) (-435.523) (-429.661) [-436.698] * [-429.083] (-430.913) (-433.825) (-429.454) -- 0:00:24
593500 -- [-431.210] (-429.442) (-431.097) (-432.265) * (-429.631) [-429.546] (-434.514) (-432.980) -- 0:00:23
594000 -- (-429.345) (-434.885) [-433.579] (-431.964) * (-430.706) (-431.721) (-430.610) [-432.480] -- 0:00:23
594500 -- (-429.890) (-429.461) (-432.950) [-432.160] * (-429.139) (-430.072) (-435.814) [-433.813] -- 0:00:23
595000 -- (-433.345) (-430.221) (-430.572) [-431.867] * [-429.734] (-429.630) (-431.144) (-431.223) -- 0:00:23
Average standard deviation of split frequencies: 0.017752
595500 -- (-431.448) (-430.660) [-429.829] (-430.164) * (-429.795) [-431.157] (-430.122) (-431.437) -- 0:00:23
596000 -- (-429.935) (-431.257) (-429.529) [-429.648] * (-431.050) [-430.054] (-428.806) (-429.084) -- 0:00:23
596500 -- (-431.790) [-431.302] (-429.764) (-432.522) * (-430.947) (-429.403) [-428.826] (-431.331) -- 0:00:23
597000 -- (-432.099) [-433.605] (-430.182) (-433.812) * (-430.147) (-429.608) [-429.490] (-432.886) -- 0:00:23
597500 -- (-432.857) (-430.222) (-429.922) [-430.064] * (-430.904) (-433.400) (-429.384) [-431.494] -- 0:00:23
598000 -- (-431.445) (-437.087) [-429.993] (-429.890) * (-432.428) (-430.707) (-429.933) [-432.208] -- 0:00:23
598500 -- (-429.891) [-432.219] (-429.280) (-430.780) * (-430.842) [-431.754] (-429.801) (-436.972) -- 0:00:23
599000 -- (-430.099) (-432.928) [-430.917] (-430.131) * (-429.064) [-431.992] (-430.262) (-431.013) -- 0:00:23
599500 -- (-432.404) (-430.186) (-436.835) [-430.645] * (-430.456) (-432.851) (-429.649) [-431.434] -- 0:00:23
600000 -- [-432.134] (-433.975) (-432.225) (-435.854) * (-431.540) (-430.024) [-430.692] (-430.857) -- 0:00:23
Average standard deviation of split frequencies: 0.017555
600500 -- [-432.374] (-430.787) (-430.310) (-429.652) * (-430.768) [-431.450] (-429.921) (-430.004) -- 0:00:23
601000 -- (-434.660) (-431.623) (-433.253) [-431.809] * (-432.158) (-431.619) (-433.407) [-430.739] -- 0:00:23
601500 -- (-431.514) (-429.853) [-435.750] (-430.186) * (-430.889) [-429.646] (-430.522) (-434.068) -- 0:00:23
602000 -- (-430.722) (-432.547) (-432.532) [-430.255] * (-430.303) (-430.735) (-437.507) [-432.461] -- 0:00:23
602500 -- [-431.339] (-430.191) (-431.750) (-430.001) * [-431.541] (-436.050) (-434.281) (-433.993) -- 0:00:23
603000 -- (-432.872) [-431.182] (-432.027) (-429.613) * (-431.051) [-433.398] (-429.824) (-440.302) -- 0:00:23
603500 -- (-431.441) (-430.125) [-431.510] (-430.888) * (-432.478) [-429.969] (-432.316) (-433.052) -- 0:00:22
604000 -- [-432.129] (-434.348) (-430.941) (-440.241) * (-430.226) [-430.525] (-430.379) (-431.928) -- 0:00:22
604500 -- [-431.346] (-430.089) (-431.962) (-430.208) * (-429.177) (-430.072) (-429.278) [-432.994] -- 0:00:22
605000 -- (-432.949) (-431.237) [-433.667] (-432.589) * (-430.302) (-432.192) (-430.336) [-436.132] -- 0:00:22
Average standard deviation of split frequencies: 0.017482
605500 -- (-430.880) [-429.789] (-430.410) (-434.325) * [-430.645] (-431.117) (-430.503) (-436.054) -- 0:00:22
606000 -- [-430.667] (-429.899) (-431.300) (-434.084) * (-432.217) [-430.777] (-430.289) (-431.315) -- 0:00:22
606500 -- (-430.247) [-429.496] (-430.995) (-429.594) * (-430.090) [-430.553] (-434.157) (-435.791) -- 0:00:22
607000 -- (-429.305) (-430.922) (-432.048) [-430.338] * (-429.222) (-435.223) (-431.595) [-430.583] -- 0:00:22
607500 -- [-429.021] (-430.422) (-431.103) (-430.950) * [-431.342] (-434.208) (-430.402) (-434.600) -- 0:00:22
608000 -- (-431.662) (-432.100) [-432.422] (-432.432) * (-430.312) [-431.948] (-432.607) (-430.467) -- 0:00:22
608500 -- [-429.978] (-429.450) (-430.501) (-432.260) * (-430.208) (-431.879) [-429.739] (-434.001) -- 0:00:22
609000 -- (-432.510) (-430.763) (-438.349) [-431.006] * (-431.611) (-430.270) (-431.140) [-432.113] -- 0:00:22
609500 -- (-431.457) [-430.257] (-429.327) (-431.169) * [-430.537] (-430.280) (-430.347) (-433.464) -- 0:00:23
610000 -- (-432.784) [-430.614] (-430.821) (-430.571) * (-430.498) (-429.466) [-429.668] (-430.575) -- 0:00:23
Average standard deviation of split frequencies: 0.016847
610500 -- (-431.763) [-429.629] (-431.226) (-429.902) * (-430.916) (-431.032) [-430.232] (-431.307) -- 0:00:22
611000 -- (-430.225) [-429.362] (-433.162) (-433.284) * (-432.863) [-430.831] (-429.683) (-432.286) -- 0:00:22
611500 -- [-431.419] (-431.402) (-430.613) (-430.287) * (-430.644) (-431.104) [-430.537] (-431.795) -- 0:00:22
612000 -- (-430.956) (-434.171) [-432.344] (-431.252) * (-430.343) (-435.472) [-431.275] (-432.403) -- 0:00:22
612500 -- (-431.749) (-429.482) (-431.511) [-430.352] * [-431.397] (-435.903) (-430.971) (-429.033) -- 0:00:22
613000 -- (-430.834) (-434.929) [-430.191] (-430.383) * [-429.919] (-428.801) (-430.685) (-430.919) -- 0:00:22
613500 -- (-429.657) (-430.505) (-431.076) [-431.950] * [-429.938] (-429.085) (-431.254) (-430.928) -- 0:00:22
614000 -- (-430.310) (-431.475) [-430.698] (-431.171) * (-434.413) (-431.684) [-431.058] (-430.691) -- 0:00:22
614500 -- (-429.321) (-429.335) (-430.479) [-429.625] * (-431.889) (-429.336) (-433.872) [-432.079] -- 0:00:22
615000 -- (-429.101) [-430.012] (-431.920) (-430.511) * (-429.971) [-429.770] (-429.050) (-431.884) -- 0:00:22
Average standard deviation of split frequencies: 0.017644
615500 -- (-429.552) (-430.255) (-433.101) [-430.490] * [-430.723] (-432.293) (-435.159) (-429.862) -- 0:00:22
616000 -- (-429.117) (-439.189) [-431.052] (-436.799) * [-431.226] (-436.001) (-432.852) (-430.373) -- 0:00:22
616500 -- (-432.614) (-430.803) [-430.149] (-432.619) * (-430.779) (-431.991) (-432.447) [-431.849] -- 0:00:22
617000 -- (-431.472) (-432.875) (-430.615) [-431.753] * (-431.955) [-430.377] (-429.755) (-430.570) -- 0:00:22
617500 -- (-429.749) (-430.293) (-433.177) [-432.048] * (-431.269) (-435.000) [-430.915] (-430.778) -- 0:00:22
618000 -- [-429.457] (-435.820) (-434.583) (-430.009) * [-430.797] (-434.347) (-431.871) (-428.849) -- 0:00:22
618500 -- (-429.864) (-433.499) [-430.724] (-430.288) * (-430.981) [-431.163] (-430.093) (-436.345) -- 0:00:22
619000 -- (-432.969) (-432.031) [-436.048] (-431.213) * (-432.558) (-430.398) (-439.941) [-430.241] -- 0:00:22
619500 -- (-431.484) (-432.571) [-429.560] (-430.789) * (-430.354) (-431.037) [-431.239] (-429.567) -- 0:00:22
620000 -- [-431.511] (-429.618) (-429.123) (-432.439) * [-432.797] (-429.929) (-430.890) (-430.070) -- 0:00:22
Average standard deviation of split frequencies: 0.016709
620500 -- (-430.359) [-430.782] (-432.670) (-430.018) * (-432.700) (-430.722) [-429.313] (-430.379) -- 0:00:22
621000 -- (-430.329) (-432.833) [-429.578] (-431.725) * (-430.503) (-430.202) [-430.559] (-429.165) -- 0:00:21
621500 -- (-433.274) (-430.523) [-430.731] (-431.135) * (-431.764) (-429.862) [-430.888] (-432.308) -- 0:00:21
622000 -- [-431.283] (-429.662) (-433.266) (-429.778) * (-430.199) [-429.702] (-431.057) (-435.618) -- 0:00:21
622500 -- (-431.676) (-432.761) [-430.474] (-435.081) * [-430.976] (-430.031) (-432.348) (-438.618) -- 0:00:21
623000 -- (-432.470) (-430.620) [-430.479] (-432.868) * (-432.575) (-430.940) (-429.995) [-437.226] -- 0:00:21
623500 -- (-436.195) (-432.614) [-430.085] (-430.380) * (-430.090) (-431.807) (-429.689) [-430.246] -- 0:00:21
624000 -- (-429.562) (-430.403) [-430.293] (-429.640) * (-428.928) [-428.898] (-430.551) (-433.164) -- 0:00:21
624500 -- [-430.976] (-429.485) (-431.502) (-432.883) * [-429.234] (-432.612) (-431.773) (-432.646) -- 0:00:21
625000 -- (-434.263) (-428.989) (-434.763) [-431.440] * [-433.238] (-432.449) (-434.053) (-429.349) -- 0:00:21
Average standard deviation of split frequencies: 0.016434
625500 -- (-434.248) (-430.729) (-429.507) [-432.214] * (-434.297) (-434.195) (-433.794) [-431.858] -- 0:00:21
626000 -- (-429.278) (-432.066) [-433.125] (-429.917) * (-434.071) (-431.913) (-431.927) [-430.369] -- 0:00:21
626500 -- (-431.559) (-431.025) [-429.810] (-430.560) * (-434.642) (-430.613) [-429.812] (-431.514) -- 0:00:21
627000 -- (-435.764) (-431.517) [-430.453] (-430.942) * (-431.521) (-430.144) [-430.662] (-431.476) -- 0:00:22
627500 -- (-432.613) [-431.294] (-431.145) (-431.238) * [-430.772] (-429.027) (-430.707) (-430.251) -- 0:00:21
628000 -- [-433.030] (-430.773) (-430.862) (-430.308) * (-433.955) (-430.547) (-430.648) [-429.236] -- 0:00:21
628500 -- (-430.919) (-432.574) (-431.555) [-431.180] * [-431.739] (-429.860) (-430.592) (-429.975) -- 0:00:21
629000 -- (-436.039) (-431.168) [-433.746] (-431.251) * (-433.569) [-429.904] (-429.853) (-429.948) -- 0:00:21
629500 -- [-431.667] (-431.336) (-436.462) (-432.599) * (-432.710) (-430.438) [-430.931] (-431.075) -- 0:00:21
630000 -- (-432.164) (-431.252) [-431.807] (-432.115) * (-430.693) (-429.793) [-430.584] (-429.009) -- 0:00:21
Average standard deviation of split frequencies: 0.016093
630500 -- (-429.223) [-431.729] (-432.570) (-431.371) * (-431.812) (-430.999) [-434.791] (-434.450) -- 0:00:21
631000 -- (-431.644) [-431.068] (-435.151) (-432.060) * [-431.318] (-431.683) (-435.875) (-432.164) -- 0:00:21
631500 -- (-429.293) (-431.297) (-434.806) [-431.791] * (-431.019) [-431.587] (-429.731) (-432.780) -- 0:00:21
632000 -- (-430.236) (-431.983) [-430.618] (-431.271) * (-432.563) (-431.572) (-429.712) [-430.361] -- 0:00:21
632500 -- (-433.677) [-432.752] (-430.184) (-433.276) * (-435.846) (-431.691) [-431.874] (-432.767) -- 0:00:21
633000 -- [-430.341] (-429.944) (-432.596) (-431.917) * (-433.342) (-432.143) (-436.047) [-430.335] -- 0:00:21
633500 -- [-434.613] (-429.654) (-441.928) (-429.079) * [-431.980] (-429.747) (-430.870) (-432.432) -- 0:00:21
634000 -- [-434.242] (-428.834) (-437.742) (-429.527) * (-430.597) (-433.513) [-432.359] (-430.740) -- 0:00:21
634500 -- (-431.975) [-428.970] (-435.433) (-430.996) * (-430.579) [-430.693] (-429.771) (-431.242) -- 0:00:21
635000 -- (-432.942) [-429.625] (-429.940) (-435.399) * (-429.712) (-429.087) (-432.472) [-431.020] -- 0:00:21
Average standard deviation of split frequencies: 0.016350
635500 -- (-431.301) (-430.182) (-431.436) [-434.007] * (-431.989) (-433.807) (-430.933) [-429.590] -- 0:00:21
636000 -- (-431.576) (-429.868) (-433.145) [-434.812] * (-431.900) (-432.776) [-430.675] (-430.285) -- 0:00:21
636500 -- (-430.655) [-429.402] (-428.803) (-429.616) * (-429.495) (-435.225) [-431.925] (-429.458) -- 0:00:21
637000 -- [-433.907] (-431.242) (-436.443) (-434.956) * (-432.047) (-431.635) (-430.976) [-430.924] -- 0:00:21
637500 -- (-434.140) (-430.035) [-432.793] (-433.225) * (-430.255) (-430.810) [-430.643] (-429.806) -- 0:00:21
638000 -- (-429.978) [-435.839] (-430.338) (-430.385) * (-434.898) (-431.515) (-431.610) [-429.451] -- 0:00:20
638500 -- (-430.206) (-428.973) [-431.308] (-432.122) * (-431.013) (-430.642) (-430.703) [-429.223] -- 0:00:20
639000 -- (-430.565) (-435.008) (-429.681) [-429.391] * (-430.323) (-433.630) (-433.389) [-431.147] -- 0:00:20
639500 -- (-430.654) [-431.714] (-430.355) (-431.545) * (-429.529) (-433.056) (-429.431) [-432.645] -- 0:00:20
640000 -- [-429.437] (-433.968) (-431.279) (-431.224) * (-433.019) [-429.987] (-432.686) (-431.695) -- 0:00:20
Average standard deviation of split frequencies: 0.016188
640500 -- (-428.969) [-431.448] (-429.534) (-431.976) * (-431.903) [-430.229] (-429.882) (-433.963) -- 0:00:20
641000 -- (-428.808) (-435.403) [-431.275] (-433.592) * (-431.404) (-437.112) (-429.957) [-430.423] -- 0:00:20
641500 -- (-434.266) [-434.738] (-431.691) (-431.991) * (-432.340) (-431.592) (-431.523) [-430.325] -- 0:00:20
642000 -- (-431.202) (-428.992) [-429.818] (-428.714) * (-432.245) (-430.298) (-433.104) [-430.563] -- 0:00:20
642500 -- (-429.576) (-432.273) (-430.197) [-431.107] * [-431.504] (-429.603) (-436.739) (-434.214) -- 0:00:20
643000 -- (-431.227) (-432.401) (-431.264) [-430.612] * (-430.922) (-429.959) (-436.768) [-434.885] -- 0:00:20
643500 -- (-430.315) (-430.420) (-429.793) [-431.413] * [-430.354] (-429.672) (-429.524) (-434.430) -- 0:00:20
644000 -- (-433.741) (-431.845) [-429.464] (-430.768) * (-431.803) [-429.285] (-430.639) (-430.907) -- 0:00:21
644500 -- (-430.564) (-431.027) [-429.732] (-431.250) * (-430.305) [-429.494] (-430.900) (-431.921) -- 0:00:20
645000 -- (-431.143) [-428.979] (-433.702) (-430.536) * (-433.508) (-432.174) (-431.313) [-432.496] -- 0:00:20
Average standard deviation of split frequencies: 0.016355
645500 -- (-433.320) (-429.258) [-431.608] (-432.173) * (-431.653) (-431.005) [-433.548] (-431.666) -- 0:00:20
646000 -- [-431.967] (-429.325) (-430.032) (-433.278) * (-430.310) (-432.409) (-429.498) [-431.367] -- 0:00:20
646500 -- [-430.317] (-433.198) (-430.164) (-433.603) * [-430.460] (-431.850) (-430.655) (-429.237) -- 0:00:20
647000 -- (-431.433) (-432.697) (-434.236) [-435.020] * [-430.952] (-431.499) (-431.352) (-431.898) -- 0:00:20
647500 -- (-431.463) [-433.309] (-429.744) (-434.784) * (-430.395) [-431.521] (-435.320) (-434.264) -- 0:00:20
648000 -- (-429.950) (-431.219) [-432.282] (-434.112) * (-431.902) (-431.775) [-430.696] (-430.597) -- 0:00:20
648500 -- (-432.568) [-430.029] (-429.375) (-429.885) * (-431.061) (-429.963) [-430.730] (-431.128) -- 0:00:20
649000 -- (-430.210) [-430.230] (-430.257) (-430.678) * [-430.533] (-432.264) (-431.218) (-430.226) -- 0:00:20
649500 -- [-430.327] (-431.305) (-432.222) (-431.715) * (-430.652) [-432.086] (-432.909) (-429.694) -- 0:00:20
650000 -- (-430.761) (-431.374) [-429.301] (-432.243) * (-430.955) (-430.762) (-429.436) [-429.447] -- 0:00:20
Average standard deviation of split frequencies: 0.016876
650500 -- [-432.252] (-432.399) (-431.672) (-430.932) * [-430.937] (-430.168) (-433.380) (-430.029) -- 0:00:20
651000 -- (-432.102) (-430.722) (-431.650) [-430.810] * [-429.910] (-429.644) (-431.976) (-430.436) -- 0:00:20
651500 -- [-432.704] (-429.519) (-431.617) (-430.654) * [-430.716] (-430.431) (-431.039) (-431.214) -- 0:00:20
652000 -- (-432.226) (-430.844) [-430.869] (-431.014) * (-432.753) (-430.757) [-432.726] (-429.039) -- 0:00:20
652500 -- (-430.732) (-432.767) [-434.073] (-433.931) * (-430.777) [-430.656] (-430.674) (-430.973) -- 0:00:20
653000 -- (-433.052) (-432.258) (-429.163) [-431.671] * (-432.351) (-436.239) (-433.049) [-429.520] -- 0:00:20
653500 -- [-430.783] (-429.537) (-432.227) (-430.182) * (-431.623) [-433.764] (-432.630) (-432.193) -- 0:00:20
654000 -- (-430.303) (-430.214) (-430.926) [-430.668] * (-433.824) [-432.288] (-429.986) (-433.753) -- 0:00:20
654500 -- (-436.219) [-429.580] (-434.264) (-431.796) * [-429.724] (-433.167) (-429.322) (-430.076) -- 0:00:20
655000 -- (-430.707) (-429.451) (-431.062) [-429.488] * (-432.082) [-429.135] (-432.643) (-433.279) -- 0:00:20
Average standard deviation of split frequencies: 0.016401
655500 -- [-431.292] (-431.380) (-431.981) (-429.665) * (-430.076) [-429.527] (-431.716) (-430.377) -- 0:00:19
656000 -- [-431.833] (-432.158) (-430.593) (-432.435) * (-429.716) (-429.704) [-430.830] (-433.888) -- 0:00:19
656500 -- (-430.852) [-429.919] (-429.288) (-429.588) * (-432.920) (-430.368) (-431.165) [-429.660] -- 0:00:19
657000 -- (-430.500) (-429.869) [-430.549] (-434.192) * (-431.094) (-429.725) (-431.880) [-429.276] -- 0:00:19
657500 -- [-433.790] (-432.314) (-431.082) (-435.379) * [-433.063] (-430.556) (-430.690) (-430.626) -- 0:00:19
658000 -- [-431.639] (-431.486) (-430.362) (-431.437) * (-429.648) (-430.673) [-430.398] (-433.313) -- 0:00:19
658500 -- (-431.565) (-430.331) [-431.172] (-432.973) * [-429.894] (-432.116) (-432.872) (-432.732) -- 0:00:19
659000 -- (-430.999) [-430.465] (-433.288) (-431.657) * (-429.559) (-435.636) (-431.111) [-430.931] -- 0:00:19
659500 -- [-429.766] (-433.965) (-434.407) (-431.950) * [-433.547] (-431.454) (-429.577) (-432.227) -- 0:00:19
660000 -- (-429.989) (-433.237) (-430.121) [-430.663] * (-432.378) (-434.334) [-431.952] (-429.825) -- 0:00:19
Average standard deviation of split frequencies: 0.016621
660500 -- (-431.072) (-430.940) [-430.215] (-432.066) * (-430.367) (-429.039) (-432.444) [-429.823] -- 0:00:19
661000 -- (-435.367) (-430.723) (-429.206) [-432.948] * (-429.779) (-431.716) [-439.993] (-429.988) -- 0:00:19
661500 -- (-430.772) (-432.810) [-429.106] (-433.216) * [-429.708] (-429.184) (-439.263) (-432.245) -- 0:00:19
662000 -- (-432.128) [-430.046] (-431.435) (-430.375) * (-432.366) [-431.690] (-437.069) (-433.164) -- 0:00:19
662500 -- [-434.071] (-430.731) (-431.153) (-432.271) * (-436.105) (-430.926) (-433.237) [-434.931] -- 0:00:19
