--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 16:21:19 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0606/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0606/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0606/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/5res/ML0606/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1341.67         -1344.47
2      -1341.82         -1345.68
--------------------------------------
TOTAL    -1341.74         -1345.25
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/5res/ML0606/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0606/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0606/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.886186    0.092223    0.343112    1.466148    0.855327   1317.72   1402.38    1.000
r(A<->C){all}   0.166140    0.019741    0.000027    0.442790    0.126607    259.87    281.29    1.000
r(A<->G){all}   0.150607    0.017215    0.000031    0.409157    0.118397    214.49    302.49    1.000
r(A<->T){all}   0.165114    0.020038    0.000011    0.452684    0.127381    201.79    251.66    1.000
r(C<->G){all}   0.153865    0.017925    0.000002    0.422756    0.116085    235.06    337.14    1.000
r(C<->T){all}   0.165458    0.019818    0.000125    0.445375    0.129027    161.07    181.80    1.006
r(G<->T){all}   0.198816    0.025668    0.000026    0.520549    0.155281    102.22    220.79    1.007
pi(A){all}      0.179770    0.000154    0.157224    0.205135    0.179600   1306.18   1320.46    1.000
pi(C){all}      0.283123    0.000211    0.255236    0.312162    0.282951   1266.05   1269.86    1.000
pi(G){all}      0.324094    0.000222    0.295866    0.353916    0.324150   1163.51   1180.33    1.000
pi(T){all}      0.213014    0.000163    0.188646    0.238356    0.213344   1302.73   1337.17    1.000
alpha{1,2}      0.409648    0.190226    0.000116    1.288480    0.262524   1316.80   1361.00    1.001
alpha{3}        0.420316    0.222972    0.000127    1.403949    0.242898   1145.22   1304.05    1.000
pinvar{all}     0.996886    0.000007    0.991740    0.999942    0.997649   1088.02   1181.00    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1309.525415
Model 2: PositiveSelection	-1303.602483
Model 0: one-ratio	-1309.472908
Model 7: beta	-1309.940724
Model 8: beta&w>1	-1303.602484


Model 0 vs 1	0.10501400000021022

Model 2 vs 1	11.845864000000347

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907835_1_635_MLBR_RS03010)

            Pr(w>1)     post mean +- SE for w

   126 G      1.000**       999.000

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907835_1_635_MLBR_RS03010)

            Pr(w>1)     post mean +- SE for w

   126 G      0.884         6.060 +- 3.099


Model 8 vs 7	12.676480000000083

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907835_1_635_MLBR_RS03010)

            Pr(w>1)     post mean +- SE for w

   126 G      1.000**       999.000

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907835_1_635_MLBR_RS03010)

            Pr(w>1)     post mean +- SE for w

   126 G      0.946         5.988 +- 2.938

>C1
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA
>C2
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA
>C3
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLVPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA
>C4
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLVPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA
>C5
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA
>C6
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=325 

C1              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
C2              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
C3              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
C4              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
C5              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
C6              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
                **************************************************

C1              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
C2              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
C3              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
C4              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
C5              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
C6              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
                **************************************************

C1              SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
C2              SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
C3              SSETWECLNTTYHALAERERAAKRLVPHEFLSFIEGRAAMFAGLADSTLS
C4              SSETWECLNTTYHALAERERAAKRLVPHEFLSFIEGRAAMFAGLADSTLS
C5              SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
C6              SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
                ************************* ************************

C1              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
C2              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
C3              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
C4              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
C5              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
C6              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
                **************************************************

C1              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
C2              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
C3              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
C4              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
C5              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
C6              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
                **************************************************

C1              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
C2              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
C3              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
C4              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
C5              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
C6              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
                **************************************************