663000 -- (-434.092) [-431.407] (-431.987) (-431.340) * [-429.572] (-435.750) (-434.756) (-435.896) -- 0:00:19
663500 -- [-429.920] (-430.158) (-429.915) (-430.278) * (-430.379) (-432.752) [-433.110] (-433.352) -- 0:00:19
664000 -- (-429.233) [-429.259] (-432.407) (-428.767) * (-429.909) [-435.771] (-429.708) (-432.173) -- 0:00:19
664500 -- (-429.742) [-430.132] (-432.562) (-428.898) * (-431.914) (-430.423) (-430.096) [-433.592] -- 0:00:19
665000 -- (-432.217) [-431.697] (-433.785) (-429.239) * (-431.054) [-429.867] (-432.901) (-429.408) -- 0:00:19
Average standard deviation of split frequencies: 0.017029
665500 -- (-432.365) (-429.993) (-429.744) [-430.220] * (-430.596) (-432.784) (-433.286) [-430.426] -- 0:00:19
666000 -- [-432.611] (-433.834) (-430.904) (-429.950) * [-429.886] (-429.504) (-434.645) (-434.626) -- 0:00:19
666500 -- (-431.865) (-433.005) (-430.516) [-430.728] * (-430.727) (-431.162) (-437.569) [-431.120] -- 0:00:19
667000 -- [-433.512] (-429.641) (-434.396) (-432.412) * (-430.858) (-432.651) [-430.875] (-429.097) -- 0:00:19
667500 -- (-430.765) [-428.715] (-429.284) (-429.777) * (-431.417) [-431.709] (-431.228) (-430.443) -- 0:00:19
668000 -- [-434.579] (-429.579) (-429.646) (-430.551) * (-430.720) (-429.914) [-431.075] (-432.026) -- 0:00:19
668500 -- (-431.449) (-430.931) [-430.977] (-434.658) * (-430.785) (-432.203) [-432.111] (-430.524) -- 0:00:19
669000 -- (-430.329) (-436.946) [-432.610] (-431.659) * (-430.431) [-431.609] (-429.812) (-430.382) -- 0:00:19
669500 -- (-429.107) (-433.043) (-432.765) [-430.925] * [-432.019] (-432.005) (-429.230) (-429.241) -- 0:00:19
670000 -- (-431.211) [-430.143] (-433.066) (-429.985) * [-430.896] (-432.390) (-431.064) (-429.278) -- 0:00:19
Average standard deviation of split frequencies: 0.016580
670500 -- [-429.378] (-433.142) (-429.424) (-439.830) * (-431.622) (-429.403) [-431.462] (-435.106) -- 0:00:19
671000 -- [-431.542] (-430.742) (-430.447) (-436.122) * [-430.789] (-433.853) (-430.185) (-431.511) -- 0:00:19
671500 -- (-432.572) (-431.935) (-430.090) [-433.992] * (-430.930) (-434.751) (-430.867) [-431.507] -- 0:00:19
672000 -- [-431.245] (-431.810) (-434.378) (-432.847) * [-430.653] (-431.630) (-430.013) (-430.794) -- 0:00:19
672500 -- (-433.254) [-434.023] (-431.518) (-433.255) * [-430.113] (-430.881) (-431.119) (-432.487) -- 0:00:18
673000 -- [-430.887] (-430.214) (-430.109) (-429.890) * [-433.355] (-429.860) (-429.510) (-431.384) -- 0:00:18
673500 -- (-429.920) (-430.915) [-428.982] (-431.852) * (-432.721) [-429.639] (-434.873) (-432.308) -- 0:00:18
674000 -- (-429.342) (-431.788) (-429.758) [-430.044] * (-430.508) [-430.040] (-435.163) (-431.291) -- 0:00:18
674500 -- (-430.309) (-435.013) [-430.559] (-430.033) * (-440.979) [-431.402] (-430.997) (-430.416) -- 0:00:18
675000 -- [-429.845] (-434.257) (-432.318) (-433.327) * [-434.083] (-430.414) (-429.914) (-429.277) -- 0:00:18
Average standard deviation of split frequencies: 0.016244
675500 -- [-432.452] (-430.247) (-431.240) (-433.134) * [-431.926] (-431.106) (-430.333) (-429.723) -- 0:00:18
676000 -- [-431.230] (-433.010) (-432.958) (-432.880) * (-429.909) (-435.664) [-431.245] (-430.312) -- 0:00:18
676500 -- (-430.181) [-429.159] (-435.630) (-429.219) * (-433.530) (-434.050) (-434.479) [-431.071] -- 0:00:18
677000 -- (-432.644) (-430.472) [-431.718] (-431.659) * (-433.051) [-431.613] (-431.448) (-432.231) -- 0:00:18
677500 -- (-433.931) (-431.102) [-429.436] (-434.042) * [-431.046] (-431.340) (-430.890) (-429.799) -- 0:00:18
678000 -- (-433.268) (-429.699) (-429.873) [-430.344] * (-431.898) (-433.196) (-429.477) [-430.949] -- 0:00:18
678500 -- (-433.239) (-430.834) (-430.165) [-431.738] * (-432.254) [-431.387] (-432.510) (-429.251) -- 0:00:18
679000 -- (-429.477) (-430.489) [-430.337] (-430.710) * (-430.892) (-431.548) (-430.694) [-429.629] -- 0:00:18
679500 -- (-435.591) (-435.799) [-430.038] (-431.790) * (-429.509) [-429.477] (-429.883) (-430.662) -- 0:00:18
680000 -- (-433.047) (-430.276) [-433.847] (-436.056) * (-433.029) (-430.230) [-433.243] (-431.896) -- 0:00:18
Average standard deviation of split frequencies: 0.016405
680500 -- (-430.705) (-430.403) (-432.714) [-431.574] * [-429.374] (-429.569) (-430.584) (-433.224) -- 0:00:18
681000 -- [-433.367] (-430.613) (-431.896) (-430.774) * (-431.749) (-431.033) (-430.033) [-430.720] -- 0:00:18
681500 -- [-433.831] (-429.907) (-431.521) (-431.118) * [-433.879] (-433.644) (-435.753) (-432.568) -- 0:00:18
682000 -- (-431.471) [-431.583] (-430.737) (-429.501) * (-429.837) [-429.118] (-433.252) (-431.153) -- 0:00:18
682500 -- (-429.916) [-429.539] (-430.218) (-433.500) * (-431.312) (-432.251) (-431.566) [-430.825] -- 0:00:18
683000 -- [-430.376] (-429.325) (-431.605) (-433.062) * [-431.827] (-429.145) (-429.321) (-431.764) -- 0:00:18
683500 -- (-430.101) (-429.180) (-431.906) [-432.285] * (-431.569) [-429.347] (-430.230) (-432.974) -- 0:00:18
684000 -- (-431.386) (-433.164) [-429.976] (-433.550) * (-432.061) (-429.369) [-429.008] (-429.418) -- 0:00:18
684500 -- (-438.515) (-430.757) [-429.816] (-430.884) * (-431.727) (-433.591) (-433.344) [-432.425] -- 0:00:18
685000 -- (-435.972) (-430.288) (-431.500) [-433.895] * (-429.966) [-430.343] (-430.575) (-432.005) -- 0:00:18
Average standard deviation of split frequencies: 0.016020
685500 -- (-432.066) (-430.215) (-430.048) [-430.537] * (-431.826) [-430.401] (-429.536) (-431.467) -- 0:00:18
686000 -- (-430.410) (-434.160) (-430.450) [-430.961] * (-432.908) (-432.112) [-430.067] (-429.694) -- 0:00:18
686500 -- (-430.402) (-437.033) (-430.057) [-436.976] * [-428.855] (-429.877) (-429.708) (-431.000) -- 0:00:18
687000 -- (-430.748) [-431.842] (-431.423) (-449.335) * [-429.743] (-433.288) (-430.393) (-430.568) -- 0:00:18
687500 -- (-432.499) (-431.521) (-440.041) [-433.062] * (-433.942) [-430.726] (-431.182) (-434.636) -- 0:00:18
688000 -- (-433.243) [-429.945] (-431.850) (-430.651) * [-430.743] (-430.607) (-432.628) (-432.908) -- 0:00:18
688500 -- [-431.932] (-435.430) (-433.995) (-429.957) * (-433.229) (-430.838) (-430.038) [-432.275] -- 0:00:18
689000 -- (-429.404) (-429.049) [-430.574] (-429.562) * (-430.080) (-433.568) [-433.715] (-431.810) -- 0:00:18
689500 -- [-429.803] (-430.320) (-430.687) (-429.447) * (-429.047) (-431.063) (-433.053) [-431.661] -- 0:00:18
690000 -- (-432.530) (-430.346) [-429.248] (-428.952) * (-429.471) (-430.213) [-430.258] (-433.372) -- 0:00:17
Average standard deviation of split frequencies: 0.015826
690500 -- (-431.981) [-431.215] (-430.455) (-429.904) * (-430.806) (-429.564) [-429.731] (-431.908) -- 0:00:17
691000 -- [-429.994] (-433.511) (-430.933) (-430.326) * (-430.819) [-430.374] (-431.645) (-429.434) -- 0:00:17
691500 -- (-430.656) (-429.717) (-431.580) [-429.876] * [-431.830] (-429.728) (-432.058) (-431.099) -- 0:00:17
692000 -- (-431.761) [-432.016] (-432.214) (-431.225) * (-430.578) [-433.943] (-432.515) (-431.596) -- 0:00:17
692500 -- (-431.195) [-429.590] (-433.808) (-435.189) * (-435.356) (-431.693) [-428.835] (-430.368) -- 0:00:17
693000 -- (-431.860) [-429.249] (-431.418) (-431.023) * (-433.192) (-430.040) (-431.811) [-431.224] -- 0:00:17
693500 -- (-431.857) (-429.161) (-429.579) [-431.471] * [-429.187] (-432.730) (-430.887) (-430.192) -- 0:00:17
694000 -- (-431.640) [-430.401] (-432.331) (-431.160) * (-429.688) (-431.749) (-433.210) [-429.928] -- 0:00:17
694500 -- (-431.018) [-430.577] (-432.439) (-429.755) * (-429.284) (-433.038) (-431.493) [-431.120] -- 0:00:17
695000 -- (-430.664) (-431.813) [-434.253] (-432.471) * (-430.944) (-435.267) [-429.275] (-431.542) -- 0:00:17
Average standard deviation of split frequencies: 0.015536
695500 -- (-432.719) (-433.358) (-431.433) [-431.583] * [-429.438] (-432.473) (-431.470) (-434.623) -- 0:00:17
696000 -- [-429.897] (-431.132) (-430.419) (-430.996) * (-430.178) (-432.366) (-431.968) [-430.712] -- 0:00:17
696500 -- (-432.695) (-431.706) [-429.984] (-431.705) * (-429.884) (-429.734) (-429.292) [-431.103] -- 0:00:17
697000 -- [-430.867] (-429.618) (-429.087) (-430.226) * (-429.685) (-430.508) (-430.194) [-429.684] -- 0:00:17
697500 -- (-434.155) (-433.649) (-431.059) [-431.286] * (-429.989) (-431.081) [-435.964] (-431.889) -- 0:00:17
698000 -- (-435.191) (-430.156) [-434.426] (-428.921) * (-429.898) [-432.383] (-433.419) (-431.413) -- 0:00:17
698500 -- (-434.632) (-430.874) [-430.111] (-430.579) * (-431.916) [-437.918] (-429.230) (-430.843) -- 0:00:17
699000 -- [-432.504] (-429.837) (-428.925) (-431.754) * (-430.315) (-430.311) [-434.484] (-429.848) -- 0:00:17
699500 -- [-431.963] (-429.989) (-436.057) (-432.825) * (-434.621) (-431.794) (-429.802) [-433.080] -- 0:00:17
700000 -- [-429.109] (-436.092) (-430.131) (-430.257) * (-431.955) (-429.984) [-432.617] (-429.227) -- 0:00:17
Average standard deviation of split frequencies: 0.015791
700500 -- (-431.795) (-434.737) [-435.852] (-431.578) * [-429.946] (-430.773) (-435.616) (-431.678) -- 0:00:17
701000 -- (-431.824) [-432.947] (-433.874) (-431.775) * (-429.633) (-429.462) [-434.064] (-431.649) -- 0:00:17
701500 -- (-432.325) (-430.991) (-430.665) [-433.722] * (-433.660) (-430.965) [-431.454] (-430.187) -- 0:00:17
702000 -- (-429.576) (-429.464) [-433.011] (-431.298) * (-430.247) (-429.672) [-429.782] (-431.297) -- 0:00:17
702500 -- (-431.287) (-434.156) (-430.025) [-431.980] * (-429.973) [-430.503] (-432.530) (-430.203) -- 0:00:17
703000 -- (-432.972) [-434.228] (-431.585) (-430.371) * [-431.225] (-430.762) (-431.221) (-431.131) -- 0:00:17
703500 -- (-433.861) [-432.609] (-431.375) (-431.111) * [-430.219] (-435.880) (-429.650) (-429.022) -- 0:00:17
704000 -- (-431.164) (-432.650) (-430.188) [-431.534] * (-432.345) (-434.210) [-432.835] (-432.327) -- 0:00:17
704500 -- (-431.411) (-432.366) (-430.447) [-430.040] * (-432.490) (-433.552) (-430.913) [-433.153] -- 0:00:17
705000 -- (-434.301) [-431.233] (-431.752) (-429.578) * (-430.340) (-430.055) [-430.450] (-430.686) -- 0:00:17
Average standard deviation of split frequencies: 0.015947
705500 -- (-432.005) (-435.245) (-430.707) [-429.774] * (-431.185) [-430.375] (-430.403) (-429.658) -- 0:00:17
706000 -- (-430.667) (-432.884) (-432.119) [-430.643] * (-430.249) (-430.273) [-431.375] (-429.508) -- 0:00:17
706500 -- [-430.860] (-430.655) (-431.290) (-431.345) * (-431.960) [-432.679] (-431.779) (-429.973) -- 0:00:17
707000 -- (-431.270) [-434.346] (-432.134) (-431.316) * (-432.918) (-431.481) (-432.268) [-430.878] -- 0:00:16
707500 -- (-435.672) (-431.177) (-430.677) [-432.578] * (-431.205) [-430.674] (-432.642) (-431.657) -- 0:00:16
708000 -- [-432.116] (-430.543) (-431.203) (-430.499) * [-430.571] (-429.634) (-433.305) (-429.579) -- 0:00:16
708500 -- (-432.961) (-431.566) [-430.793] (-433.214) * (-432.562) [-429.707] (-430.557) (-431.816) -- 0:00:16
709000 -- (-430.495) (-430.265) (-430.719) [-435.399] * (-433.567) (-433.405) [-431.436] (-432.807) -- 0:00:16
709500 -- (-431.962) (-431.149) [-431.762] (-429.060) * (-435.553) (-432.402) (-429.618) [-429.242] -- 0:00:16
710000 -- (-435.772) (-429.733) [-431.186] (-435.396) * (-432.294) [-432.635] (-430.115) (-431.988) -- 0:00:16
Average standard deviation of split frequencies: 0.015725
710500 -- (-433.104) [-431.372] (-430.659) (-433.330) * [-429.138] (-433.204) (-431.433) (-434.100) -- 0:00:16
711000 -- (-430.693) (-432.266) [-430.131] (-432.250) * [-430.523] (-435.460) (-429.609) (-432.681) -- 0:00:16
711500 -- [-430.547] (-429.156) (-431.025) (-429.074) * (-430.980) (-430.192) (-429.701) [-434.126] -- 0:00:16
712000 -- (-428.917) [-431.267] (-432.686) (-430.977) * [-429.764] (-431.468) (-433.353) (-429.737) -- 0:00:16
712500 -- (-435.413) (-429.969) (-436.274) [-434.013] * [-429.112] (-432.023) (-430.963) (-431.919) -- 0:00:16
713000 -- [-432.124] (-431.443) (-431.290) (-436.246) * (-433.288) (-434.252) [-429.858] (-429.697) -- 0:00:16
713500 -- (-430.923) [-435.091] (-436.131) (-430.322) * (-432.093) (-433.354) [-429.674] (-431.564) -- 0:00:16
714000 -- (-429.939) (-431.284) [-432.464] (-431.143) * (-432.746) (-433.615) [-429.902] (-430.782) -- 0:00:16
714500 -- (-430.428) (-432.267) [-431.157] (-431.672) * (-429.314) (-433.333) (-429.964) [-432.187] -- 0:00:16
715000 -- (-429.585) [-431.097] (-431.310) (-433.294) * [-435.116] (-434.534) (-431.124) (-429.664) -- 0:00:16
Average standard deviation of split frequencies: 0.015061
715500 -- (-430.230) (-433.494) [-430.254] (-431.263) * (-431.210) (-431.175) (-430.919) [-430.463] -- 0:00:16
716000 -- (-429.174) (-436.298) (-429.030) [-429.686] * [-429.793] (-432.836) (-434.637) (-429.857) -- 0:00:16
716500 -- (-431.122) (-433.078) (-435.162) [-429.674] * [-432.169] (-431.013) (-430.506) (-430.143) -- 0:00:16
717000 -- [-430.972] (-432.303) (-430.384) (-438.259) * (-430.824) [-432.250] (-431.286) (-429.896) -- 0:00:16
717500 -- (-431.793) (-430.584) (-438.800) [-431.685] * (-430.054) [-433.100] (-430.177) (-432.063) -- 0:00:16
718000 -- (-433.569) [-430.611] (-429.432) (-430.594) * (-430.574) [-432.629] (-432.230) (-433.601) -- 0:00:16
718500 -- (-430.508) [-433.922] (-433.749) (-429.567) * (-429.548) (-432.793) [-432.025] (-431.280) -- 0:00:16
719000 -- [-430.226] (-437.190) (-433.498) (-430.356) * (-430.768) (-432.188) (-432.811) [-431.605] -- 0:00:16
719500 -- (-430.781) (-433.817) [-433.541] (-433.950) * (-430.172) (-433.134) (-432.186) [-432.467] -- 0:00:16
720000 -- (-430.831) [-429.416] (-432.836) (-430.860) * [-429.376] (-430.935) (-429.074) (-432.323) -- 0:00:16
Average standard deviation of split frequencies: 0.014929
720500 -- (-429.548) [-428.775] (-431.231) (-433.454) * (-429.474) (-433.202) (-431.057) [-432.805] -- 0:00:16
721000 -- (-432.109) [-431.064] (-432.554) (-434.002) * (-430.237) (-431.398) [-432.471] (-437.474) -- 0:00:16
721500 -- (-435.061) (-429.867) (-431.327) [-435.559] * (-429.007) (-434.434) [-433.619] (-435.054) -- 0:00:16
722000 -- (-433.467) [-428.886] (-429.975) (-430.289) * [-430.254] (-429.816) (-429.360) (-434.805) -- 0:00:16
722500 -- [-430.298] (-429.590) (-432.020) (-429.256) * [-431.791] (-432.875) (-429.086) (-433.408) -- 0:00:16
723000 -- (-429.771) [-432.507] (-430.680) (-431.703) * (-430.286) [-432.444] (-429.828) (-437.002) -- 0:00:16
723500 -- (-434.220) (-429.609) [-432.567] (-431.443) * (-433.711) (-429.661) (-429.544) [-429.611] -- 0:00:16
724000 -- (-430.363) [-433.284] (-434.249) (-432.303) * (-429.746) (-430.724) (-430.944) [-429.457] -- 0:00:16
724500 -- (-429.693) (-429.930) [-431.144] (-432.949) * (-429.913) [-429.288] (-431.003) (-429.007) -- 0:00:15
725000 -- [-429.829] (-429.267) (-432.380) (-432.668) * (-429.588) [-430.335] (-430.341) (-431.713) -- 0:00:15
Average standard deviation of split frequencies: 0.014514
725500 -- (-429.465) [-430.021] (-430.549) (-431.447) * (-431.289) (-430.295) [-430.361] (-433.899) -- 0:00:15
726000 -- (-430.597) (-429.374) [-430.556] (-432.254) * (-433.645) (-429.485) [-430.445] (-431.086) -- 0:00:15
726500 -- [-432.870] (-430.003) (-434.321) (-430.894) * (-433.023) (-429.977) [-431.367] (-430.368) -- 0:00:15
727000 -- [-429.522] (-433.980) (-429.559) (-431.866) * [-432.795] (-431.911) (-432.251) (-432.292) -- 0:00:15
727500 -- (-431.276) [-430.835] (-431.209) (-429.749) * (-431.825) [-431.741] (-431.691) (-430.651) -- 0:00:15
728000 -- (-433.735) [-430.568] (-431.356) (-429.491) * (-435.559) (-431.464) (-431.092) [-429.234] -- 0:00:15
728500 -- (-434.529) (-432.017) [-429.944] (-429.677) * (-432.688) (-428.857) (-434.736) [-432.134] -- 0:00:15
729000 -- (-431.704) [-431.958] (-434.649) (-429.672) * (-434.561) [-432.517] (-429.495) (-429.734) -- 0:00:15
729500 -- (-429.620) [-429.465] (-435.040) (-433.236) * (-429.586) (-431.196) (-429.555) [-429.769] -- 0:00:15
730000 -- (-433.353) [-429.378] (-429.524) (-430.345) * (-435.392) (-432.525) (-431.201) [-429.327] -- 0:00:15
Average standard deviation of split frequencies: 0.014194
730500 -- (-430.322) (-434.859) (-429.919) [-430.637] * (-431.125) [-432.215] (-431.610) (-432.383) -- 0:00:15
731000 -- [-431.234] (-431.793) (-430.047) (-431.473) * (-429.713) [-429.202] (-431.467) (-434.367) -- 0:00:15
731500 -- (-431.631) (-433.066) [-432.412] (-429.025) * (-431.269) (-434.827) [-430.923] (-433.621) -- 0:00:15
732000 -- (-433.217) (-430.590) (-430.457) [-430.041] * [-432.165] (-429.608) (-432.019) (-433.803) -- 0:00:15
732500 -- (-432.082) (-433.558) (-433.241) [-433.120] * (-429.887) (-429.463) [-431.305] (-429.608) -- 0:00:15