C1              FHVAPWVAWSDAGHRGRMVGKRGEA
C2              FHVAPWVAWSDAGHRGRMVGKRGEA
C3              FHVAPWVAWSDAGHRGRMVGKRGEA
C4              FHVAPWVAWSDAGHRGRMVGKRGEA
C5              FHVAPWVAWSDAGHRGRMVGKRGEA
C6              FHVAPWVAWSDAGHRGRMVGKRGEA
                *************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  325 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  325 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9750]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [9750]--->[9750]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.514 Mb, Max= 30.891 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
C2              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
C3              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
C4              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
C5              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
C6              MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
                **************************************************

C1              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
C2              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
C3              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
C4              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
C5              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
C6              VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
                **************************************************

C1              SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
C2              SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
C3              SSETWECLNTTYHALAERERAAKRLVPHEFLSFIEGRAAMFAGLADSTLS
C4              SSETWECLNTTYHALAERERAAKRLVPHEFLSFIEGRAAMFAGLADSTLS
C5              SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
C6              SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
                ************************* ************************

C1              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
C2              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
C3              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
C4              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
C5              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
C6              RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
                **************************************************

C1              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
C2              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
C3              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
C4              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
C5              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
C6              LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
                **************************************************

C1              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
C2              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
C3              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
C4              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
C5              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
C6              ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
                **************************************************

C1              FHVAPWVAWSDAGHRGRMVGKRGEA
C2              FHVAPWVAWSDAGHRGRMVGKRGEA
C3              FHVAPWVAWSDAGHRGRMVGKRGEA
C4              FHVAPWVAWSDAGHRGRMVGKRGEA
C5              FHVAPWVAWSDAGHRGRMVGKRGEA
C6              FHVAPWVAWSDAGHRGRMVGKRGEA
                *************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 99.69 C1	 C3	 99.69
TOP	    2    0	 99.69 C3	 C1	 99.69
BOT	    0    3	 99.69 C1	 C4	 99.69
TOP	    3    0	 99.69 C4	 C1	 99.69
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 99.69 C2	 C3	 99.69
TOP	    2    1	 99.69 C3	 C2	 99.69
BOT	    1    3	 99.69 C2	 C4	 99.69
TOP	    3    1	 99.69 C4	 C2	 99.69
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 99.69 C3	 C5	 99.69
TOP	    4    2	 99.69 C5	 C3	 99.69
BOT	    2    5	 99.69 C3	 C6	 99.69
TOP	    5    2	 99.69 C6	 C3	 99.69
BOT	    3    4	 99.69 C4	 C5	 99.69
TOP	    4    3	 99.69 C5	 C4	 99.69
BOT	    3    5	 99.69 C4	 C6	 99.69
TOP	    5    3	 99.69 C6	 C4	 99.69
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 99.88
AVG	 1	 C2	  *	 99.88
AVG	 2	 C3	  *	 99.75
AVG	 3	 C4	  *	 99.75
AVG	 4	 C5	  *	 99.88
AVG	 5	 C6	  *	 99.88
TOT	 TOT	  *	 99.84
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
C2              ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
C3              ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
C4              ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
C5              ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
C6              ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
                **************************************************

C1              ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
C2              ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
C3              ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
C4              ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
C5              ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
C6              ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
                **************************************************

C1              TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
C2              TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
C3              TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
C4              TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
C5              TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
C6              TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
                **************************************************

C1              GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
C2              GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
C3              GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
C4              GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
C5              GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
C6              GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
                **************************************************

C1              CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
C2              CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
C3              CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
C4              CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
C5              CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
C6              CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
                **************************************************

C1              ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
C2              ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
C3              ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
C4              ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
C5              ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
C6              ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
                **************************************************

C1              TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
C2              TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
C3              TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
C4              TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
C5              TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
C6              TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
                **************************************************

C1              ACGCGAACGCGCCGCTAAACGCCTTGGTCCACACGAATTTTTGTCTTTCA
C2              ACGCGAACGCGCCGCTAAACGCCTTGGTCCACACGAATTTTTGTCTTTCA
C3              ACGCGAACGCGCCGCTAAACGCCTTGTTCCACACGAATTTTTGTCTTTCA
C4              ACGCGAACGCGCCGCTAAACGCCTTGTTCCACACGAATTTTTGTCTTTCA
C5              ACGCGAACGCGCCGCTAAACGCCTTGGTCCACACGAATTTTTGTCTTTCA
C6              ACGCGAACGCGCCGCTAAACGCCTTGGTCCACACGAATTTTTGTCTTTCA
                ************************** ***********************