733000 -- [-432.746] (-429.010) (-435.913) (-435.524) * (-430.901) [-430.112] (-429.855) (-431.867) -- 0:00:15
733500 -- (-433.174) (-430.531) (-429.999) [-429.634] * (-428.975) (-430.369) (-430.568) [-432.334] -- 0:00:15
734000 -- (-433.903) (-431.466) (-433.419) [-430.764] * (-436.004) (-431.817) (-433.650) [-430.012] -- 0:00:15
734500 -- (-431.079) (-431.717) [-434.759] (-431.380) * (-429.998) [-429.645] (-429.673) (-430.896) -- 0:00:15
735000 -- (-429.591) (-431.423) [-430.592] (-431.586) * (-434.977) (-431.292) [-431.286] (-433.864) -- 0:00:15
Average standard deviation of split frequencies: 0.013903
735500 -- (-434.120) [-433.473] (-432.199) (-429.665) * (-430.227) (-431.314) (-430.563) [-433.933] -- 0:00:15
736000 -- (-429.472) [-431.828] (-431.858) (-432.040) * (-429.444) [-430.254] (-430.758) (-430.999) -- 0:00:15
736500 -- (-430.182) (-432.137) (-431.811) [-430.131] * (-429.435) (-429.515) (-429.682) [-433.417] -- 0:00:15
737000 -- (-429.273) (-431.799) (-433.064) [-430.021] * (-431.502) (-436.417) (-430.920) [-429.768] -- 0:00:15
737500 -- (-432.263) (-432.937) (-429.867) [-430.215] * (-433.066) [-431.393] (-429.634) (-429.964) -- 0:00:15
738000 -- [-432.239] (-430.317) (-436.011) (-432.307) * (-431.534) (-431.356) [-429.844] (-433.291) -- 0:00:15
738500 -- (-429.633) (-434.181) (-431.126) [-430.915] * (-431.184) [-428.859] (-430.120) (-430.266) -- 0:00:15
739000 -- [-434.358] (-430.693) (-429.868) (-439.869) * (-435.942) (-430.572) (-432.011) [-434.567] -- 0:00:15
739500 -- (-430.836) (-430.392) (-429.383) [-431.588] * (-432.648) (-433.481) [-430.608] (-434.919) -- 0:00:15
740000 -- (-429.829) (-431.966) [-432.124] (-432.699) * (-431.523) (-432.766) (-430.327) [-430.812] -- 0:00:15
Average standard deviation of split frequencies: 0.013962
740500 -- [-430.740] (-431.267) (-430.300) (-432.329) * (-433.974) [-430.979] (-433.747) (-432.194) -- 0:00:15
741000 -- (-436.717) (-431.091) (-430.414) [-431.360] * (-433.095) (-445.481) (-437.191) [-431.130] -- 0:00:15
741500 -- [-429.221] (-429.200) (-431.094) (-431.390) * (-433.436) (-433.102) (-430.950) [-430.892] -- 0:00:14
742000 -- (-430.709) (-429.356) (-431.715) [-433.863] * (-430.646) (-430.263) (-430.618) [-429.875] -- 0:00:14
742500 -- (-431.718) [-429.377] (-431.004) (-432.723) * (-429.883) (-430.090) [-431.556] (-431.469) -- 0:00:14
743000 -- (-429.352) (-431.489) (-429.531) [-431.191] * [-430.321] (-429.986) (-432.335) (-431.292) -- 0:00:14
743500 -- (-432.018) (-430.763) (-429.920) [-430.144] * (-430.038) (-430.805) (-432.141) [-429.553] -- 0:00:14
744000 -- (-432.525) [-430.734] (-430.896) (-429.427) * [-430.557] (-432.152) (-430.643) (-430.259) -- 0:00:14
744500 -- (-431.049) (-429.484) (-429.629) [-430.536] * (-429.855) (-435.617) [-430.275] (-432.681) -- 0:00:14
745000 -- (-433.322) [-432.688] (-429.602) (-429.395) * [-432.764] (-431.492) (-429.798) (-430.302) -- 0:00:14
Average standard deviation of split frequencies: 0.014297
745500 -- (-429.228) (-429.652) (-431.681) [-430.734] * (-430.870) (-432.469) (-430.321) [-429.624] -- 0:00:14
746000 -- [-429.830] (-434.600) (-430.149) (-430.438) * (-430.156) (-431.034) [-431.922] (-429.943) -- 0:00:14
746500 -- [-433.217] (-435.361) (-430.322) (-430.538) * (-430.350) (-431.024) [-433.950] (-429.296) -- 0:00:14
747000 -- [-430.319] (-431.426) (-430.010) (-429.880) * [-431.052] (-430.742) (-435.742) (-434.206) -- 0:00:14
747500 -- (-429.784) [-430.243] (-433.568) (-430.426) * (-431.020) (-429.610) (-434.251) [-431.278] -- 0:00:14
748000 -- (-429.438) (-429.887) (-432.162) [-430.023] * (-432.177) (-429.796) (-430.260) [-430.559] -- 0:00:14
748500 -- [-430.916] (-431.132) (-431.037) (-433.044) * (-432.943) (-431.351) (-429.653) [-430.547] -- 0:00:14
749000 -- [-429.323] (-429.004) (-432.483) (-429.302) * (-431.675) (-435.441) [-429.756] (-432.198) -- 0:00:14
749500 -- [-430.010] (-431.513) (-430.471) (-431.343) * (-431.490) (-429.615) (-430.444) [-430.374] -- 0:00:14
750000 -- [-429.112] (-434.328) (-429.897) (-430.612) * (-430.753) (-433.045) [-429.092] (-430.201) -- 0:00:14
Average standard deviation of split frequencies: 0.013462
750500 -- (-431.483) (-432.321) (-431.000) [-431.383] * (-431.115) (-430.621) [-431.090] (-430.058) -- 0:00:14
751000 -- (-429.972) [-431.006] (-430.663) (-435.935) * (-433.398) [-434.323] (-433.791) (-429.916) -- 0:00:14
751500 -- [-430.587] (-432.199) (-430.025) (-431.331) * (-429.977) (-431.147) (-435.694) [-430.938] -- 0:00:14
752000 -- (-429.480) [-429.969] (-429.932) (-430.493) * [-430.297] (-431.084) (-430.584) (-431.105) -- 0:00:14
752500 -- (-429.581) (-430.210) [-429.977] (-432.087) * (-433.405) (-431.556) (-430.021) [-430.523] -- 0:00:14
753000 -- (-430.024) [-432.690] (-431.139) (-433.725) * (-431.230) (-435.224) (-430.042) [-435.952] -- 0:00:14
753500 -- [-429.641] (-432.420) (-436.106) (-429.688) * [-430.551] (-433.372) (-430.497) (-431.561) -- 0:00:14
754000 -- (-431.134) (-429.427) (-429.417) [-430.370] * (-431.234) (-430.228) [-431.178] (-429.505) -- 0:00:14
754500 -- (-431.707) (-433.036) [-429.581] (-429.920) * (-430.998) (-431.062) (-429.400) [-431.252] -- 0:00:14
755000 -- (-429.878) [-430.445] (-430.709) (-432.382) * [-431.640] (-429.828) (-429.834) (-431.572) -- 0:00:14
Average standard deviation of split frequencies: 0.013211
755500 -- (-435.337) (-436.347) [-431.961] (-432.316) * (-431.250) (-430.737) [-431.340] (-433.157) -- 0:00:14
756000 -- [-431.275] (-433.799) (-433.384) (-431.970) * (-429.319) [-431.603] (-431.028) (-431.813) -- 0:00:14
756500 -- (-432.144) (-436.088) (-432.295) [-429.343] * [-428.966] (-434.369) (-435.431) (-431.778) -- 0:00:14
757000 -- [-429.049] (-431.844) (-432.751) (-430.679) * (-429.854) [-434.908] (-435.815) (-430.220) -- 0:00:14
757500 -- (-429.308) (-432.862) [-430.783] (-429.210) * (-430.244) (-430.405) (-430.038) [-432.122] -- 0:00:14
758000 -- [-429.292] (-430.492) (-431.533) (-432.159) * (-431.516) (-431.552) (-429.415) [-429.396] -- 0:00:14
758500 -- (-432.165) (-431.068) (-433.009) [-428.860] * [-430.462] (-430.627) (-429.474) (-430.532) -- 0:00:14
759000 -- (-432.685) (-430.488) (-436.153) [-428.918] * (-432.090) [-430.450] (-429.696) (-432.469) -- 0:00:13
759500 -- (-430.083) (-433.329) (-432.120) [-431.143] * (-431.339) (-430.173) (-431.554) [-431.731] -- 0:00:13
760000 -- (-431.516) [-431.566] (-430.792) (-430.048) * (-431.745) (-429.935) [-431.608] (-433.426) -- 0:00:13
Average standard deviation of split frequencies: 0.013324
760500 -- (-433.923) (-430.599) (-431.810) [-429.625] * (-431.268) (-430.249) [-434.285] (-430.284) -- 0:00:13
761000 -- (-433.208) (-431.777) (-431.548) [-430.946] * (-432.710) [-429.577] (-430.790) (-431.247) -- 0:00:13
761500 -- (-430.120) (-432.672) (-432.209) [-430.231] * (-429.907) (-429.813) (-429.658) [-435.516] -- 0:00:13
762000 -- (-430.840) (-438.334) (-430.959) [-432.501] * (-430.310) (-430.551) [-430.096] (-431.194) -- 0:00:13
762500 -- [-432.365] (-433.599) (-434.750) (-431.373) * (-431.836) [-431.065] (-431.623) (-430.629) -- 0:00:13
763000 -- (-431.222) (-437.057) (-430.788) [-430.821] * (-430.989) (-431.798) [-432.966] (-432.763) -- 0:00:13
763500 -- (-432.342) (-432.673) (-431.580) [-429.925] * (-431.500) (-432.831) (-431.151) [-430.431] -- 0:00:13
764000 -- (-430.938) (-430.323) [-432.286] (-430.988) * [-431.335] (-431.718) (-433.443) (-434.258) -- 0:00:13
764500 -- (-430.734) (-432.629) [-430.681] (-435.799) * (-430.204) [-431.334] (-433.769) (-434.526) -- 0:00:13
765000 -- (-431.791) (-431.843) [-430.663] (-430.792) * [-429.877] (-431.100) (-430.719) (-436.360) -- 0:00:13
Average standard deviation of split frequencies: 0.013501
765500 -- [-430.499] (-429.071) (-433.435) (-431.126) * (-430.839) (-431.231) (-432.422) [-432.702] -- 0:00:13
766000 -- (-430.711) (-430.768) [-429.896] (-433.232) * [-432.170] (-437.007) (-432.564) (-430.603) -- 0:00:13
766500 -- [-435.662] (-431.683) (-431.813) (-431.872) * (-430.459) [-432.133] (-433.076) (-429.451) -- 0:00:13
767000 -- (-434.058) [-430.658] (-429.422) (-430.287) * [-430.498] (-431.150) (-430.135) (-430.204) -- 0:00:13
767500 -- (-433.112) [-430.196] (-429.190) (-431.462) * [-432.240] (-430.105) (-429.334) (-431.559) -- 0:00:13
768000 -- (-430.920) (-428.920) [-429.989] (-430.476) * (-430.195) (-431.835) [-430.399] (-429.958) -- 0:00:13
768500 -- (-432.917) (-430.284) (-430.284) [-429.503] * (-429.223) [-433.141] (-432.189) (-433.846) -- 0:00:13
769000 -- (-430.996) (-429.901) [-430.792] (-431.660) * (-433.414) (-430.766) [-430.968] (-432.708) -- 0:00:13
769500 -- (-434.023) (-430.811) (-429.225) [-432.320] * (-435.023) [-429.073] (-430.691) (-431.182) -- 0:00:13
770000 -- (-430.653) (-433.587) [-435.156] (-431.759) * (-431.820) (-431.569) (-431.181) [-429.304] -- 0:00:13
Average standard deviation of split frequencies: 0.013534
770500 -- (-429.800) [-430.358] (-429.618) (-430.534) * (-434.819) (-429.967) (-432.006) [-430.329] -- 0:00:13
771000 -- (-429.375) (-430.082) [-429.687] (-429.146) * [-431.676] (-430.059) (-430.175) (-429.698) -- 0:00:13
771500 -- (-431.181) [-429.438] (-429.215) (-431.369) * (-430.167) (-429.750) [-432.295] (-430.648) -- 0:00:13
772000 -- (-429.104) (-431.991) [-429.895] (-432.294) * (-430.705) (-429.995) (-433.329) [-432.225] -- 0:00:13
772500 -- (-430.686) [-433.113] (-430.442) (-433.574) * [-430.298] (-432.418) (-433.302) (-431.651) -- 0:00:13
773000 -- (-430.774) [-431.680] (-430.561) (-430.800) * (-429.877) (-432.165) [-433.364] (-434.248) -- 0:00:13
773500 -- [-430.531] (-430.388) (-433.228) (-429.869) * [-430.866] (-429.900) (-431.420) (-430.479) -- 0:00:13
774000 -- (-429.560) (-432.321) [-433.703] (-430.816) * (-429.565) (-429.400) (-431.709) [-429.681] -- 0:00:13
774500 -- (-437.459) [-433.973] (-436.988) (-431.171) * (-429.509) (-433.281) (-431.330) [-432.161] -- 0:00:13
775000 -- [-431.565] (-431.411) (-432.090) (-435.240) * [-435.799] (-429.607) (-432.303) (-430.661) -- 0:00:13
Average standard deviation of split frequencies: 0.013289
775500 -- (-430.553) [-435.504] (-432.164) (-434.513) * (-437.804) (-431.494) [-434.920] (-435.446) -- 0:00:13
776000 -- (-430.187) (-431.845) [-430.274] (-432.386) * (-434.589) (-433.656) [-433.404] (-432.399) -- 0:00:12
776500 -- (-428.896) (-432.596) [-431.330] (-430.110) * [-431.422] (-432.705) (-432.771) (-431.698) -- 0:00:12
777000 -- (-431.608) (-433.123) (-431.246) [-429.701] * (-430.597) (-436.248) (-429.428) [-430.004] -- 0:00:12
777500 -- (-431.336) [-432.339] (-430.616) (-429.751) * [-431.564] (-439.274) (-430.526) (-431.970) -- 0:00:12
778000 -- [-431.711] (-431.175) (-429.246) (-430.531) * [-432.913] (-435.358) (-433.600) (-429.986) -- 0:00:12
778500 -- (-433.926) (-430.976) [-430.345] (-430.735) * (-431.652) (-431.904) [-431.776] (-430.176) -- 0:00:12
779000 -- (-429.562) [-429.131] (-432.646) (-431.165) * (-432.157) (-431.306) (-429.209) [-433.918] -- 0:00:12
779500 -- [-429.275] (-429.670) (-430.137) (-429.123) * (-432.117) (-431.438) (-429.217) [-431.624] -- 0:00:12
780000 -- (-429.643) (-429.641) [-437.321] (-431.751) * (-430.170) [-431.739] (-431.747) (-431.793) -- 0:00:12
Average standard deviation of split frequencies: 0.013096
780500 -- (-432.392) (-430.057) (-435.116) [-429.358] * (-430.882) (-429.291) [-433.366] (-430.901) -- 0:00:12
781000 -- (-433.217) (-430.772) (-432.869) [-429.252] * (-430.171) [-433.128] (-430.479) (-429.274) -- 0:00:12
781500 -- [-433.026] (-431.829) (-431.002) (-430.209) * (-432.102) (-430.080) (-432.484) [-430.146] -- 0:00:12
782000 -- (-430.030) (-430.510) [-430.033] (-431.653) * (-432.684) [-430.524] (-431.998) (-430.710) -- 0:00:12
782500 -- [-432.991] (-431.455) (-433.032) (-429.891) * (-429.315) [-430.486] (-431.475) (-429.304) -- 0:00:12
783000 -- (-430.766) (-430.247) (-429.087) [-428.915] * (-431.718) (-434.195) [-430.877] (-430.074) -- 0:00:12
783500 -- (-432.536) (-432.878) [-431.418] (-430.516) * (-429.061) (-432.590) (-431.574) [-431.438] -- 0:00:12
784000 -- (-433.263) [-433.249] (-430.210) (-429.727) * [-430.799] (-430.771) (-433.188) (-432.153) -- 0:00:12
784500 -- (-431.550) (-431.425) [-434.181] (-428.937) * (-430.102) (-434.805) [-431.767] (-431.712) -- 0:00:12
785000 -- (-429.307) (-431.504) (-432.951) [-433.146] * (-430.369) (-429.727) [-431.305] (-432.172) -- 0:00:12
Average standard deviation of split frequencies: 0.012857
785500 -- (-429.183) [-432.283] (-431.478) (-428.949) * (-429.450) (-430.088) (-433.986) [-432.166] -- 0:00:12
786000 -- [-429.652] (-432.880) (-431.889) (-431.834) * (-428.985) (-431.123) [-430.552] (-432.740) -- 0:00:12
786500 -- [-429.314] (-429.099) (-432.868) (-432.240) * (-432.104) (-433.504) [-429.654] (-431.217) -- 0:00:12
787000 -- (-429.791) (-429.530) [-430.474] (-431.339) * (-433.576) (-431.746) (-431.020) [-431.550] -- 0:00:12
787500 -- (-429.675) (-430.280) (-431.317) [-430.522] * (-433.301) (-432.020) [-431.087] (-432.189) -- 0:00:12
788000 -- (-434.737) [-431.219] (-432.583) (-432.420) * (-434.177) (-429.812) (-429.418) [-430.927] -- 0:00:12
788500 -- (-429.778) (-432.141) [-434.171] (-430.978) * (-435.404) (-431.793) [-429.620] (-430.601) -- 0:00:12
789000 -- [-430.574] (-438.419) (-430.998) (-432.006) * (-430.543) (-431.472) (-429.949) [-432.875] -- 0:00:12
789500 -- (-430.435) [-430.832] (-429.963) (-429.874) * (-429.818) [-429.600] (-432.114) (-432.576) -- 0:00:12
790000 -- (-431.874) (-431.137) [-429.554] (-432.606) * [-430.544] (-432.177) (-429.534) (-432.435) -- 0:00:12
Average standard deviation of split frequencies: 0.012148
790500 -- (-432.802) (-429.338) [-430.698] (-432.682) * (-431.824) (-431.981) [-429.575] (-430.396) -- 0:00:12
791000 -- (-433.132) (-431.147) [-432.631] (-430.749) * (-429.891) [-429.609] (-429.706) (-429.920) -- 0:00:12
791500 -- (-433.955) (-430.047) [-430.472] (-433.007) * (-430.978) (-429.817) [-430.580] (-432.688) -- 0:00:12
792000 -- [-431.425] (-433.529) (-429.904) (-431.845) * (-429.819) (-430.006) [-430.198] (-433.369) -- 0:00:12
792500 -- (-432.546) (-429.962) [-430.938] (-431.123) * (-430.618) (-434.816) (-430.019) [-428.757] -- 0:00:12
793000 -- (-432.990) (-430.586) (-430.910) [-429.869] * (-431.230) (-434.598) [-430.227] (-430.965) -- 0:00:12
793500 -- (-429.660) (-434.832) (-430.549) [-429.672] * (-429.453) (-431.509) [-430.542] (-430.209) -- 0:00:11
794000 -- (-433.489) (-429.570) [-430.262] (-433.666) * (-434.499) (-431.558) [-431.886] (-429.809) -- 0:00:11
794500 -- [-430.915] (-433.648) (-429.888) (-431.174) * (-429.732) [-430.683] (-431.075) (-430.160) -- 0:00:11
795000 -- [-429.316] (-430.993) (-432.260) (-433.898) * [-429.779] (-431.427) (-429.463) (-432.730) -- 0:00:11
Average standard deviation of split frequencies: 0.012214
795500 -- (-432.417) [-430.013] (-431.715) (-431.791) * [-430.699] (-431.816) (-431.510) (-430.206) -- 0:00:11
796000 -- (-430.723) (-434.941) [-432.028] (-431.206) * (-430.571) (-429.718) (-432.522) [-430.345] -- 0:00:11
796500 -- [-430.971] (-431.057) (-432.103) (-430.094) * [-430.446] (-430.470) (-431.991) (-429.677) -- 0:00:11
797000 -- [-434.155] (-431.130) (-431.161) (-431.802) * (-432.950) (-431.308) [-429.537] (-436.821) -- 0:00:11
797500 -- [-432.456] (-430.028) (-437.398) (-431.954) * [-432.518] (-430.007) (-430.329) (-434.457) -- 0:00:11
798000 -- [-429.859] (-428.933) (-434.638) (-429.793) * (-429.659) (-430.371) (-435.326) [-432.719] -- 0:00:11
798500 -- (-430.400) (-432.039) (-432.307) [-432.437] * [-430.848] (-429.024) (-431.073) (-431.029) -- 0:00:11
799000 -- [-432.337] (-429.831) (-431.510) (-431.887) * (-430.676) [-430.091] (-432.509) (-429.647) -- 0:00:11
799500 -- (-430.767) (-430.529) (-432.501) [-434.040] * (-429.699) (-429.985) (-430.143) [-433.128] -- 0:00:11
800000 -- [-429.675] (-429.111) (-431.252) (-430.296) * (-430.173) (-431.516) [-431.261] (-433.505) -- 0:00:11
Average standard deviation of split frequencies: 0.012401
800500 -- (-430.394) (-429.668) (-432.578) [-429.646] * (-433.324) (-429.648) [-431.282] (-433.679) -- 0:00:11
801000 -- (-431.164) (-431.340) [-433.484] (-430.712) * (-433.205) (-429.495) (-431.146) [-436.124] -- 0:00:11
801500 -- (-433.313) [-431.172] (-430.403) (-430.992) * (-434.417) (-429.630) [-431.227] (-433.268) -- 0:00:11
802000 -- (-437.852) [-429.954] (-429.722) (-429.791) * (-434.378) [-429.220] (-430.500) (-433.292) -- 0:00:11
802500 -- (-431.270) (-432.893) [-431.142] (-430.644) * [-429.118] (-429.126) (-431.438) (-431.049) -- 0:00:11
803000 -- (-432.359) [-434.411] (-430.250) (-429.210) * (-430.355) [-430.274] (-430.370) (-430.721) -- 0:00:11
803500 -- (-431.393) (-431.959) (-432.183) [-429.058] * (-430.485) (-430.153) (-430.575) [-430.059] -- 0:00:11
804000 -- (-432.631) (-431.903) (-429.305) [-429.725] * (-430.708) [-429.620] (-431.384) (-429.405) -- 0:00:11
804500 -- (-431.841) [-429.086] (-429.134) (-430.082) * (-430.297) (-431.982) (-431.188) [-430.190] -- 0:00:11
805000 -- [-434.189] (-432.272) (-430.291) (-430.945) * (-429.323) (-430.444) (-429.212) [-431.641] -- 0:00:11
Average standard deviation of split frequencies: 0.011953
805500 -- (-436.906) (-429.867) (-430.414) [-434.626] * (-431.304) [-430.005] (-430.322) (-429.259) -- 0:00:11
806000 -- (-433.146) [-429.044] (-431.303) (-436.769) * (-431.070) (-431.707) (-429.842) [-430.020] -- 0:00:11
806500 -- (-432.168) (-431.100) [-430.072] (-431.086) * (-433.923) (-435.016) [-429.220] (-435.122) -- 0:00:11
807000 -- (-433.943) (-432.965) [-430.814] (-429.557) * (-433.008) (-432.958) [-429.723] (-430.139) -- 0:00:11
807500 -- [-431.712] (-433.010) (-431.297) (-433.960) * (-434.000) (-431.615) (-430.350) [-430.073] -- 0:00:11
808000 -- [-432.223] (-431.888) (-438.051) (-432.979) * [-432.345] (-436.811) (-432.815) (-431.144) -- 0:00:11
808500 -- (-430.949) (-432.244) (-429.503) [-429.884] * (-431.176) [-430.350] (-431.258) (-434.519) -- 0:00:11
809000 -- (-432.200) [-431.162] (-429.101) (-430.268) * (-432.790) (-433.218) [-430.210] (-433.093) -- 0:00:11
809500 -- (-429.165) (-432.368) (-429.476) [-431.330] * [-430.248] (-433.529) (-430.970) (-429.809) -- 0:00:11
810000 -- [-431.465] (-431.826) (-432.164) (-430.681) * [-431.748] (-433.931) (-429.426) (-430.525) -- 0:00:11
Average standard deviation of split frequencies: 0.012175
810500 -- (-434.449) [-429.863] (-431.206) (-429.560) * [-431.008] (-433.720) (-429.188) (-431.124) -- 0:00:10
811000 -- [-431.890] (-432.468) (-429.995) (-433.113) * [-430.671] (-430.206) (-429.261) (-429.360) -- 0:00:10
811500 -- (-434.699) [-432.172] (-429.220) (-432.210) * (-430.341) (-430.982) [-429.943] (-429.623) -- 0:00:10
812000 -- (-431.296) (-431.467) (-430.175) [-432.774] * [-430.599] (-432.089) (-430.204) (-430.859) -- 0:00:10
812500 -- (-433.061) [-429.995] (-429.367) (-432.589) * [-434.636] (-429.716) (-429.570) (-428.945) -- 0:00:10
813000 -- (-433.807) (-430.430) (-434.217) [-433.093] * (-435.349) (-430.052) (-429.460) [-429.873] -- 0:00:10
813500 -- (-431.374) [-429.247] (-429.680) (-433.449) * (-435.745) (-430.118) (-432.595) [-430.352] -- 0:00:10
814000 -- [-430.040] (-430.253) (-429.887) (-436.326) * (-433.255) [-429.523] (-430.825) (-429.461) -- 0:00:10
814500 -- (-429.489) (-431.306) [-432.023] (-437.676) * (-430.520) [-430.345] (-431.303) (-431.401) -- 0:00:10
815000 -- (-430.248) [-433.379] (-429.498) (-435.626) * [-430.797] (-429.670) (-431.309) (-430.810) -- 0:00:10
Average standard deviation of split frequencies: 0.011915
815500 -- (-431.315) (-430.642) (-430.877) [-432.516] * (-430.326) [-430.220] (-434.322) (-430.523) -- 0:00:10
816000 -- (-433.340) [-430.505] (-433.678) (-431.736) * (-429.527) [-430.368] (-433.353) (-430.335) -- 0:00:10
816500 -- (-431.668) [-431.901] (-436.079) (-433.177) * (-431.669) [-430.105] (-433.829) (-430.308) -- 0:00:10
817000 -- [-429.152] (-430.764) (-431.871) (-431.790) * (-430.432) [-430.985] (-431.797) (-430.084) -- 0:00:10
817500 -- (-429.677) (-432.347) [-432.650] (-429.105) * [-430.596] (-431.053) (-429.362) (-432.309) -- 0:00:10
818000 -- (-434.840) (-432.280) (-431.038) [-432.757] * (-431.128) (-432.246) (-432.894) [-431.601] -- 0:00:10
818500 -- [-430.740] (-430.438) (-431.390) (-430.878) * (-432.417) (-430.358) (-433.286) [-432.678] -- 0:00:10
819000 -- [-429.892] (-430.027) (-430.137) (-434.094) * (-431.734) (-434.265) (-431.163) [-430.330] -- 0:00:10
819500 -- (-430.163) [-430.436] (-434.319) (-431.610) * [-431.081] (-430.757) (-435.217) (-431.281) -- 0:00:10
820000 -- (-430.990) [-431.012] (-430.367) (-432.386) * (-430.673) (-432.107) [-430.490] (-432.830) -- 0:00:10
Average standard deviation of split frequencies: 0.011704
820500 -- (-431.990) (-428.966) [-429.653] (-430.624) * (-432.091) [-431.977] (-431.208) (-429.983) -- 0:00:10
821000 -- (-432.949) (-430.913) [-429.680] (-432.551) * [-431.001] (-432.307) (-433.403) (-434.710) -- 0:00:10
821500 -- (-432.975) (-432.756) (-430.140) [-430.546] * [-431.308] (-432.550) (-431.267) (-429.666) -- 0:00:10
822000 -- [-431.282] (-431.365) (-435.056) (-431.415) * (-437.508) (-433.207) (-431.425) [-432.029] -- 0:00:10
822500 -- (-431.279) (-429.294) [-434.029] (-432.668) * (-429.562) [-431.653] (-430.663) (-431.356) -- 0:00:10
823000 -- (-429.648) (-429.543) (-431.304) [-432.175] * (-435.477) (-431.647) (-433.496) [-431.807] -- 0:00:10
823500 -- [-431.115] (-432.869) (-436.106) (-431.567) * [-429.301] (-429.990) (-431.945) (-431.861) -- 0:00:10
824000 -- [-431.015] (-430.014) (-431.233) (-433.101) * [-430.168] (-429.687) (-430.673) (-430.495) -- 0:00:10
824500 -- (-430.206) [-433.622] (-430.948) (-434.183) * (-430.238) (-432.265) (-432.926) [-428.927] -- 0:00:10
825000 -- (-430.048) (-431.813) [-431.551] (-432.705) * [-429.289] (-430.823) (-432.492) (-433.031) -- 0:00:10
Average standard deviation of split frequencies: 0.011378
825500 -- [-429.144] (-433.165) (-431.273) (-432.935) * (-429.503) [-430.582] (-431.010) (-432.320) -- 0:00:10
826000 -- (-430.538) (-429.747) (-431.611) [-431.718] * (-432.096) (-431.198) (-430.336) [-430.803] -- 0:00:10
826500 -- [-435.869] (-429.085) (-430.647) (-430.729) * (-430.438) [-430.663] (-430.342) (-433.893) -- 0:00:10
827000 -- (-431.243) (-432.840) [-433.849] (-429.459) * (-432.375) (-431.050) (-431.489) [-432.772] -- 0:00:10
827500 -- (-431.595) [-430.563] (-433.696) (-434.347) * [-433.154] (-432.171) (-431.522) (-432.229) -- 0:00:10
828000 -- (-430.721) [-430.067] (-430.416) (-430.859) * (-433.029) [-429.740] (-434.082) (-436.215) -- 0:00:09
828500 -- [-429.780] (-432.296) (-433.115) (-430.148) * (-430.288) (-430.423) (-433.632) [-431.316] -- 0:00:09
829000 -- [-430.865] (-433.105) (-430.888) (-430.321) * (-433.865) (-431.423) (-430.134) [-429.862] -- 0:00:09
829500 -- (-432.093) (-429.861) (-432.481) [-429.716] * [-430.907] (-430.468) (-431.350) (-430.996) -- 0:00:09
830000 -- [-430.550] (-430.394) (-431.501) (-433.565) * (-431.631) (-432.658) (-431.177) [-430.320] -- 0:00:09
Average standard deviation of split frequencies: 0.011173
830500 -- [-430.150] (-431.581) (-436.374) (-433.746) * [-430.112] (-432.920) (-432.020) (-432.929) -- 0:00:09
831000 -- (-430.521) (-433.407) (-430.887) [-431.833] * (-430.791) [-433.888] (-437.639) (-430.192) -- 0:00:09
831500 -- (-431.968) [-429.415] (-431.812) (-431.026) * (-433.233) (-430.331) [-435.352] (-430.368) -- 0:00:09
832000 -- [-435.726] (-431.283) (-433.020) (-431.851) * (-433.256) (-434.683) (-434.201) [-431.108] -- 0:00:09
832500 -- (-430.186) [-430.148] (-431.258) (-431.535) * (-432.284) (-430.600) [-434.412] (-432.870) -- 0:00:09
833000 -- (-429.435) [-429.061] (-432.922) (-429.805) * (-432.024) (-429.929) [-430.220] (-430.188) -- 0:00:09
833500 -- [-429.098] (-434.837) (-431.047) (-432.721) * (-431.399) (-433.625) (-432.676) [-431.492] -- 0:00:09
834000 -- [-429.089] (-433.779) (-429.110) (-435.518) * (-429.651) (-430.997) [-430.150] (-430.373) -- 0:00:09
834500 -- [-428.969] (-429.758) (-430.054) (-431.389) * (-430.305) (-428.914) [-432.352] (-431.739) -- 0:00:09
835000 -- (-430.092) (-431.219) (-430.611) [-431.887] * (-429.725) (-430.010) (-429.759) [-430.967] -- 0:00:09
Average standard deviation of split frequencies: 0.011207
835500 -- [-429.545] (-429.001) (-432.185) (-433.665) * (-433.295) (-430.433) (-429.814) [-430.224] -- 0:00:09
836000 -- (-430.141) (-428.963) (-430.763) [-434.324] * (-432.106) [-429.875] (-432.310) (-429.459) -- 0:00:09
836500 -- (-430.516) (-429.374) [-429.919] (-434.243) * (-430.446) (-432.371) (-429.985) [-429.793] -- 0:00:09
837000 -- [-430.691] (-430.610) (-430.457) (-434.618) * (-430.199) (-429.605) [-430.193] (-429.880) -- 0:00:09
837500 -- (-431.059) [-429.142] (-430.201) (-430.642) * (-430.221) [-431.807] (-431.085) (-429.725) -- 0:00:09
838000 -- [-430.509] (-430.797) (-430.759) (-429.993) * (-429.733) (-430.119) (-438.269) [-429.725] -- 0:00:09
838500 -- (-431.723) (-431.235) (-429.216) [-432.527] * [-428.893] (-430.809) (-436.682) (-429.469) -- 0:00:09
839000 -- (-432.359) [-430.459] (-429.193) (-435.174) * (-430.601) (-429.246) [-431.139] (-431.331) -- 0:00:09
839500 -- [-430.531] (-431.119) (-429.406) (-431.791) * (-430.150) [-431.639] (-429.645) (-430.251) -- 0:00:09
840000 -- (-430.970) (-432.868) [-429.002] (-431.729) * (-429.434) [-429.375] (-429.675) (-429.729) -- 0:00:09
Average standard deviation of split frequencies: 0.010579
840500 -- [-432.640] (-430.876) (-429.934) (-433.808) * (-429.854) [-431.819] (-431.610) (-430.318) -- 0:00:09
841000 -- (-431.406) (-429.143) [-434.914] (-430.542) * (-434.889) [-432.204] (-431.328) (-430.090) -- 0:00:09
841500 -- [-430.815] (-430.290) (-431.159) (-429.519) * (-430.558) [-429.530] (-434.136) (-429.529) -- 0:00:09
842000 -- (-434.379) (-430.051) (-431.152) [-431.805] * [-430.386] (-433.275) (-431.523) (-430.121) -- 0:00:09
842500 -- [-429.923] (-429.472) (-435.264) (-436.946) * (-430.448) [-431.696] (-432.327) (-431.570) -- 0:00:09
843000 -- (-432.381) [-429.965] (-429.391) (-433.283) * (-431.607) [-431.373] (-430.601) (-431.696) -- 0:00:09
843500 -- (-433.495) (-429.970) [-431.493] (-430.613) * (-431.870) [-432.590] (-430.836) (-430.911) -- 0:00:09
844000 -- (-438.172) (-430.907) [-428.798] (-430.728) * (-442.368) (-433.300) (-432.741) [-430.420] -- 0:00:09
844500 -- (-429.477) [-431.405] (-429.292) (-431.070) * [-434.909] (-431.945) (-434.199) (-430.744) -- 0:00:09
845000 -- (-429.212) (-429.349) [-429.258] (-432.708) * (-437.734) (-435.286) [-434.269] (-432.833) -- 0:00:08
Average standard deviation of split frequencies: 0.010364
845500 -- [-430.903] (-430.798) (-431.061) (-430.172) * (-434.907) (-429.840) (-432.596) [-434.525] -- 0:00:08
846000 -- (-430.841) [-428.720] (-431.333) (-431.622) * (-430.526) (-430.281) [-430.456] (-431.572) -- 0:00:08
846500 -- (-432.725) [-430.107] (-429.987) (-430.278) * [-429.660] (-435.248) (-430.855) (-430.299) -- 0:00:08
847000 -- (-432.445) (-429.066) [-430.769] (-430.989) * (-433.547) (-433.447) [-430.412] (-429.404) -- 0:00:08
847500 -- (-431.847) [-429.524] (-430.697) (-434.810) * (-440.650) [-431.274] (-434.173) (-432.446) -- 0:00:08
848000 -- (-433.397) (-431.642) [-430.606] (-431.413) * (-429.570) [-428.859] (-431.049) (-432.852) -- 0:00:08
848500 -- (-431.921) (-429.896) [-429.383] (-430.898) * (-431.107) (-428.851) (-432.011) [-432.850] -- 0:00:08
849000 -- (-430.149) [-432.842] (-429.857) (-429.781) * (-430.906) (-433.136) (-435.861) [-431.973] -- 0:00:08
849500 -- (-435.432) (-430.862) [-430.827] (-430.779) * (-431.862) [-433.610] (-433.530) (-432.691) -- 0:00:08
850000 -- [-429.595] (-431.745) (-432.469) (-429.823) * (-429.234) [-431.531] (-430.339) (-429.659) -- 0:00:08
Average standard deviation of split frequencies: 0.010603
850500 -- (-430.943) (-429.623) [-437.335] (-431.213) * [-430.605] (-432.537) (-431.765) (-433.722) -- 0:00:08
851000 -- [-430.547] (-436.553) (-431.579) (-432.661) * (-429.096) [-430.439] (-432.026) (-431.204) -- 0:00:08
851500 -- (-432.165) (-431.211) (-430.308) [-434.794] * (-429.353) (-429.553) [-431.267] (-430.263) -- 0:00:08
852000 -- (-430.526) (-431.064) (-432.614) [-432.365] * [-434.360] (-432.021) (-433.206) (-431.775) -- 0:00:08
852500 -- [-430.290] (-431.613) (-436.438) (-429.781) * (-433.568) [-429.460] (-432.741) (-435.930) -- 0:00:08
853000 -- (-431.153) (-432.257) (-431.988) [-434.036] * [-433.144] (-430.364) (-429.841) (-430.689) -- 0:00:08
853500 -- (-433.149) [-429.744] (-434.458) (-432.824) * [-429.925] (-431.753) (-432.123) (-431.601) -- 0:00:08
854000 -- (-430.835) (-430.451) (-429.745) [-432.504] * (-429.686) (-432.469) [-430.460] (-433.267) -- 0:00:08
854500 -- (-430.803) [-429.526] (-430.522) (-430.392) * (-429.283) [-435.183] (-429.073) (-430.987) -- 0:00:08
855000 -- (-432.995) [-430.964] (-434.134) (-431.238) * (-430.528) (-434.194) [-429.559] (-433.019) -- 0:00:08
Average standard deviation of split frequencies: 0.010720
855500 -- (-434.126) (-429.399) [-433.263] (-429.528) * [-431.787] (-430.361) (-430.745) (-431.439) -- 0:00:08
856000 -- (-430.163) (-430.657) [-432.674] (-430.282) * (-430.389) (-432.329) (-434.032) [-431.560] -- 0:00:08
856500 -- (-433.500) (-431.935) [-432.965] (-435.219) * (-432.595) [-435.886] (-432.723) (-431.556) -- 0:00:08
857000 -- (-434.385) [-433.235] (-430.017) (-432.934) * (-431.655) [-430.851] (-429.195) (-430.886) -- 0:00:08
857500 -- (-433.996) [-431.510] (-430.786) (-429.552) * (-431.024) (-431.030) (-432.555) [-431.114] -- 0:00:08
858000 -- (-431.742) (-432.919) [-429.496] (-429.634) * (-429.678) (-433.333) (-429.550) [-430.379] -- 0:00:08
858500 -- [-429.850] (-430.890) (-429.637) (-431.777) * (-432.147) (-431.375) (-430.282) [-429.252] -- 0:00:08
859000 -- (-430.349) (-430.404) [-430.099] (-429.303) * [-434.830] (-433.619) (-431.116) (-430.688) -- 0:00:08
859500 -- (-432.305) (-430.003) (-432.249) [-429.628] * (-432.484) (-429.270) [-433.803] (-433.301) -- 0:00:08
860000 -- [-431.786] (-434.466) (-429.954) (-429.305) * [-431.621] (-429.756) (-434.301) (-429.825) -- 0:00:08
Average standard deviation of split frequencies: 0.010699
860500 -- (-431.454) [-429.986] (-430.326) (-429.594) * [-432.937] (-431.131) (-431.372) (-430.210) -- 0:00:08
861000 -- (-435.146) [-432.523] (-431.359) (-430.167) * [-432.919] (-429.975) (-429.144) (-431.426) -- 0:00:08
861500 -- (-431.907) (-431.388) [-429.557] (-430.831) * (-431.207) (-429.719) [-433.302] (-431.571) -- 0:00:08
862000 -- (-431.898) [-429.409] (-430.200) (-430.414) * (-432.326) [-432.530] (-431.168) (-431.465) -- 0:00:08
862500 -- (-429.719) (-430.706) [-429.805] (-430.266) * (-436.005) (-430.349) [-430.477] (-429.745) -- 0:00:07
863000 -- (-430.522) [-430.573] (-431.000) (-429.498) * (-432.616) [-432.802] (-430.140) (-433.452) -- 0:00:07
863500 -- [-431.465] (-430.617) (-431.863) (-429.496) * (-432.372) (-432.337) (-433.210) [-429.588] -- 0:00:07
864000 -- (-432.704) (-430.631) [-432.515] (-430.810) * [-432.060] (-431.089) (-433.657) (-429.908) -- 0:00:07
864500 -- (-430.341) [-430.393] (-432.355) (-433.423) * [-428.950] (-431.192) (-436.278) (-430.076) -- 0:00:07
865000 -- (-430.332) [-433.094] (-432.908) (-433.470) * (-429.271) [-432.280] (-432.182) (-432.943) -- 0:00:07
Average standard deviation of split frequencies: 0.010778
865500 -- (-429.448) [-430.820] (-432.450) (-437.280) * (-431.033) [-431.755] (-434.129) (-432.440) -- 0:00:07
866000 -- [-430.521] (-431.497) (-432.234) (-433.152) * [-430.351] (-435.412) (-431.104) (-431.240) -- 0:00:07
866500 -- (-433.631) (-437.269) [-430.959] (-432.619) * (-430.436) [-434.474] (-430.099) (-430.907) -- 0:00:07
867000 -- [-429.853] (-432.457) (-431.129) (-431.753) * (-431.646) [-438.150] (-430.834) (-432.747) -- 0:00:07
867500 -- (-429.976) (-430.883) (-430.151) [-430.501] * (-433.921) [-429.379] (-430.021) (-431.080) -- 0:00:07
868000 -- (-430.232) (-429.705) (-440.494) [-431.038] * (-431.903) (-432.413) (-433.333) [-430.985] -- 0:00:07
868500 -- (-429.229) (-430.752) [-433.113] (-434.515) * (-431.979) [-430.357] (-430.864) (-436.939) -- 0:00:07
869000 -- [-431.409] (-431.509) (-431.256) (-430.897) * (-430.303) (-429.213) [-429.938] (-432.622) -- 0:00:07
869500 -- (-429.142) (-432.828) (-434.259) [-431.432] * (-433.924) (-430.764) (-430.436) [-434.734] -- 0:00:07
870000 -- [-428.815] (-432.878) (-430.185) (-429.662) * (-431.640) (-429.781) (-430.192) [-430.454] -- 0:00:07
Average standard deviation of split frequencies: 0.010865
870500 -- (-433.704) (-432.307) [-432.195] (-431.059) * (-430.240) (-429.232) (-429.538) [-430.772] -- 0:00:07
871000 -- (-432.363) (-432.709) [-429.706] (-431.804) * (-430.195) [-432.285] (-429.853) (-430.547) -- 0:00:07
871500 -- (-431.073) (-429.732) [-429.339] (-431.152) * (-429.061) (-431.761) [-429.429] (-431.061) -- 0:00:07
872000 -- (-430.288) (-434.168) [-431.946] (-431.031) * (-432.287) (-439.910) (-432.883) [-432.284] -- 0:00:07