C1              TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
C2              TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
C3              TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
C4              TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
C5              TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
C6              TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
                **************************************************

C1              CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
C2              CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
C3              CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
C4              CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
C5              CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
C6              CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
                **************************************************

C1              CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
C2              CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
C3              CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
C4              CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
C5              CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
C6              CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
                **************************************************

C1              CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
C2              CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
C3              CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
C4              CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
C5              CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
C6              CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
                **************************************************

C1              CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
C2              CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
C3              CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
C4              CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
C5              CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
C6              CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
                **************************************************

C1              GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
C2              GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
C3              GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
C4              GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
C5              GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
C6              GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
                **************************************************

C1              CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
C2              CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
C3              CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
C4              CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
C5              CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
C6              CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
                **************************************************

C1              GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
C2              GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
C3              GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
C4              GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
C5              GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
C6              GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
                **************************************************

C1              ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
C2              ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
C3              ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
C4              ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
C5              ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
C6              ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
                **************************************************

C1              GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
C2              GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
C3              GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
C4              GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
C5              GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
C6              GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
                **************************************************

C1              TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
C2              TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
C3              TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
C4              TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
C5              TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
C6              TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
                **************************************************

C1              AATGGTTGGCAAGCGGGGAGAAGCC
C2              AATGGTTGGCAAGCGGGGAGAAGCC
C3              AATGGTTGGCAAGCGGGGAGAAGCC
C4              AATGGTTGGCAAGCGGGGAGAAGCC
C5              AATGGTTGGCAAGCGGGGAGAAGCC
C6              AATGGTTGGCAAGCGGGGAGAAGCC
                *************************