872500 -- (-432.797) (-430.744) [-430.877] (-430.633) * (-434.370) (-430.326) [-432.478] (-437.059) -- 0:00:07
873000 -- (-432.948) (-429.788) [-431.137] (-431.367) * (-430.620) [-429.568] (-431.509) (-429.489) -- 0:00:07
873500 -- [-432.245] (-433.723) (-430.055) (-430.653) * [-433.395] (-432.083) (-430.405) (-433.576) -- 0:00:07
874000 -- (-436.365) (-432.910) [-431.358] (-435.887) * (-430.596) (-433.358) (-431.986) [-429.586] -- 0:00:07
874500 -- (-430.943) [-430.579] (-431.145) (-434.094) * [-429.348] (-433.831) (-430.496) (-430.752) -- 0:00:07
875000 -- (-432.828) (-430.584) (-431.560) [-430.793] * (-430.464) (-431.171) [-430.518] (-430.970) -- 0:00:07
Average standard deviation of split frequencies: 0.010727
875500 -- (-430.914) [-433.701] (-430.675) (-431.858) * (-432.103) (-433.745) (-433.046) [-431.576] -- 0:00:07
876000 -- (-430.899) (-434.057) [-429.698] (-431.357) * (-430.047) (-430.134) [-430.117] (-430.012) -- 0:00:07
876500 -- (-430.923) (-433.519) (-429.537) [-431.057] * [-430.703] (-431.978) (-429.448) (-431.937) -- 0:00:07
877000 -- (-429.648) (-430.797) (-433.257) [-429.860] * [-429.528] (-431.470) (-432.283) (-429.653) -- 0:00:07
877500 -- [-430.810] (-430.655) (-430.522) (-433.016) * (-430.118) (-429.881) [-431.000] (-431.159) -- 0:00:07
878000 -- (-432.942) [-431.618] (-429.705) (-433.421) * (-431.550) (-432.137) [-434.575] (-430.929) -- 0:00:07
878500 -- (-431.054) [-430.519] (-430.764) (-431.106) * (-431.059) (-431.107) (-432.466) [-435.783] -- 0:00:07
879000 -- (-432.994) (-432.083) (-433.013) [-431.845] * (-430.252) [-433.275] (-429.062) (-434.124) -- 0:00:07
879500 -- [-434.903] (-432.079) (-433.516) (-432.824) * (-431.833) (-432.259) (-431.164) [-431.098] -- 0:00:06
880000 -- [-430.700] (-429.419) (-433.525) (-432.038) * (-430.593) (-432.481) [-430.568] (-431.046) -- 0:00:06
Average standard deviation of split frequencies: 0.010741
880500 -- (-429.865) [-429.290] (-431.218) (-431.610) * (-430.393) [-431.193] (-429.905) (-431.207) -- 0:00:06
881000 -- (-429.316) (-431.084) [-431.100] (-433.477) * (-433.838) (-431.070) (-431.144) [-433.313] -- 0:00:06
881500 -- (-437.279) (-434.970) [-430.709] (-430.965) * (-434.576) [-432.051] (-431.982) (-432.139) -- 0:00:06
882000 -- (-430.299) (-430.929) (-432.051) [-431.310] * (-428.986) (-431.829) [-431.991] (-429.605) -- 0:00:06
882500 -- (-434.658) (-430.761) [-430.752] (-430.925) * [-430.271] (-429.497) (-434.069) (-432.264) -- 0:00:06
883000 -- (-430.663) (-432.028) [-431.538] (-432.214) * [-431.506] (-429.670) (-432.202) (-431.272) -- 0:00:06
883500 -- (-429.384) (-431.035) (-433.670) [-429.150] * (-432.045) (-430.066) (-432.362) [-431.863] -- 0:00:06
884000 -- (-429.880) (-438.388) [-434.597] (-431.875) * (-431.415) (-430.211) [-433.602] (-433.739) -- 0:00:06
884500 -- [-429.762] (-431.952) (-434.001) (-430.675) * (-430.404) (-431.607) [-434.218] (-433.647) -- 0:00:06
885000 -- (-429.686) (-430.714) [-430.657] (-429.141) * (-432.059) [-429.831] (-431.781) (-430.124) -- 0:00:06
Average standard deviation of split frequencies: 0.010677
885500 -- [-434.282] (-433.774) (-436.267) (-431.038) * (-429.681) (-429.571) [-430.119] (-431.670) -- 0:00:06
886000 -- (-430.932) [-433.406] (-431.244) (-433.944) * (-431.149) (-432.217) (-433.485) [-433.094] -- 0:00:06
886500 -- (-430.870) (-433.828) (-430.574) [-429.336] * [-434.262] (-432.989) (-432.063) (-430.853) -- 0:00:06
887000 -- [-429.969] (-437.428) (-430.838) (-430.575) * (-430.295) [-431.368] (-432.196) (-435.058) -- 0:00:06
887500 -- (-431.557) (-431.717) (-431.195) [-431.344] * (-431.728) (-430.512) [-429.938] (-433.296) -- 0:00:06
888000 -- [-429.497] (-430.363) (-429.337) (-431.056) * [-430.015] (-429.877) (-433.887) (-431.131) -- 0:00:06
888500 -- (-430.582) (-432.825) [-431.440] (-431.736) * (-430.358) [-429.392] (-432.254) (-432.052) -- 0:00:06
889000 -- [-430.507] (-433.182) (-430.731) (-430.547) * [-433.175] (-429.634) (-433.524) (-433.023) -- 0:00:06
889500 -- [-430.426] (-429.133) (-431.946) (-430.074) * (-430.833) [-429.726] (-432.426) (-432.791) -- 0:00:06
890000 -- (-430.392) (-430.287) [-430.809] (-429.069) * [-430.069] (-429.882) (-429.380) (-433.599) -- 0:00:06
Average standard deviation of split frequencies: 0.010197
890500 -- (-429.908) [-430.846] (-431.404) (-429.513) * (-431.129) [-438.095] (-434.264) (-431.629) -- 0:00:06
891000 -- (-430.127) (-430.822) (-430.491) [-430.631] * (-430.371) (-431.074) [-429.265] (-431.766) -- 0:00:06
891500 -- (-432.484) [-429.747] (-433.050) (-429.838) * (-430.261) (-430.309) (-431.315) [-432.424] -- 0:00:06
892000 -- (-430.833) (-429.549) (-435.687) [-436.125] * (-430.141) (-430.136) (-431.975) [-432.700] -- 0:00:06
892500 -- (-430.542) [-432.009] (-431.710) (-430.766) * [-429.287] (-429.796) (-432.474) (-433.015) -- 0:00:06
893000 -- (-430.910) (-432.232) (-433.487) [-430.440] * (-429.906) (-437.554) (-431.654) [-434.535] -- 0:00:06
893500 -- (-433.791) (-431.450) (-431.864) [-430.616] * (-430.279) (-430.460) [-431.439] (-430.394) -- 0:00:06
894000 -- (-431.641) [-431.269] (-431.259) (-430.272) * (-431.239) [-431.472] (-431.614) (-430.725) -- 0:00:06
894500 -- (-433.190) (-433.364) [-433.923] (-435.573) * (-431.982) (-429.196) [-430.900] (-431.397) -- 0:00:06
895000 -- (-432.174) (-432.361) (-434.051) [-430.240] * (-432.384) (-430.312) (-430.506) [-429.334] -- 0:00:06
Average standard deviation of split frequencies: 0.010417
895500 -- (-430.998) [-430.190] (-430.874) (-432.891) * (-430.962) (-433.851) [-433.834] (-437.194) -- 0:00:06
896000 -- [-430.133] (-438.120) (-429.933) (-430.219) * (-430.335) (-430.657) (-432.221) [-430.180] -- 0:00:06
896500 -- (-429.822) [-432.227] (-436.415) (-430.403) * (-431.833) [-432.402] (-435.539) (-430.959) -- 0:00:06
897000 -- [-429.475] (-432.231) (-431.011) (-432.361) * (-432.176) [-430.888] (-431.491) (-432.203) -- 0:00:05
897500 -- [-430.031] (-430.928) (-429.536) (-432.478) * (-438.848) (-432.156) [-429.413] (-431.290) -- 0:00:05
898000 -- (-428.806) [-431.652] (-430.897) (-430.979) * (-436.196) (-433.193) [-431.810] (-429.865) -- 0:00:05
898500 -- (-429.879) (-429.724) (-430.760) [-432.247] * (-430.034) (-436.466) [-434.580] (-430.386) -- 0:00:05
899000 -- (-430.138) [-431.534] (-429.770) (-433.496) * (-430.156) (-432.912) (-434.924) [-434.412] -- 0:00:05
899500 -- [-429.791] (-431.378) (-433.026) (-434.648) * (-428.896) (-430.943) (-430.824) [-439.744] -- 0:00:05
900000 -- (-432.857) (-429.862) [-430.217] (-431.488) * (-439.049) [-428.862] (-432.116) (-433.177) -- 0:00:05
Average standard deviation of split frequencies: 0.010573
900500 -- [-430.598] (-428.936) (-429.673) (-436.477) * (-432.670) [-429.404] (-433.494) (-432.927) -- 0:00:05
901000 -- (-429.165) (-429.392) (-433.750) [-430.940] * (-432.719) (-431.722) (-432.087) [-432.314] -- 0:00:05
901500 -- [-428.991] (-433.305) (-430.840) (-430.452) * (-435.445) [-430.275] (-431.267) (-436.424) -- 0:00:05
902000 -- (-430.722) (-432.851) (-430.151) [-432.325] * (-432.646) [-431.537] (-431.055) (-433.969) -- 0:00:05
902500 -- (-430.160) (-432.498) (-430.858) [-430.694] * [-432.931] (-434.651) (-428.913) (-430.907) -- 0:00:05
903000 -- (-430.012) (-432.312) (-430.676) [-429.724] * [-431.344] (-430.786) (-429.609) (-431.575) -- 0:00:05
903500 -- [-429.913] (-436.905) (-431.128) (-430.939) * [-433.756] (-433.334) (-430.735) (-434.410) -- 0:00:05
904000 -- (-431.082) (-429.506) (-434.477) [-430.477] * (-432.393) (-430.344) (-430.908) [-430.553] -- 0:00:05
904500 -- [-430.029] (-432.677) (-432.970) (-429.348) * (-429.263) (-430.796) (-430.108) [-430.160] -- 0:00:05
905000 -- (-432.891) [-429.344] (-432.611) (-429.142) * (-429.866) (-431.040) [-429.555] (-431.315) -- 0:00:05
Average standard deviation of split frequencies: 0.010406
905500 -- (-429.052) (-429.807) (-431.761) [-429.015] * (-430.047) [-430.352] (-430.498) (-432.154) -- 0:00:05
906000 -- (-431.665) [-429.858] (-431.218) (-430.499) * [-429.629] (-430.317) (-430.003) (-431.973) -- 0:00:05
906500 -- (-433.434) (-434.509) [-433.618] (-433.554) * (-429.710) (-433.014) [-430.696] (-430.313) -- 0:00:05
907000 -- [-432.890] (-434.190) (-429.685) (-435.195) * (-434.528) (-435.723) (-431.445) [-429.205] -- 0:00:05
907500 -- (-433.627) [-433.718] (-429.436) (-433.056) * (-429.738) [-435.427] (-431.997) (-432.153) -- 0:00:05
908000 -- (-430.796) (-430.298) (-430.624) [-430.041] * [-432.874] (-434.047) (-430.027) (-430.519) -- 0:00:05
908500 -- [-431.979] (-432.507) (-430.554) (-431.448) * [-436.684] (-431.669) (-435.957) (-433.999) -- 0:00:05
909000 -- [-432.065] (-432.577) (-430.335) (-431.436) * (-439.845) [-432.941] (-431.547) (-431.848) -- 0:00:05
909500 -- (-431.897) (-429.761) (-434.587) [-432.269] * [-430.459] (-429.964) (-432.045) (-430.322) -- 0:00:05
910000 -- (-436.789) (-429.761) (-429.057) [-429.830] * [-431.039] (-430.384) (-429.402) (-430.323) -- 0:00:05
Average standard deviation of split frequencies: 0.010042
910500 -- (-431.844) (-430.793) (-431.843) [-429.427] * (-431.236) [-431.149] (-430.458) (-432.132) -- 0:00:05
911000 -- (-430.719) (-430.224) (-432.117) [-430.718] * (-430.005) (-431.728) [-432.326] (-429.982) -- 0:00:05
911500 -- [-430.213] (-429.917) (-429.580) (-432.232) * (-431.217) (-431.366) [-430.995] (-432.521) -- 0:00:05
912000 -- (-429.387) [-431.068] (-433.981) (-431.285) * (-431.505) [-432.986] (-433.040) (-429.950) -- 0:00:05
912500 -- (-429.319) (-431.129) [-429.494] (-431.425) * (-431.022) (-433.827) (-433.732) [-431.568] -- 0:00:05
913000 -- [-428.865] (-431.020) (-430.633) (-432.787) * (-434.264) (-430.146) (-430.580) [-431.274] -- 0:00:05
913500 -- (-428.856) (-430.221) (-430.946) [-429.505] * (-431.239) [-430.131] (-433.581) (-431.870) -- 0:00:05
914000 -- [-429.187] (-430.101) (-433.510) (-429.680) * (-433.082) [-430.560] (-430.241) (-431.844) -- 0:00:04
914500 -- [-429.330] (-430.096) (-430.192) (-431.801) * (-431.329) [-431.603] (-430.859) (-431.859) -- 0:00:04
915000 -- (-432.319) (-432.836) (-429.308) [-432.370] * [-432.020] (-429.050) (-430.137) (-430.153) -- 0:00:04
Average standard deviation of split frequencies: 0.009812
915500 -- [-433.545] (-430.055) (-431.195) (-428.884) * (-429.836) [-429.323] (-432.724) (-430.550) -- 0:00:04
916000 -- (-430.962) [-431.691] (-430.062) (-431.886) * (-430.456) (-430.559) (-431.640) [-429.058] -- 0:00:04
916500 -- (-431.878) [-430.191] (-432.985) (-430.398) * [-432.236] (-428.873) (-434.129) (-428.841) -- 0:00:04
917000 -- (-429.560) (-430.117) (-434.589) [-430.237] * (-432.774) (-430.944) [-430.713] (-432.579) -- 0:00:04
917500 -- (-431.474) (-430.213) (-431.757) [-430.731] * (-431.855) (-432.206) (-437.798) [-430.419] -- 0:00:04
918000 -- (-432.122) [-429.807] (-430.710) (-432.438) * [-432.939] (-433.235) (-436.641) (-432.175) -- 0:00:04
918500 -- [-430.264] (-433.633) (-430.371) (-433.496) * (-430.592) (-433.453) (-433.076) [-430.558] -- 0:00:04
919000 -- [-430.601] (-435.012) (-431.265) (-429.201) * (-430.585) (-433.583) (-429.994) [-430.098] -- 0:00:04
919500 -- (-430.625) [-431.773] (-430.535) (-429.345) * (-435.823) (-434.515) [-428.918] (-432.481) -- 0:00:04
920000 -- [-429.949] (-432.030) (-434.261) (-429.001) * (-434.326) (-429.211) [-429.023] (-434.890) -- 0:00:04
Average standard deviation of split frequencies: 0.010070
920500 -- (-430.495) (-432.612) (-433.505) [-429.687] * (-434.319) [-430.227] (-431.745) (-433.188) -- 0:00:04
921000 -- (-431.176) (-430.408) (-431.185) [-434.418] * (-431.355) [-434.004] (-429.853) (-434.887) -- 0:00:04
921500 -- (-430.489) [-429.956] (-431.420) (-436.722) * (-431.640) [-429.427] (-430.463) (-434.343) -- 0:00:04
922000 -- (-433.367) [-432.697] (-428.974) (-436.541) * (-430.434) (-429.960) (-431.813) [-432.509] -- 0:00:04
922500 -- [-432.539] (-431.164) (-432.290) (-430.370) * (-434.043) [-429.901] (-432.628) (-432.864) -- 0:00:04
923000 -- (-431.324) (-430.252) [-430.417] (-431.322) * (-429.426) (-429.468) (-431.121) [-431.441] -- 0:00:04
923500 -- [-429.701] (-430.089) (-431.085) (-428.795) * (-429.820) (-429.928) [-429.174] (-435.909) -- 0:00:04
924000 -- (-431.891) [-432.209] (-433.772) (-429.190) * (-429.655) [-429.286] (-428.758) (-433.439) -- 0:00:04
924500 -- [-432.860] (-431.821) (-432.923) (-429.720) * (-430.373) (-429.318) [-429.327] (-430.589) -- 0:00:04
925000 -- (-430.051) (-432.414) (-429.987) [-429.703] * (-429.040) [-431.760] (-430.908) (-430.782) -- 0:00:04
Average standard deviation of split frequencies: 0.010657
925500 -- (-432.187) (-433.067) [-431.993] (-430.183) * [-429.832] (-434.225) (-431.317) (-431.567) -- 0:00:04
926000 -- [-431.260] (-430.073) (-429.797) (-431.779) * [-429.615] (-431.624) (-432.090) (-431.024) -- 0:00:04
926500 -- (-431.161) (-430.877) [-429.316] (-428.891) * (-429.721) (-432.548) (-431.685) [-429.887] -- 0:00:04
927000 -- (-430.189) (-430.784) (-432.687) [-430.051] * (-434.100) (-433.861) (-435.890) [-431.259] -- 0:00:04
927500 -- [-430.592] (-429.355) (-434.194) (-429.178) * (-433.920) (-431.407) (-436.762) [-430.722] -- 0:00:04
928000 -- [-429.358] (-433.422) (-431.655) (-434.407) * [-435.349] (-430.869) (-431.511) (-434.917) -- 0:00:04
928500 -- (-431.146) [-430.500] (-431.985) (-433.770) * (-437.689) (-430.437) [-433.888] (-433.325) -- 0:00:04
929000 -- (-434.768) (-430.508) [-431.607] (-431.306) * [-432.829] (-429.904) (-430.332) (-432.371) -- 0:00:04
929500 -- (-432.529) (-430.588) [-429.688] (-429.871) * [-431.840] (-431.460) (-429.481) (-432.664) -- 0:00:04
930000 -- (-433.236) (-430.171) (-431.019) [-431.371] * [-431.410] (-432.021) (-431.492) (-429.960) -- 0:00:04
Average standard deviation of split frequencies: 0.010671
930500 -- [-432.839] (-431.849) (-428.848) (-430.403) * (-431.076) (-429.178) (-430.833) [-430.036] -- 0:00:04
931000 -- [-430.231] (-432.312) (-434.086) (-431.556) * (-430.465) [-429.395] (-430.643) (-431.259) -- 0:00:04
931500 -- (-432.001) (-430.394) [-433.426] (-430.460) * (-432.919) [-432.600] (-433.443) (-430.204) -- 0:00:03
932000 -- (-430.963) [-429.869] (-431.272) (-429.683) * [-432.329] (-429.770) (-434.196) (-430.434) -- 0:00:03
932500 -- (-432.036) [-429.595] (-433.393) (-433.623) * (-432.865) (-430.456) [-430.834] (-434.102) -- 0:00:03
933000 -- (-435.007) (-429.756) [-434.268] (-431.279) * (-429.869) (-431.605) (-433.036) [-432.275] -- 0:00:03
933500 -- (-434.633) [-429.882] (-431.655) (-431.894) * (-432.072) (-430.105) (-431.720) [-430.764] -- 0:00:03
934000 -- (-429.626) (-432.788) (-432.590) [-429.925] * (-434.870) (-429.981) [-432.554] (-430.455) -- 0:00:03
934500 -- (-434.445) (-432.379) (-429.843) [-430.799] * (-437.134) (-434.006) (-430.209) [-436.441] -- 0:00:03
935000 -- (-430.085) (-430.960) (-433.461) [-431.045] * (-430.480) [-430.726] (-428.989) (-430.277) -- 0:00:03
Average standard deviation of split frequencies: 0.010744
935500 -- (-431.009) (-432.400) [-435.842] (-432.439) * [-430.551] (-429.687) (-429.044) (-431.486) -- 0:00:03
936000 -- (-435.205) (-429.664) (-435.675) [-431.200] * (-431.416) [-429.370] (-429.716) (-431.164) -- 0:00:03
936500 -- (-435.024) (-429.111) (-431.086) [-430.356] * [-431.565] (-431.921) (-431.702) (-431.107) -- 0:00:03
937000 -- (-433.485) [-429.943] (-431.495) (-433.717) * (-434.691) (-430.790) [-431.593] (-431.559) -- 0:00:03
937500 -- [-429.518] (-430.081) (-431.215) (-432.532) * (-431.189) (-429.243) (-432.233) [-430.612] -- 0:00:03
938000 -- (-428.782) [-432.876] (-429.484) (-432.750) * (-430.736) [-431.011] (-433.274) (-429.974) -- 0:00:03
938500 -- (-429.690) (-431.368) [-431.014] (-429.028) * (-430.081) [-431.593] (-432.012) (-430.731) -- 0:00:03
939000 -- (-433.199) (-432.100) [-430.915] (-431.644) * [-430.548] (-432.256) (-433.081) (-430.461) -- 0:00:03
939500 -- (-431.471) (-435.728) (-432.507) [-429.245] * (-430.416) (-431.771) (-432.824) [-429.309] -- 0:00:03
940000 -- (-430.640) (-432.168) (-431.960) [-430.604] * (-429.780) [-428.966] (-430.143) (-430.965) -- 0:00:03
Average standard deviation of split frequencies: 0.010624
940500 -- [-432.274] (-430.522) (-438.986) (-431.014) * (-430.624) (-431.250) [-431.377] (-434.462) -- 0:00:03
941000 -- [-433.477] (-432.080) (-430.949) (-434.225) * (-429.331) (-430.505) (-429.897) [-430.362] -- 0:00:03
941500 -- (-433.066) (-431.766) (-432.165) [-430.630] * (-428.871) (-434.564) [-430.790] (-430.273) -- 0:00:03
942000 -- (-430.270) (-434.786) (-429.737) [-431.341] * (-430.022) (-432.310) [-431.108] (-430.594) -- 0:00:03