>C1
ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
ACGCGAACGCGCCGCTAAACGCCTTGGTCCACACGAATTTTTGTCTTTCA
TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
AATGGTTGGCAAGCGGGGAGAAGCC
>C2
ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
ACGCGAACGCGCCGCTAAACGCCTTGGTCCACACGAATTTTTGTCTTTCA
TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
AATGGTTGGCAAGCGGGGAGAAGCC
>C3
ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
ACGCGAACGCGCCGCTAAACGCCTTGTTCCACACGAATTTTTGTCTTTCA
TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
AATGGTTGGCAAGCGGGGAGAAGCC
>C4
ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
ACGCGAACGCGCCGCTAAACGCCTTGTTCCACACGAATTTTTGTCTTTCA
TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
AATGGTTGGCAAGCGGGGAGAAGCC
>C5
ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
ACGCGAACGCGCCGCTAAACGCCTTGGTCCACACGAATTTTTGTCTTTCA
TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
AATGGTTGGCAAGCGGGGAGAAGCC
>C6
ATGCTTGCCCGTAACGCCGAGGCGCTCTATTGGATCGGTCGCTACGTCGA
ACGTGCCGACGACACCGCGCGCATTCTCGACGTCGTTGTGCACCAATTGT
TGGAAGATTCCAGCGTTGATCCCGACCACGCCTCGAGGACGTTGCTGCGG
GTGCTCGGCATCGAGCTCCCGGACCACGAGTTGGACGTCTGGTCGCTGAC
CGATCTGGTGGCGTTCAGTACCAATGCTCAGGGCGGCTCTTCGATCGTCG
ATGCGATCTCGGCGGCGCGGGAAAACGCAAAATCGGCACGGGAAGTGACA
TCCAGTGAAACCTGGGAATGTCTCAACACCACATACCATGCTCTCGCCGA
ACGCGAACGCGCCGCTAAACGCCTTGGTCCACACGAATTTTTGTCTTTCA
TCGAGGGTCGGGCGGCGATGTTCGCCGGCCTGGCTGACTCGACGCTTTCG
CGTGACGACGGATACCGCTTCATGCTGCTGGGCCGCGCTATAGAGCGGGT
CGACATGACGGTGCGACTGTTGTTGTCCCGGGTGGGAGATAGCGCGTCGT
CACCGGCATGGGTGACGCTGCTACGCTCGGCTGGTGGGCATGACACCTAT
CTGCGCACCTACCGCGGTGTGTTGGATGCAGCCCGGGTGGTCGAATTCAT
GCTGCTCGACCGGCTGTTTCCACGTTCGATTTTTTACTCGCTGAAGTTGG
CCGAACACAACCTTGACGAGTTGTTGCGCAATCCGCAGAGCCGAGTTGGT
GCCACAACGGAAGCGCAGCGGTTACTCGGGCAGGCCCGCAGCGAACTGGA
ATTCGTGCAACCCGGTGTGCTGCTGAAGACACTGGACAGCCGCTTGGCTA
GCCTGCAGACCACTTGCAGGGATGTTGGAGACGCATTGGTGTTGCAGTAT
TTTCACGTCGCGCCGTGGGTAGCGTGGTCGGATGCCGGCCACCGGGGACG
AATGGTTGGCAAGCGGGGAGAAGCC
>C1
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA
>C2
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA
>C3
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLVPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA
>C4
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLVPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA
>C5
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA
>C6
MLARNAEALYWIGRYVERADDTARILDVVVHQLLEDSSVDPDHASRTLLR
VLGIELPDHELDVWSLTDLVAFSTNAQGGSSIVDAISAARENAKSAREVT
SSETWECLNTTYHALAERERAAKRLGPHEFLSFIEGRAAMFAGLADSTLS
RDDGYRFMLLGRAIERVDMTVRLLLSRVGDSASSPAWVTLLRSAGGHDTY
LRTYRGVLDAARVVEFMLLDRLFPRSIFYSLKLAEHNLDELLRNPQSRVG
ATTEAQRLLGQARSELEFVQPGVLLKTLDSRLASLQTTCRDVGDALVLQY
FHVAPWVAWSDAGHRGRMVGKRGEA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/5res/ML0606/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 975 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579796392
      Setting output file names to "/data/5res/ML0606/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 764806145
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0176459306
      Seed = 774117320
      Swapseed = 1579796392
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2188.130388 -- -24.965149
         Chain 2 -- -2185.463896 -- -24.965149
         Chain 3 -- -2188.768503 -- -24.965149
         Chain 4 -- -2188.803680 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2188.768503 -- -24.965149
         Chain 2 -- -2188.768503 -- -24.965149
         Chain 3 -- -2188.767234 -- -24.965149
         Chain 4 -- -2188.768503 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2188.130] (-2185.464) (-2188.769) (-2188.804) * [-2188.769] (-2188.769) (-2188.767) (-2188.769) 
        500 -- [-1348.501] (-1344.765) (-1366.343) (-1348.602) * (-1348.306) (-1352.186) [-1344.294] (-1347.356) -- 0:00:00
       1000 -- (-1345.584) (-1339.399) (-1354.616) [-1346.564] * (-1346.343) (-1346.597) (-1343.669) [-1343.762] -- 0:00:00
       1500 -- (-1347.556) (-1344.596) (-1342.389) [-1345.663] * [-1346.209] (-1344.880) (-1350.912) (-1350.216) -- 0:00:00
       2000 -- [-1341.579] (-1346.899) (-1351.561) (-1347.791) * (-1347.824) (-1351.078) [-1347.190] (-1340.520) -- 0:00:00
       2500 -- [-1348.853] (-1342.185) (-1353.402) (-1345.808) * (-1344.634) (-1342.402) (-1346.420) [-1347.486] -- 0:00:00
       3000 -- [-1343.255] (-1345.253) (-1351.159) (-1350.368) * (-1348.223) [-1349.552] (-1348.043) (-1344.024) -- 0:00:00
       3500 -- (-1345.778) (-1345.409) [-1346.382] (-1348.527) * (-1352.050) (-1343.219) (-1345.965) [-1340.643] -- 0:00:00
       4000 -- (-1342.596) (-1343.252) (-1349.585) [-1346.505] * (-1348.128) (-1350.759) [-1351.369] (-1346.842) -- 0:00:00
       4500 -- (-1343.057) [-1346.824] (-1351.238) (-1346.351) * [-1347.580] (-1343.153) (-1352.428) (-1344.483) -- 0:03:41
       5000 -- (-1349.515) (-1346.430) [-1343.536] (-1360.526) * (-1343.007) [-1344.962] (-1347.709) (-1347.262) -- 0:03:19