942500 -- [-430.884] (-433.143) (-432.432) (-432.523) * (-430.441) [-431.454] (-429.671) (-429.258) -- 0:00:03
943000 -- (-437.985) [-431.479] (-429.214) (-434.080) * (-430.482) (-430.367) (-431.079) [-429.338] -- 0:00:03
943500 -- (-431.353) (-430.512) (-430.568) [-430.614] * [-430.421] (-434.643) (-432.771) (-430.539) -- 0:00:03
944000 -- [-432.513] (-432.363) (-433.408) (-431.203) * (-430.996) (-433.505) (-432.393) [-429.165] -- 0:00:03
944500 -- (-431.592) (-431.640) [-437.686] (-432.887) * [-431.992] (-432.839) (-430.449) (-432.187) -- 0:00:03
945000 -- [-438.002] (-429.556) (-434.678) (-429.939) * (-429.590) [-436.188] (-429.626) (-432.404) -- 0:00:03
Average standard deviation of split frequencies: 0.010531
945500 -- [-433.261] (-429.628) (-431.747) (-430.563) * (-429.789) [-433.244] (-429.602) (-433.180) -- 0:00:03
946000 -- (-431.053) [-431.816] (-433.104) (-433.724) * [-429.601] (-429.740) (-430.094) (-432.050) -- 0:00:03
946500 -- (-431.411) (-431.906) (-434.735) [-430.386] * [-429.977] (-434.062) (-431.435) (-429.909) -- 0:00:03
947000 -- (-430.392) [-429.706] (-431.085) (-432.752) * (-431.281) [-431.652] (-429.708) (-429.398) -- 0:00:03
947500 -- [-431.789] (-430.258) (-433.076) (-431.500) * (-431.348) [-430.635] (-431.525) (-430.359) -- 0:00:03
948000 -- (-431.105) [-431.706] (-431.532) (-429.690) * (-436.440) (-431.651) [-430.207] (-431.861) -- 0:00:03
948500 -- (-430.352) (-432.608) [-429.152] (-431.799) * (-430.155) (-431.041) [-429.466] (-431.947) -- 0:00:02
949000 -- [-434.986] (-431.357) (-430.322) (-432.414) * (-432.618) [-429.351] (-431.073) (-433.221) -- 0:00:02
949500 -- (-435.702) [-430.490] (-435.280) (-431.202) * (-432.849) (-432.864) (-432.739) [-431.479] -- 0:00:02
950000 -- (-432.441) (-434.770) [-432.392] (-433.551) * (-430.463) (-434.925) (-435.656) [-430.851] -- 0:00:02
Average standard deviation of split frequencies: 0.010314
950500 -- [-431.073] (-432.423) (-433.382) (-433.541) * (-431.266) (-431.311) (-433.641) [-432.131] -- 0:00:02
951000 -- (-431.081) (-430.511) [-429.865] (-430.509) * (-432.287) (-430.066) (-430.997) [-429.487] -- 0:00:02
951500 -- [-431.893] (-430.433) (-430.501) (-430.866) * (-430.449) (-429.869) (-429.671) [-430.203] -- 0:00:02
952000 -- [-429.382] (-430.481) (-431.952) (-429.964) * (-429.907) (-429.097) (-429.758) [-429.781] -- 0:00:02
952500 -- (-432.219) [-429.278] (-434.638) (-429.075) * [-431.572] (-429.313) (-430.871) (-432.726) -- 0:00:02
953000 -- (-430.696) [-429.424] (-431.640) (-431.654) * [-430.732] (-432.483) (-438.642) (-431.201) -- 0:00:02
953500 -- (-431.544) (-432.760) (-433.427) [-430.685] * [-429.240] (-433.515) (-433.194) (-430.052) -- 0:00:02
954000 -- [-430.975] (-434.336) (-433.574) (-432.893) * (-432.547) (-429.151) (-436.177) [-431.918] -- 0:00:02
954500 -- (-432.339) (-432.778) [-431.302] (-430.216) * (-434.443) (-434.090) [-434.462] (-433.465) -- 0:00:02
955000 -- (-429.929) (-435.437) [-429.333] (-432.955) * (-430.043) [-432.552] (-430.032) (-431.818) -- 0:00:02
Average standard deviation of split frequencies: 0.010191
955500 -- (-429.911) (-433.695) [-429.807] (-430.009) * (-437.920) [-430.770] (-433.511) (-432.940) -- 0:00:02
956000 -- (-429.313) (-431.613) [-431.869] (-430.329) * (-430.116) [-430.585] (-429.659) (-432.926) -- 0:00:02
956500 -- (-430.042) (-433.600) [-429.883] (-429.483) * (-432.093) (-429.936) [-429.651] (-435.276) -- 0:00:02
957000 -- (-428.915) [-432.115] (-429.463) (-429.908) * (-437.510) (-431.613) (-430.847) [-433.621] -- 0:00:02
957500 -- (-430.328) (-433.927) (-429.092) [-430.358] * (-432.561) (-429.608) [-431.779] (-432.439) -- 0:00:02
958000 -- (-430.311) (-437.987) [-431.371] (-431.742) * (-432.118) (-430.347) [-429.493] (-434.804) -- 0:00:02
958500 -- [-430.041] (-430.147) (-430.622) (-429.350) * [-431.756] (-433.670) (-433.865) (-431.132) -- 0:00:02
959000 -- (-429.989) [-429.652] (-431.662) (-431.356) * [-430.950] (-431.069) (-430.903) (-429.717) -- 0:00:02
959500 -- (-429.601) [-428.855] (-433.468) (-429.398) * (-429.116) (-431.206) [-429.892] (-431.292) -- 0:00:02
960000 -- (-428.971) (-429.765) [-431.148] (-433.796) * (-432.486) (-430.769) (-430.955) [-432.243] -- 0:00:02
Average standard deviation of split frequencies: 0.010076
960500 -- (-429.603) (-429.902) [-430.184] (-431.382) * [-437.777] (-432.430) (-432.020) (-433.453) -- 0:00:02
961000 -- [-431.192] (-429.787) (-432.369) (-431.381) * (-430.984) (-432.727) [-429.327] (-430.545) -- 0:00:02
961500 -- (-432.435) (-432.111) (-429.700) [-433.043] * (-429.786) [-429.664] (-430.714) (-431.911) -- 0:00:02
962000 -- (-431.524) (-429.878) [-430.192] (-433.492) * [-430.720] (-430.243) (-429.768) (-431.660) -- 0:00:02
962500 -- (-429.560) (-430.073) (-430.980) [-431.630] * (-432.324) (-429.598) [-431.015] (-433.368) -- 0:00:02
963000 -- (-432.737) (-430.328) [-434.694] (-430.212) * (-431.019) (-430.601) [-431.282] (-431.941) -- 0:00:02
963500 -- [-430.561] (-433.736) (-435.912) (-430.333) * [-429.370] (-430.164) (-434.311) (-433.835) -- 0:00:02
964000 -- (-430.667) (-432.579) (-430.972) [-431.425] * (-431.122) (-430.730) (-431.672) [-430.073] -- 0:00:02
964500 -- (-432.046) (-433.199) [-433.246] (-431.939) * [-429.384] (-431.319) (-432.430) (-431.318) -- 0:00:02
965000 -- (-429.999) [-432.815] (-433.857) (-431.898) * [-429.162] (-432.099) (-430.818) (-432.504) -- 0:00:02
Average standard deviation of split frequencies: 0.009988
965500 -- [-430.627] (-430.868) (-435.843) (-431.169) * [-430.405] (-431.240) (-430.109) (-431.393) -- 0:00:02
966000 -- (-430.872) (-430.708) [-430.840] (-429.161) * (-430.158) (-435.245) [-431.302] (-433.498) -- 0:00:01
966500 -- [-430.425] (-430.978) (-429.398) (-430.545) * (-432.097) (-434.543) [-429.629] (-431.370) -- 0:00:01
967000 -- [-430.685] (-431.550) (-432.122) (-432.882) * [-431.182] (-432.526) (-432.725) (-429.129) -- 0:00:01
967500 -- (-429.099) [-435.003] (-432.604) (-431.667) * (-432.041) (-431.096) (-429.573) [-429.378] -- 0:00:01
968000 -- [-429.127] (-430.561) (-431.910) (-429.191) * (-430.023) (-430.748) (-430.471) [-429.345] -- 0:00:01
968500 -- (-431.588) [-430.348] (-430.614) (-429.821) * [-429.104] (-430.155) (-430.398) (-431.001) -- 0:00:01
969000 -- [-431.101] (-431.074) (-429.403) (-429.602) * (-430.147) (-431.620) [-429.459] (-428.909) -- 0:00:01
969500 -- (-431.135) [-429.164] (-429.409) (-430.072) * (-429.555) (-437.643) (-429.391) [-429.342] -- 0:00:01
970000 -- (-432.977) [-429.684] (-430.921) (-430.111) * [-430.322] (-434.594) (-430.259) (-430.323) -- 0:00:01
Average standard deviation of split frequencies: 0.009616
970500 -- (-432.160) (-429.067) (-431.157) [-431.217] * (-429.861) (-430.053) (-432.579) [-429.494] -- 0:00:01
971000 -- (-437.290) (-432.278) [-430.705] (-432.697) * (-429.982) [-434.272] (-432.727) (-430.703) -- 0:00:01
971500 -- (-431.985) (-429.555) (-430.576) [-433.669] * [-430.224] (-433.837) (-431.219) (-430.274) -- 0:00:01
972000 -- (-432.229) (-429.958) (-433.579) [-432.947] * (-429.828) [-429.439] (-430.476) (-432.277) -- 0:00:01
972500 -- (-431.706) (-430.093) [-431.032] (-432.320) * [-429.612] (-429.449) (-431.503) (-430.391) -- 0:00:01
973000 -- (-431.209) [-429.317] (-430.769) (-434.710) * (-430.779) (-441.645) (-432.538) [-435.659] -- 0:00:01
973500 -- (-430.558) (-431.975) (-431.060) [-434.538] * [-433.161] (-432.074) (-434.116) (-430.257) -- 0:00:01
974000 -- (-430.772) (-431.181) [-430.009] (-431.994) * (-433.522) [-432.448] (-429.190) (-432.249) -- 0:00:01
974500 -- (-430.616) [-429.793] (-432.814) (-434.832) * [-430.862] (-431.602) (-432.302) (-431.540) -- 0:00:01
975000 -- (-435.417) (-433.621) [-431.527] (-434.623) * [-433.063] (-431.465) (-433.179) (-430.878) -- 0:00:01
Average standard deviation of split frequencies: 0.009563
975500 -- (-434.534) [-432.281] (-429.566) (-430.618) * (-434.499) [-431.073] (-429.453) (-430.003) -- 0:00:01
976000 -- (-431.915) (-430.856) [-431.537] (-431.305) * (-432.362) [-429.763] (-432.648) (-429.775) -- 0:00:01
976500 -- [-430.706] (-432.486) (-432.174) (-428.947) * [-428.864] (-430.886) (-432.267) (-431.363) -- 0:00:01
977000 -- [-430.315] (-432.376) (-434.037) (-432.452) * [-430.644] (-429.734) (-432.512) (-430.585) -- 0:00:01
977500 -- (-433.515) [-431.384] (-430.157) (-431.476) * [-431.536] (-430.184) (-430.448) (-429.849) -- 0:00:01
978000 -- (-430.375) [-432.474] (-434.922) (-432.959) * [-430.608] (-431.215) (-430.338) (-432.914) -- 0:00:01
978500 -- (-431.307) [-431.722] (-434.417) (-433.612) * [-430.475] (-429.456) (-432.891) (-429.421) -- 0:00:01
979000 -- (-430.603) [-431.570] (-432.869) (-430.674) * (-429.752) (-431.411) [-430.646] (-429.515) -- 0:00:01
979500 -- (-432.856) (-432.035) (-430.871) [-429.307] * (-429.848) [-429.707] (-433.634) (-433.949) -- 0:00:01
980000 -- (-430.699) (-431.966) (-429.427) [-431.319] * (-431.180) (-431.185) (-432.571) [-431.103] -- 0:00:01
Average standard deviation of split frequencies: 0.009518
980500 -- (-432.632) (-432.874) [-429.899] (-431.742) * [-433.189] (-430.608) (-431.248) (-430.540) -- 0:00:01
981000 -- [-431.242] (-431.437) (-433.659) (-431.283) * (-434.388) (-430.162) (-433.352) [-430.259] -- 0:00:01
981500 -- [-429.508] (-432.904) (-435.643) (-432.001) * [-437.679] (-430.526) (-430.270) (-430.431) -- 0:00:01
982000 -- (-432.734) (-431.181) [-430.821] (-431.870) * (-433.753) (-431.703) (-431.152) [-433.930] -- 0:00:01
982500 -- [-429.943] (-429.070) (-432.767) (-432.180) * (-431.365) [-432.602] (-431.666) (-430.844) -- 0:00:01
983000 -- (-430.699) (-430.484) [-433.692] (-433.789) * [-433.360] (-431.547) (-431.530) (-431.454) -- 0:00:00
983500 -- (-430.699) (-429.605) [-432.543] (-432.068) * (-431.721) [-431.757] (-428.984) (-430.700) -- 0:00:00
984000 -- [-434.244] (-431.450) (-429.835) (-430.265) * (-431.886) (-434.231) (-431.421) [-432.225] -- 0:00:00
984500 -- (-431.817) (-432.398) (-430.603) [-431.025] * [-431.478] (-433.495) (-430.221) (-434.078) -- 0:00:00
985000 -- (-433.727) (-429.445) (-429.030) [-430.148] * [-431.310] (-431.374) (-433.438) (-430.314) -- 0:00:00
Average standard deviation of split frequencies: 0.009658
985500 -- (-432.563) (-434.231) [-432.363] (-429.710) * (-433.328) (-432.428) (-433.780) [-431.473] -- 0:00:00
986000 -- (-432.641) [-433.545] (-430.983) (-432.597) * (-430.191) (-434.342) [-431.720] (-429.932) -- 0:00:00
986500 -- (-431.361) (-434.931) [-429.916] (-436.538) * (-432.540) [-434.312] (-431.032) (-431.856) -- 0:00:00
987000 -- (-433.050) (-432.724) (-431.281) [-430.107] * (-432.676) [-434.969] (-430.977) (-429.575) -- 0:00:00
987500 -- (-434.611) (-432.890) [-431.726] (-429.759) * [-429.772] (-434.275) (-430.644) (-430.004) -- 0:00:00
988000 -- (-436.918) (-430.795) [-431.578] (-430.040) * [-431.994] (-434.248) (-431.819) (-429.711) -- 0:00:00
988500 -- (-431.939) (-431.589) (-429.256) [-431.213] * (-429.326) [-433.784] (-429.620) (-429.839) -- 0:00:00
989000 -- (-431.285) (-433.481) (-433.677) [-432.305] * (-429.003) (-432.347) (-429.052) [-429.610] -- 0:00:00
989500 -- [-429.483] (-429.778) (-434.388) (-435.360) * [-431.193] (-433.126) (-432.037) (-430.163) -- 0:00:00
990000 -- [-430.227] (-430.236) (-432.414) (-432.731) * (-429.657) (-432.854) (-430.657) [-432.703] -- 0:00:00
Average standard deviation of split frequencies: 0.009105
990500 -- (-434.048) [-430.682] (-432.823) (-429.888) * [-431.500] (-430.569) (-431.865) (-430.751) -- 0:00:00
991000 -- [-431.997] (-432.930) (-437.728) (-432.983) * (-431.262) (-432.015) [-431.619] (-433.155) -- 0:00:00
991500 -- (-430.386) (-432.420) [-429.831] (-432.620) * (-430.937) (-433.542) [-430.187] (-433.474) -- 0:00:00
992000 -- (-429.431) [-435.370] (-429.954) (-433.301) * (-430.224) [-429.968] (-430.274) (-434.268) -- 0:00:00
992500 -- [-428.947] (-431.097) (-432.909) (-432.880) * (-430.742) (-429.908) [-430.663] (-433.824) -- 0:00:00
993000 -- (-433.255) [-430.257] (-433.786) (-429.932) * (-432.770) (-431.082) [-429.722] (-429.119) -- 0:00:00
993500 -- (-432.497) (-433.986) (-430.848) [-429.870] * (-433.140) (-432.501) (-429.853) [-430.021] -- 0:00:00
994000 -- [-429.279] (-432.059) (-430.014) (-435.927) * (-430.279) (-434.630) (-430.674) [-430.120] -- 0:00:00
994500 -- [-430.168] (-430.536) (-432.102) (-432.900) * (-432.273) (-435.408) [-433.712] (-429.913) -- 0:00:00
995000 -- [-431.782] (-431.607) (-428.805) (-429.207) * [-432.061] (-434.641) (-430.866) (-429.412) -- 0:00:00
Average standard deviation of split frequencies: 0.009245
995500 -- (-430.442) (-429.898) (-433.348) [-429.029] * (-431.234) [-436.171] (-431.715) (-433.356) -- 0:00:00
996000 -- (-430.820) [-431.237] (-432.582) (-431.188) * (-430.093) (-436.338) [-433.471] (-432.922) -- 0:00:00
996500 -- (-432.847) [-430.760] (-432.658) (-430.980) * (-429.794) (-431.231) (-432.455) [-434.154] -- 0:00:00
997000 -- (-431.116) [-432.054] (-431.096) (-431.026) * [-433.263] (-434.107) (-429.770) (-431.062) -- 0:00:00
997500 -- (-430.238) (-431.331) [-430.338] (-433.618) * [-433.696] (-431.566) (-433.613) (-433.463) -- 0:00:00
998000 -- (-433.172) (-432.574) [-430.339] (-433.778) * (-430.310) (-431.272) [-431.799] (-431.236) -- 0:00:00
998500 -- (-431.742) (-438.171) [-430.309] (-436.181) * (-434.486) (-429.469) (-429.370) [-429.500] -- 0:00:00
999000 -- [-429.914] (-431.866) (-432.206) (-432.029) * (-429.778) [-431.059] (-431.572) (-431.897) -- 0:00:00
999500 -- (-431.500) (-429.788) (-432.807) [-434.061] * (-431.051) (-431.660) (-430.951) [-431.636] -- 0:00:00
1000000 -- [-430.761] (-432.482) (-435.478) (-430.532) * (-430.040) (-429.808) [-431.183] (-431.844) -- 0:00:00
Average standard deviation of split frequencies: 0.009265
Analysis completed in 58 seconds
Analysis used 57.43 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -428.68
Likelihood of best state for "cold" chain of run 2 was -428.68
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
38.4 % ( 34 %) Dirichlet(Pi{all})
38.2 % ( 22 %) Slider(Pi{all})
78.3 % ( 57 %) Multiplier(Alpha{1,2})
77.9 % ( 57 %) Multiplier(Alpha{3})
26.7 % ( 30 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 19 %) Multiplier(V{all})
97.3 % ( 99 %) Nodeslider(V{all})
30.2 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
39.0 % ( 30 %) Dirichlet(Pi{all})
38.1 % ( 27 %) Slider(Pi{all})
79.3 % ( 58 %) Multiplier(Alpha{1,2})
78.1 % ( 56 %) Multiplier(Alpha{3})
26.3 % ( 35 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.7 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 166237 0.82 0.67
3 | 167221 166759 0.84
4 | 166552 166855 166376
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166829 0.82 0.67
3 | 166186 166866 0.84
4 | 166425 166567 167127
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -430.41
| 1 1 |
| 1 12 |
| 2 2 2 2 22 1 2 |
| 2 1 1 1 2 |
| 1 1 21 1 2 2 2 2 1 1|
| 1 2 21 1 1 21 1 1 1 |
| 1 11 1 2 1 *1 1 |
| 2 2 1 1 * 2 2 2 1 2 |
|2 2 1 2 2 1 2 2 1 1 1 2 1 |
|1 1 2 2 1 11 2 2 1 |
| 2 * 121 2 2 21 1 2 |
| 2 2 1 2 1 2 1 2 2 |
| 2 12 2|
| 2 1 1 1 |
| 1 1 2 2 22 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -431.96
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -430.40 -434.57
2 -430.43 -434.64
--------------------------------------
TOTAL -430.42 -434.61
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898057 0.085546 0.373533 1.494165 0.872634 1414.44 1417.90 1.000
r(A<->C){all} 0.164647 0.020483 0.000009 0.457360 0.124975 168.84 240.13 1.000
r(A<->G){all} 0.170645 0.020166 0.000029 0.454171 0.133734 146.71 298.25 1.000
r(A<->T){all} 0.167341 0.019660 0.000014 0.445043 0.133204 131.94 165.49 1.000
r(C<->G){all} 0.173780 0.022020 0.000057 0.482937 0.134858 182.50 284.53 1.000
r(C<->T){all} 0.161486 0.019081 0.000030 0.444810 0.124160 193.09 205.86 1.000
r(G<->T){all} 0.162101 0.019908 0.000010 0.448968 0.123590 124.61 140.49 1.001
pi(A){all} 0.211467 0.000544 0.170456 0.261589 0.210616 1337.33 1419.17 1.001
pi(C){all} 0.265974 0.000631 0.217383 0.315793 0.265158 1384.02 1442.51 1.003
pi(G){all} 0.307362 0.000670 0.254292 0.354757 0.306607 1395.90 1411.16 1.000
pi(T){all} 0.215197 0.000543 0.169675 0.258638 0.214946 1391.83 1446.41 1.000
alpha{1,2} 0.419209 0.228001 0.000136 1.357038 0.252272 1292.78 1365.22 1.002
alpha{3} 0.445222 0.228323 0.000347 1.407039 0.283034 1416.62 1438.15 1.000
pinvar{all} 0.994697 0.000042 0.982536 0.999995 0.996750 1361.37 1379.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*...*
8 -- ..*.*.
9 -- ....**
10 -- .****.
11 -- .**.**
12 -- .**...
13 -- ..****
14 -- .*.***
15 -- ...*.*
16 -- ..**..
17 -- .*.*..
18 -- .*..*.
19 -- ..*..*
20 -- .***.*
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 467 0.155563 0.018373 0.142572 0.168554 2
8 461 0.153564 0.006124 0.149234 0.157895 2
9 446 0.148568 0.009422 0.141905 0.155230 2
10 442 0.147235 0.010364 0.139907 0.154564 2
11 437 0.145570 0.000471 0.145237 0.145903 2
12 436 0.145237 0.009422 0.138574 0.151899 2
13 430 0.143238 0.032976 0.119920 0.166556 2
14 427 0.142239 0.004240 0.139241 0.145237 2
15 426 0.141905 0.003769 0.139241 0.144570 2
16 421 0.140240 0.000471 0.139907 0.140573 2
17 419 0.139574 0.008009 0.133911 0.145237 2
18 412 0.137242 0.007537 0.131912 0.142572 2
19 410 0.136576 0.013191 0.127249 0.145903 2
20 408 0.135909 0.005653 0.131912 0.139907 2
21 399 0.132911 0.008951 0.126582 0.139241 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100927 0.009890 0.000010 0.296290 0.071993 1.000 2
length{all}[2] 0.098619 0.009667 0.000001 0.308586 0.068280 1.000 2
length{all}[3] 0.098615 0.009899 0.000065 0.310164 0.067529 1.000 2
length{all}[4] 0.102588 0.010213 0.000184 0.307289 0.071939 1.000 2
length{all}[5] 0.101482 0.010631 0.000044 0.301326 0.069827 1.000 2
length{all}[6] 0.101543 0.009866 0.000097 0.300792 0.071161 1.000 2
length{all}[7] 0.098898 0.009644 0.000611 0.296425 0.068609 0.998 2
length{all}[8] 0.095837 0.008578 0.000036 0.294880 0.065489 1.000 2
length{all}[9] 0.097795 0.009920 0.000216 0.307583 0.068239 0.998 2
length{all}[10] 0.094553 0.007894 0.000079 0.264165 0.068613 0.999 2
length{all}[11] 0.097923 0.008766 0.000076 0.283643 0.070965 0.998 2
length{all}[12] 0.095406 0.008771 0.000164 0.296758 0.066137 0.998 2
length{all}[13] 0.102783 0.009053 0.000046 0.299096 0.078485 1.000 2
length{all}[14] 0.101340 0.009258 0.000790 0.293576 0.069248 1.010 2
length{all}[15] 0.092578 0.007553 0.000103 0.252619 0.069083 0.999 2
length{all}[16] 0.100469 0.009114 0.000110 0.284689 0.073179 0.999 2
length{all}[17] 0.100896 0.010179 0.000072 0.303972 0.072706 0.998 2
length{all}[18] 0.097049 0.009441 0.000274 0.290371 0.063645 0.999 2
length{all}[19] 0.092994 0.008954 0.000304 0.265245 0.064395 1.002 2
length{all}[20] 0.099696 0.008743 0.000451 0.287441 0.073343 0.999 2
length{all}[21] 0.096564 0.008982 0.000399 0.282454 0.072012 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009265
Maximum standard deviation of split frequencies = 0.032976
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 312
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 104 / 104 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 104 / 104 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.076133 0.045314 0.027172 0.031799 0.021871 0.036767 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -437.708215
Iterating by ming2
Initial: fx= 437.708215
x= 0.07613 0.04531 0.02717 0.03180 0.02187 0.03677 0.30000 1.30000
1 h-m-p 0.0000 0.0002 250.9716 +++ 424.281209 m 0.0002 14 | 1/8
2 h-m-p 0.0016 0.0121 29.5752 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 229.8022 ++ 421.553841 m 0.0001 45 | 2/8
4 h-m-p 0.0005 0.0169 22.7904 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 205.5831 ++ 419.646969 m 0.0000 76 | 3/8
6 h-m-p 0.0004 0.0215 18.4986 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 178.0216 ++ 418.110246 m 0.0000 107 | 4/8
8 h-m-p 0.0005 0.0284 14.3138 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 145.2801 ++ 416.346721 m 0.0001 138 | 5/8
10 h-m-p 0.0009 0.0418 9.8276 -----------.. | 5/8
11 h-m-p 0.0000 0.0003 102.6095 +++ 413.152107 m 0.0003 170 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 413.152107 m 8.0000 181 | 6/8
13 h-m-p 0.2150 8.0000 0.0001 +++ 413.152107 m 8.0000 195 | 6/8
14 h-m-p 0.0160 8.0000 0.3481 +++Y 413.152107 0 2.4536 211 | 6/8
15 h-m-p 1.6000 8.0000 0.0442 C 413.152107 0 2.0365 224 | 6/8
16 h-m-p 1.6000 8.0000 0.0102 C 413.152107 0 0.5513 237 | 6/8
17 h-m-p 1.6000 8.0000 0.0004 -----C 413.152107 0 0.0004 255 | 6/8
18 h-m-p 0.4975 8.0000 0.0000 ---------------C 413.152107 0 0.0000 283
Out..
lnL = -413.152107
284 lfun, 284 eigenQcodon, 1704 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.102924 0.078029 0.016488 0.047483 0.055907 0.058877 0.694161 0.566250 0.376688
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.951263
np = 9
lnL0 = -449.598412
Iterating by ming2
Initial: fx= 449.598412
x= 0.10292 0.07803 0.01649 0.04748 0.05591 0.05888 0.69416 0.56625 0.37669
1 h-m-p 0.0000 0.0002 243.2069 +++ 439.792477 m 0.0002 15 | 1/9
2 h-m-p 0.0003 0.0015 117.6882 ++ 424.052414 m 0.0015 27 | 2/9
3 h-m-p 0.0000 0.0000 6898.9028 ++ 420.672485 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0002 200.4959 ++ 419.572555 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0001 1725.5595 ++ 415.502904 m 0.0001 63 | 5/9
6 h-m-p 0.0000 0.0000 2792.1960 ++ 415.207010 m 0.0000 75 | 6/9
7 h-m-p 0.0013 0.3566 3.0692 -----------.. | 6/9
8 h-m-p 0.0000 0.0002 102.5566 +++ 413.152125 m 0.0002 109 | 7/9
9 h-m-p 0.1377 8.0000 0.0000 +++ 413.152125 m 8.0000 122 | 7/9
10 h-m-p 0.0064 3.1810 0.1986 --------C 413.152125 0 0.0000 144 | 7/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 413.152125 m 8.0000 161 | 7/9
12 h-m-p 0.0038 1.8836 0.5036 +++++ 413.152117 m 1.8836 178 | 8/9
13 h-m-p 0.6165 8.0000 1.1918 -----------Y 413.152117 0 0.0000 203 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 -C 413.152117 0 0.0008 216 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 -C 413.152117 0 0.0010 230
Out..
lnL = -413.152117
231 lfun, 693 eigenQcodon, 2772 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021795 0.066536 0.078231 0.076034 0.044011 0.047383 1.408117 0.839967 0.333286 0.383510 2.116635
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.489593
np = 11
lnL0 = -446.169062
Iterating by ming2
Initial: fx= 446.169062
x= 0.02179 0.06654 0.07823 0.07603 0.04401 0.04738 1.40812 0.83997 0.33329 0.38351 2.11663
1 h-m-p 0.0000 0.0002 231.7398 +++ 433.666805 m 0.0002 17 | 1/11
2 h-m-p 0.0008 0.0042 57.0250 ++ 422.050241 m 0.0042 31 | 2/11
3 h-m-p 0.0000 0.0000 25573.9266 ++ 420.719497 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0002 700.3670 ++ 417.884747 m 0.0002 59 | 4/11
5 h-m-p 0.0162 0.6043 3.8937 -------------.. | 4/11
6 h-m-p 0.0000 0.0001 174.0086 ++ 415.103382 m 0.0001 98 | 5/11
7 h-m-p 0.0079 3.9421 2.3898 -------------.. | 5/11
8 h-m-p 0.0000 0.0001 144.6382 ++ 413.355878 m 0.0001 137 | 6/11
9 h-m-p 0.0105 5.2623 1.0255 -------------.. | 6/11
10 h-m-p 0.0000 0.0000 103.5190 ++ 413.152120 m 0.0000 176 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 Y 413.152120 0 0.0160 190 | 6/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 413.152120 m 8.0000 211 | 6/11
13 h-m-p 0.0022 0.0108 0.1101 ------C 413.152120 0 0.0000 236 | 6/11
14 h-m-p 0.0160 8.0000 0.0007 +++++ 413.152120 m 8.0000 258 | 6/11
15 h-m-p 0.0077 2.7836 0.7660 ++++Y 413.152119 0 1.6625 281 | 6/11
16 h-m-p 1.6000 8.0000 0.0826 C 413.152119 0 1.6000 300 | 6/11
17 h-m-p 1.6000 8.0000 0.0085 Y 413.152119 0 0.8378 319 | 6/11
18 h-m-p 1.6000 8.0000 0.0008 +Y 413.152119 0 4.6869 339 | 6/11
19 h-m-p 1.6000 8.0000 0.0001 ++ 413.152119 m 8.0000 358 | 6/11
20 h-m-p 0.0160 8.0000 0.1424 +++Y 413.152119 0 1.9497 380 | 6/11
21 h-m-p 1.6000 8.0000 0.0331 ++ 413.152119 m 8.0000 399 | 6/11
22 h-m-p 0.1684 0.8418 1.0026 --------------Y 413.152119 0 0.0000 432 | 6/11
23 h-m-p 0.0039 1.9323 0.6188 ++++Y 413.152119 0 0.8166 450 | 6/11
24 h-m-p 1.6000 8.0000 0.0290 Y 413.152119 0 1.2309 469 | 6/11
25 h-m-p 1.6000 8.0000 0.0003 C 413.152119 0 0.4000 488 | 6/11
26 h-m-p 1.2954 8.0000 0.0001 ++ 413.152119 m 8.0000 507 | 6/11
27 h-m-p 0.1248 8.0000 0.0065 C 413.152119 0 0.0312 526 | 6/11
28 h-m-p 1.6000 8.0000 0.0001 ----------------.. | 6/11
29 h-m-p 0.0160 8.0000 0.0000 +++++ 413.152119 m 8.0000 581 | 6/11
30 h-m-p 0.0027 1.3642 0.3013 -------Y 413.152119 0 0.0000 607 | 6/11
31 h-m-p 0.0160 8.0000 0.0000 +++++ 413.152119 m 8.0000 629 | 6/11
32 h-m-p 0.0028 1.4053 1.0712 +++++ 413.152110 m 1.4053 651 | 7/11
33 h-m-p 0.0242 0.1210 17.8131 -----------C 413.152110 0 0.0000 676 | 7/11
34 h-m-p 0.0160 8.0000 0.0159 +++++ 413.152109 m 8.0000 693 | 7/11
35 h-m-p 0.0288 0.5143 4.4289 -------------C 413.152109 0 0.0000 724 | 7/11
36 h-m-p 0.0160 8.0000 0.0000 +++++ 413.152109 m 8.0000 741 | 7/11
37 h-m-p 0.0160 8.0000 0.0799 +++++ 413.152107 m 8.0000 762 | 7/11
38 h-m-p 0.0962 0.4811 5.5973 -----------Y 413.152107 0 0.0000 791 | 7/11
39 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
40 h-m-p 0.0160 8.0000 0.0000 +++++ 413.152107 m 8.0000 837 | 7/11
41 h-m-p 0.0016 0.8160 0.4102 +++++ 413.152103 m 0.8160 858 | 8/11
42 h-m-p 0.0186 8.0000 4.4739 +++++ 413.152092 m 8.0000 879 | 8/11
43 h-m-p 1.6000 8.0000 0.3349 ++ 413.152092 m 8.0000 893 | 8/11
44 h-m-p 0.3970 8.0000 6.7487 +++ 413.152092 m 8.0000 911 | 8/11
45 h-m-p 0.9548 4.7738 19.8160 -------------Y 413.152092 0 0.0000 938 | 8/11
46 h-m-p 0.2956 8.0000 0.0000 --Y 413.152092 0 0.0046 954 | 8/11
47 h-m-p 0.6314 8.0000 0.0000 --------N 413.152092 0 0.0000 979
Out..
lnL = -413.152092
980 lfun, 3920 eigenQcodon, 17640 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -413.149730 S = -413.149646 -0.000032
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:05
did 20 / 49 patterns 0:05
did 30 / 49 patterns 0:05
did 40 / 49 patterns 0:06
did 49 / 49 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.088886 0.012087 0.076332 0.099509 0.023157 0.077732 0.000100 1.089152 1.840434
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.201692
np = 9
lnL0 = -450.995362
Iterating by ming2
Initial: fx= 450.995362
x= 0.08889 0.01209 0.07633 0.09951 0.02316 0.07773 0.00011 1.08915 1.84043
1 h-m-p 0.0000 0.0000 238.4737 ++ 450.701866 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0653 16.7739 ----------.. | 1/9
3 h-m-p 0.0000 0.0001 238.5902 ++ 444.004879 m 0.0001 46 | 2/9
4 h-m-p 0.0017 0.0726 15.1092 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 219.5804 ++ 438.606660 m 0.0001 80 | 3/9
6 h-m-p 0.0018 0.0914 12.0426 ------------.. | 3/9
7 h-m-p 0.0000 0.0005 197.5251 +++ 417.072711 m 0.0005 115 | 4/9
8 h-m-p 0.0159 0.2036 5.8112 -------------.. | 4/9
9 h-m-p 0.0000 0.0000 178.0821 ++ 416.631939 m 0.0000 150 | 5/9
10 h-m-p 0.0042 2.1101 2.3134 ------------.. | 5/9
11 h-m-p 0.0000 0.0001 145.2898 ++ 414.281375 m 0.0001 184 | 6/9
12 h-m-p 0.0057 2.7217 1.9903 ------------.. | 6/9
13 h-m-p 0.0000 0.0001 103.1986 ++ 413.152120 m 0.0001 218 | 7/9
14 h-m-p 0.3426 8.0000 0.0000 +++ 413.152120 m 8.0000 231 | 7/9
15 h-m-p 0.1533 8.0000 0.0001 +++ 413.152120 m 8.0000 246 | 7/9
16 h-m-p 0.0160 8.0000 0.2223 +++++ 413.152119 m 8.0000 263 | 7/9
17 h-m-p 1.6000 8.0000 0.6926 ++ 413.152119 m 8.0000 277 | 7/9
18 h-m-p 1.6000 8.0000 1.1007 ++ 413.152118 m 8.0000 291 | 7/9
19 h-m-p 1.3348 6.6742 2.6912 ----------------.. | 7/9
20 h-m-p 0.0160 8.0000 0.0000 --Y 413.152118 0 0.0003 331 | 7/9
21 h-m-p 0.0160 8.0000 0.0000 ------------N 413.152118 0 0.0000 357
Out..
lnL = -413.152118
358 lfun, 3938 eigenQcodon, 21480 P(t)
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.103731 0.087000 0.028701 0.067835 0.101543 0.076958 0.000100 0.900000 0.568662 1.133090 1.948655
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.655359
np = 11
lnL0 = -456.516282
Iterating by ming2
Initial: fx= 456.516282
x= 0.10373 0.08700 0.02870 0.06783 0.10154 0.07696 0.00011 0.90000 0.56866 1.13309 1.94865
1 h-m-p 0.0000 0.0000 208.3422 ++ 456.393617 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 270.8390 +++ 441.121588 m 0.0004 31 | 2/11
3 h-m-p 0.0001 0.0007 163.8967 ++ 422.958551 m 0.0007 45 | 3/11
4 h-m-p 0.0021 0.0105 25.7390 ++ 418.135484 m 0.0105 59 | 4/11
5 h-m-p 0.0000 0.0000 6330.7232 ++ 415.129287 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 2621.3099 ++ 414.652721 m 0.0000 87 | 6/11
7 h-m-p 0.0031 0.0778 19.8879 ------------.. | 6/11
8 h-m-p 0.0000 0.0001 142.9831 ++ 413.278188 m 0.0001 125 | 7/11
9 h-m-p 0.0123 1.4611 0.5478 -------------.. | 7/11
10 h-m-p 0.0000 0.0000 103.2061 ++ 413.152114 m 0.0000 168 | 8/11
11 h-m-p 0.0205 8.0000 0.0000 +++++ 413.152114 m 8.0000 185 | 8/11
12 h-m-p 0.0391 8.0000 0.0003 ++++ 413.152114 m 8.0000 204 | 8/11
13 h-m-p 0.0111 5.5376 0.2383 +++C 413.152114 0 0.9940 224 | 8/11
14 h-m-p 1.6000 8.0000 0.0016 Y 413.152114 0 0.9893 241 | 8/11
15 h-m-p 1.6000 8.0000 0.0001 Y 413.152114 0 1.6000 258 | 8/11
16 h-m-p 0.6471 8.0000 0.0002 Y 413.152114 0 0.1618 275 | 8/11
17 h-m-p 1.6000 8.0000 0.0000 ++ 413.152114 m 8.0000 292 | 8/11
18 h-m-p 0.1176 8.0000 0.0010 +Y 413.152114 0 1.1278 310 | 8/11
19 h-m-p 1.6000 8.0000 0.0001 ++ 413.152114 m 8.0000 327 | 8/11
20 h-m-p 0.1340 8.0000 0.0030 ++C 413.152114 0 2.0307 346 | 8/11
21 h-m-p 1.6000 8.0000 0.0000 ++ 413.152114 m 8.0000 363 | 8/11
22 h-m-p 0.0083 4.1431 1.0194 +++
QuantileBeta(0.15, 0.00500, 3.49414) = 6.846011e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
+ 413.152100 m 4.1431 383
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.236775e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093857e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
| 9/11
23 h-m-p 0.9295 8.0000 4.4747
QuantileBeta(0.15, 0.00500, 9.68144) = 2.242887e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.56284) = 3.393952e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.78319) = 3.893184e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.58828) = 4.041779e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.53955) = 4.080714e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52737) = 4.090565e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52432) = 4.093036e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52356) = 4.093654e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52337) = 4.093808e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52333) = 4.093847e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093856e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093859e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
N 413.152100 0 0.0000 408
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.236775e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093857e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
| 9/11
24 h-m-p 0.0460 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
C 413.152100 0 0.0115 422
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.236775e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52351) = 4.093700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52311) = 4.094019e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
| 9/11
25 h-m-p 0.0266 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
C 413.152100 0 0.0000 449
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
Out..
lnL = -413.152100
450 lfun, 5400 eigenQcodon, 29700 P(t)
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -413.153439 S = -413.150058 -0.001481
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:18
did 20 / 49 patterns 0:19
did 30 / 49 patterns 0:19
did 40 / 49 patterns 0:19
did 49 / 49 patterns 0:19
QuantileBeta(0.15, 0.00500, 5.52331) = 4.093860e-161 2000 rounds
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=104
NC_011896_1_WP_010907975_1_902_MLBR_RS04245 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
NC_002677_1_NP_301651_1_523_ML0863 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN
**************************************************
NC_011896_1_WP_010907975_1_902_MLBR_RS04245 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
NC_002677_1_NP_301651_1_523_ML0863 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760 RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA
**************************************************
NC_011896_1_WP_010907975_1_902_MLBR_RS04245 RRSG
NC_002677_1_NP_301651_1_523_ML0863 RRSG
NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225 RRSG
NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855 RRSG
NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675 RRSG
NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760 RRSG
****
>NC_011896_1_WP_010907975_1_902_MLBR_RS04245 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG AGACGATCCGGC >NC_002677_1_NP_301651_1_523_ML0863 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG AGACGATCCGGC >NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG AGACGATCCGGC >NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG AGACGATCCGGC >NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG AGACGATCCGGC >NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760 GTGCCGGGTCAACACGGATGGCTCGCATTGGACCACATAGTTGGCATGCG GGATCGGCTGGTCGATAATCGGCATGCAGCTAGGATTACTGTTGTCAGTG CTCCAGGCCGTAGTGAGATCGATGTTGAGGGCATTTCTGCAGGCAACAAC CGGCTGGTGCTGGCCGGCACCGATACCGGACACCAAGCCCCGATCACACT GGTTATCAGCACCACGGTGCTTAGTGGTGTAAAGATCAGCCGCTGTACAG TCACAGTCGGCCTTCCACAGGATTTTGATCGCTATCAGGTTGGAGCCGCG AGACGATCCGGC
>NC_011896_1_WP_010907975_1_902_MLBR_RS04245 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA RRSG >NC_002677_1_NP_301651_1_523_ML0863 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA RRSG >NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA RRSG >NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA RRSG >NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA RRSG >NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760 VPGQHGWLALDHIVGMRDRLVDNRHAARITVVSAPGRSEIDVEGISAGNN RLVLAGTDTGHQAPITLVISTTVLSGVKISRCTVTVGLPQDFDRYQVGAA RRSG
#NEXUS
[ID: 0195931620]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907975_1_902_MLBR_RS04245
NC_002677_1_NP_301651_1_523_ML0863
NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225
NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855
NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675
NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907975_1_902_MLBR_RS04245,
2 NC_002677_1_NP_301651_1_523_ML0863,
3 NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225,
4 NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855,
5 NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675,
6 NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07199326,2:0.06827977,3:0.06752912,4:0.07193857,5:0.06982707,6:0.07116127);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07199326,2:0.06827977,3:0.06752912,4:0.07193857,5:0.06982707,6:0.07116127);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -430.40 -434.57
2 -430.43 -434.64
--------------------------------------
TOTAL -430.42 -434.61
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0863/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898057 0.085546 0.373533 1.494165 0.872634 1414.44 1417.90 1.000
r(A<->C){all} 0.164647 0.020483 0.000009 0.457360 0.124975 168.84 240.13 1.000
r(A<->G){all} 0.170645 0.020166 0.000029 0.454171 0.133734 146.71 298.25 1.000
r(A<->T){all} 0.167341 0.019660 0.000014 0.445043 0.133204 131.94 165.49 1.000
r(C<->G){all} 0.173780 0.022020 0.000057 0.482937 0.134858 182.50 284.53 1.000
r(C<->T){all} 0.161486 0.019081 0.000030 0.444810 0.124160 193.09 205.86 1.000
r(G<->T){all} 0.162101 0.019908 0.000010 0.448968 0.123590 124.61 140.49 1.001
pi(A){all} 0.211467 0.000544 0.170456 0.261589 0.210616 1337.33 1419.17 1.001
pi(C){all} 0.265974 0.000631 0.217383 0.315793 0.265158 1384.02 1442.51 1.003
pi(G){all} 0.307362 0.000670 0.254292 0.354757 0.306607 1395.90 1411.16 1.000
pi(T){all} 0.215197 0.000543 0.169675 0.258638 0.214946 1391.83 1446.41 1.000
alpha{1,2} 0.419209 0.228001 0.000136 1.357038 0.252272 1292.78 1365.22 1.002
alpha{3} 0.445222 0.228323 0.000347 1.407039 0.283034 1416.62 1438.15 1.000
pinvar{all} 0.994697 0.000042 0.982536 0.999995 0.996750 1361.37 1379.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0863/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 104
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 0 0 0 0 0 0 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 3 3 3 3 3 3 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 2 2 2 2 2 2 | CAG 2 2 2 2 2 2 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 3 3 3 3 3 3
ATC 4 4 4 4 4 4 | ACC 3 3 3 3 3 3 | AAC 2 2 2 2 2 2 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 2 2 2 2 2 2 | Asp GAT 6 6 6 6 6 6 | Gly GGT 2 2 2 2 2 2
GTC 4 4 4 4 4 4 | GCC 3 3 3 3 3 3 | GAC 1 1 1 1 1 1 | GGC 7 7 7 7 7 7
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 0 0 0 0 0 0 | GGA 3 3 3 3 3 3
GTG 3 3 3 3 3 3 | GCG 1 1 1 1 1 1 | GAG 2 2 2 2 2 2 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907975_1_902_MLBR_RS04245
position 1: T:0.06731 C:0.25962 A:0.25962 G:0.41346
position 2: T:0.28846 C:0.22115 A:0.21154 G:0.27885
position 3: T:0.28846 C:0.31731 A:0.16346 G:0.23077
Average T:0.21474 C:0.26603 A:0.21154 G:0.30769
#2: NC_002677_1_NP_301651_1_523_ML0863
position 1: T:0.06731 C:0.25962 A:0.25962 G:0.41346
position 2: T:0.28846 C:0.22115 A:0.21154 G:0.27885
position 3: T:0.28846 C:0.31731 A:0.16346 G:0.23077
Average T:0.21474 C:0.26603 A:0.21154 G:0.30769
#3: NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225
position 1: T:0.06731 C:0.25962 A:0.25962 G:0.41346
position 2: T:0.28846 C:0.22115 A:0.21154 G:0.27885
position 3: T:0.28846 C:0.31731 A:0.16346 G:0.23077
Average T:0.21474 C:0.26603 A:0.21154 G:0.30769
#4: NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855
position 1: T:0.06731 C:0.25962 A:0.25962 G:0.41346
position 2: T:0.28846 C:0.22115 A:0.21154 G:0.27885
position 3: T:0.28846 C:0.31731 A:0.16346 G:0.23077
Average T:0.21474 C:0.26603 A:0.21154 G:0.30769
#5: NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675
position 1: T:0.06731 C:0.25962 A:0.25962 G:0.41346
position 2: T:0.28846 C:0.22115 A:0.21154 G:0.27885
position 3: T:0.28846 C:0.31731 A:0.16346 G:0.23077
Average T:0.21474 C:0.26603 A:0.21154 G:0.30769
#6: NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760
position 1: T:0.06731 C:0.25962 A:0.25962 G:0.41346
position 2: T:0.28846 C:0.22115 A:0.21154 G:0.27885
position 3: T:0.28846 C:0.31731 A:0.16346 G:0.23077
Average T:0.21474 C:0.26603 A:0.21154 G:0.30769
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 6
TTC 0 | TCC 6 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 0 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 6
CTC 6 | CCC 0 | CAC 18 | CGC 12
CTA 0 | CCA 12 | Gln Q CAA 12 | CGA 6
CTG 24 | CCG 12 | CAG 12 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 18
ATC 24 | ACC 18 | AAC 12 | AGC 12
ATA 6 | ACA 18 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 6 | ACG 6 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 12 | Asp D GAT 36 | Gly G GGT 12
GTC 24 | GCC 18 | GAC 6 | GGC 42
GTA 6 | GCA 18 | Glu E GAA 0 | GGA 18
GTG 18 | GCG 6 | GAG 12 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.06731 C:0.25962 A:0.25962 G:0.41346
position 2: T:0.28846 C:0.22115 A:0.21154 G:0.27885
position 3: T:0.28846 C:0.31731 A:0.16346 G:0.23077
Average T:0.21474 C:0.26603 A:0.21154 G:0.30769
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -413.152107 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.694161 1.948655
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907975_1_902_MLBR_RS04245: 0.000004, NC_002677_1_NP_301651_1_523_ML0863: 0.000004, NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225: 0.000004, NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855: 0.000004, NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675: 0.000004, NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.69416
omega (dN/dS) = 1.94865
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 223.8 88.2 1.9487 0.0000 0.0000 0.0 0.0
7..2 0.000 223.8 88.2 1.9487 0.0000 0.0000 0.0 0.0
7..3 0.000 223.8 88.2 1.9487 0.0000 0.0000 0.0 0.0
7..4 0.000 223.8 88.2 1.9487 0.0000 0.0000 0.0 0.0
7..5 0.000 223.8 88.2 1.9487 0.0000 0.0000 0.0 0.0
7..6 0.000 223.8 88.2 1.9487 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -413.152117 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.408117 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907975_1_902_MLBR_RS04245: 0.000004, NC_002677_1_NP_301651_1_523_ML0863: 0.000004, NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225: 0.000004, NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855: 0.000004, NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675: 0.000004, NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.40812
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 219.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 219.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 219.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 219.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 219.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 219.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -413.152092 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 1.000000 71.193540
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907975_1_902_MLBR_RS04245: 0.000004, NC_002677_1_NP_301651_1_523_ML0863: 0.000004, NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225: 0.000004, NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855: 0.000004, NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675: 0.000004, NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 71.19354
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 232.1 79.9 71.1935 0.0000 0.0000 0.0 0.0
7..2 0.000 232.1 79.9 71.1935 0.0000 0.0000 0.0 0.0
7..3 0.000 232.1 79.9 71.1935 0.0000 0.0000 0.0 0.0
7..4 0.000 232.1 79.9 71.1935 0.0000 0.0000 0.0 0.0
7..5 0.000 232.1 79.9 71.1935 0.0000 0.0000 0.0 0.0
7..6 0.000 232.1 79.9 71.1935 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907975_1_902_MLBR_RS04245)
Pr(w>1) post mean +- SE for w
1 V 1.000** 71.194
2 P 1.000** 71.194
3 G 1.000** 71.194
4 Q 1.000** 71.194
5 H 1.000** 71.194
6 G 1.000** 71.194
7 W 1.000** 71.194
8 L 1.000** 71.194
9 A 1.000** 71.194
10 L 1.000** 71.194
11 D 1.000** 71.194
12 H 1.000** 71.194
13 I 1.000** 71.194
14 V 1.000** 71.194
15 G 1.000** 71.194
16 M 1.000** 71.194
17 R 1.000** 71.194
18 D 1.000** 71.194
19 R 1.000** 71.194
20 L 1.000** 71.194
21 V 1.000** 71.194
22 D 1.000** 71.194
23 N 1.000** 71.194
24 R 1.000** 71.194
25 H 1.000** 71.194
26 A 1.000** 71.194
27 A 1.000** 71.194
28 R 1.000** 71.194
29 I 1.000** 71.194
30 T 1.000** 71.194
31 V 1.000** 71.194
32 V 1.000** 71.194
33 S 1.000** 71.194
34 A 1.000** 71.194
35 P 1.000** 71.194
36 G 1.000** 71.194
37 R 1.000** 71.194
38 S 1.000** 71.194
39 E 1.000** 71.194
40 I 1.000** 71.194
41 D 1.000** 71.194
42 V 1.000** 71.194
43 E 1.000** 71.194
44 G 1.000** 71.194
45 I 1.000** 71.194
46 S 1.000** 71.194
47 A 1.000** 71.194
48 G 1.000** 71.194
49 N 1.000** 71.194
50 N 1.000** 71.194
51 R 1.000** 71.194
52 L 1.000** 71.194
53 V 1.000** 71.194
54 L 1.000** 71.194
55 A 1.000** 71.194
56 G 1.000** 71.194
57 T 1.000** 71.194
58 D 1.000** 71.194
59 T 1.000** 71.194
60 G 1.000** 71.194
61 H 1.000** 71.194
62 Q 1.000** 71.194
63 A 1.000** 71.194
64 P 1.000** 71.194
65 I 1.000** 71.194
66 T 1.000** 71.194
67 L 1.000** 71.194
68 V 1.000** 71.194
69 I 1.000** 71.194
70 S 1.000** 71.194
71 T 1.000** 71.194
72 T 1.000** 71.194
73 V 1.000** 71.194
74 L 1.000** 71.194
75 S 1.000** 71.194
76 G 1.000** 71.194
77 V 1.000** 71.194
78 K 1.000** 71.194
79 I 1.000** 71.194
80 S 1.000** 71.194
81 R 1.000** 71.194
82 C 1.000** 71.194
83 T 1.000** 71.194
84 V 1.000** 71.194
85 T 1.000** 71.194
86 V 1.000** 71.194
87 G 1.000** 71.194
88 L 1.000** 71.194
89 P 1.000** 71.194
90 Q 1.000** 71.194
91 D 1.000** 71.194
92 F 1.000** 71.194
93 D 1.000** 71.194
94 R 1.000** 71.194
95 Y 1.000** 71.194
96 Q 1.000** 71.194
97 V 1.000** 71.194
98 G 1.000** 71.194
99 A 1.000** 71.194
100 A 1.000** 71.194
101 R 1.000** 71.194
102 R 1.000** 71.194
103 S 1.000** 71.194
104 G 1.000** 71.194
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907975_1_902_MLBR_RS04245)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -413.152118 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 10.606464 14.857238
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907975_1_902_MLBR_RS04245: 0.000004, NC_002677_1_NP_301651_1_523_ML0863: 0.000004, NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225: 0.000004, NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855: 0.000004, NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675: 0.000004, NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 10.60646 q = 14.85724
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.26245 0.31567 0.34917 0.37673 0.40197 0.42673 0.45258 0.48154 0.51784 0.57822
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 232.1 79.9 0.4163 0.0000 0.0000 0.0 0.0
7..2 0.000 232.1 79.9 0.4163 0.0000 0.0000 0.0 0.0
7..3 0.000 232.1 79.9 0.4163 0.0000 0.0000 0.0 0.0
7..4 0.000 232.1 79.9 0.4163 0.0000 0.0000 0.0 0.0
7..5 0.000 232.1 79.9 0.4163 0.0000 0.0000 0.0 0.0
7..6 0.000 232.1 79.9 0.4163 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -413.152100 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 5.523310 1.981030
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907975_1_902_MLBR_RS04245: 0.000004, NC_002677_1_NP_301651_1_523_ML0863: 0.000004, NZ_LVXE01000007_1_WP_010907975_1_2566_A3216_RS04225: 0.000004, NZ_LYPH01000011_1_WP_010907975_1_388_A8144_RS01855: 0.000004, NZ_CP029543_1_WP_010907975_1_920_DIJ64_RS04675: 0.000004, NZ_AP014567_1_WP_010907975_1_937_JK2ML_RS04760: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 5.52331
(p1 = 0.99999) w = 1.98103
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.98103
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 232.1 79.9 1.9810 0.0000 0.0000 0.0 0.0
7..2 0.000 232.1 79.9 1.9810 0.0000 0.0000 0.0 0.0
7..3 0.000 232.1 79.9 1.9810 0.0000 0.0000 0.0 0.0
7..4 0.000 232.1 79.9 1.9810 0.0000 0.0000 0.0 0.0
7..5 0.000 232.1 79.9 1.9810 0.0000 0.0000 0.0 0.0
7..6 0.000 232.1 79.9 1.9810 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907975_1_902_MLBR_RS04245)
Pr(w>1) post mean +- SE for w
1 V 1.000** 1.981
2 P 1.000** 1.981
3 G 1.000** 1.981
4 Q 1.000** 1.981
5 H 1.000** 1.981
6 G 1.000** 1.981
7 W 1.000** 1.981
8 L 1.000** 1.981
9 A 1.000** 1.981
10 L 1.000** 1.981
11 D 1.000** 1.981
12 H 1.000** 1.981
13 I 1.000** 1.981
14 V 1.000** 1.981
15 G 1.000** 1.981
16 M 1.000** 1.981
17 R 1.000** 1.981
18 D 1.000** 1.981
19 R 1.000** 1.981
20 L 1.000** 1.981
21 V 1.000** 1.981
22 D 1.000** 1.981
23 N 1.000** 1.981
24 R 1.000** 1.981
25 H 1.000** 1.981
26 A 1.000** 1.981
27 A 1.000** 1.981
28 R 1.000** 1.981
29 I 1.000** 1.981
30 T 1.000** 1.981
31 V 1.000** 1.981
32 V 1.000** 1.981
33 S 1.000** 1.981
34 A 1.000** 1.981
35 P 1.000** 1.981
36 G 1.000** 1.981
37 R 1.000** 1.981
38 S 1.000** 1.981
39 E 1.000** 1.981
40 I 1.000** 1.981
41 D 1.000** 1.981
42 V 1.000** 1.981
43 E 1.000** 1.981
44 G 1.000** 1.981
45 I 1.000** 1.981
46 S 1.000** 1.981
47 A 1.000** 1.981
48 G 1.000** 1.981
49 N 1.000** 1.981
50 N 1.000** 1.981
51 R 1.000** 1.981
52 L 1.000** 1.981
53 V 1.000** 1.981
54 L 1.000** 1.981
55 A 1.000** 1.981
56 G 1.000** 1.981
57 T 1.000** 1.981
58 D 1.000** 1.981
59 T 1.000** 1.981
60 G 1.000** 1.981
61 H 1.000** 1.981
62 Q 1.000** 1.981
63 A 1.000** 1.981
64 P 1.000** 1.981
65 I 1.000** 1.981
66 T 1.000** 1.981
67 L 1.000** 1.981
68 V 1.000** 1.981
69 I 1.000** 1.981
70 S 1.000** 1.981
71 T 1.000** 1.981
72 T 1.000** 1.981
73 V 1.000** 1.981
74 L 1.000** 1.981
75 S 1.000** 1.981
76 G 1.000** 1.981
77 V 1.000** 1.981
78 K 1.000** 1.981
79 I 1.000** 1.981
80 S 1.000** 1.981
81 R 1.000** 1.981
82 C 1.000** 1.981
83 T 1.000** 1.981
84 V 1.000** 1.981
85 T 1.000** 1.981
86 V 1.000** 1.981
87 G 1.000** 1.981
88 L 1.000** 1.981
89 P 1.000** 1.981
90 Q 1.000** 1.981
91 D 1.000** 1.981
92 F 1.000** 1.981
93 D 1.000** 1.981
94 R 1.000** 1.981
95 Y 1.000** 1.981
96 Q 1.000** 1.981
97 V 1.000** 1.981
98 G 1.000** 1.981
99 A 1.000** 1.981
100 A 1.000** 1.981
101 R 1.000** 1.981
102 R 1.000** 1.981
103 S 1.000** 1.981
104 G 1.000** 1.981
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907975_1_902_MLBR_RS04245)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:19
Model 1: NearlyNeutral -413.152117 Model 2: PositiveSelection -413.152092 Model 0: one-ratio -413.152107 Model 7: beta -413.152118 Model 8: beta&w>1 -413.1521 Model 0 vs 1 1.9999999949504854E-5 Model 2 vs 1 4.999999998744897E-5 Model 8 vs 7 3.599999990910874E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