      Average standard deviation of split frequencies: 0.071425

       5500 -- (-1348.590) (-1346.034) [-1349.784] (-1342.091) * (-1350.412) (-1340.059) (-1350.684) [-1346.906] -- 0:03:00
       6000 -- (-1339.161) (-1355.767) (-1352.858) [-1340.833] * (-1347.853) (-1343.147) [-1351.158] (-1341.385) -- 0:02:45
       6500 -- (-1352.342) [-1346.582] (-1347.449) (-1349.408) * (-1342.246) (-1351.821) (-1345.930) [-1342.145] -- 0:02:32
       7000 -- (-1343.760) [-1341.965] (-1351.495) (-1358.818) * (-1348.949) [-1348.711] (-1344.304) (-1345.489) -- 0:02:21
       7500 -- [-1350.848] (-1342.585) (-1341.405) (-1346.261) * (-1355.164) [-1343.073] (-1344.187) (-1342.476) -- 0:02:12
       8000 -- (-1346.836) (-1344.908) (-1341.717) [-1344.562] * (-1349.806) (-1351.623) (-1360.280) [-1343.158] -- 0:02:04
       8500 -- (-1342.650) [-1354.371] (-1347.361) (-1349.913) * [-1342.022] (-1350.877) (-1343.257) (-1348.546) -- 0:01:56
       9000 -- (-1347.557) [-1354.609] (-1342.918) (-1343.390) * [-1345.120] (-1347.591) (-1345.638) (-1360.108) -- 0:01:50
       9500 -- (-1345.258) (-1360.589) (-1346.408) [-1343.955] * (-1351.411) (-1344.046) [-1341.364] (-1348.134) -- 0:01:44
      10000 -- [-1345.899] (-1357.097) (-1348.035) (-1344.485) * (-1341.783) (-1349.851) [-1343.599] (-1350.208) -- 0:01:39

      Average standard deviation of split frequencies: 0.048614

      10500 -- (-1346.713) (-1343.029) (-1360.668) [-1344.254] * (-1341.020) (-1343.070) (-1341.866) [-1347.120] -- 0:01:34
      11000 -- [-1349.248] (-1353.345) (-1350.681) (-1349.976) * [-1343.644] (-1344.279) (-1342.591) (-1351.945) -- 0:01:29
      11500 -- (-1347.975) (-1350.937) (-1345.060) [-1343.290] * (-1344.773) [-1346.164] (-1343.949) (-1342.836) -- 0:01:25
      12000 -- (-1353.708) [-1345.567] (-1348.156) (-1350.721) * (-1345.142) (-1342.233) (-1345.836) [-1349.894] -- 0:01:22
      12500 -- [-1342.082] (-1343.275) (-1352.149) (-1353.195) * [-1342.964] (-1348.062) (-1346.936) (-1350.162) -- 0:01:19
      13000 -- (-1343.910) [-1344.207] (-1348.928) (-1340.489) * (-1344.483) (-1343.929) (-1343.394) [-1351.908] -- 0:01:15
      13500 -- (-1348.346) [-1341.323] (-1344.715) (-1347.134) * (-1342.076) [-1340.825] (-1344.300) (-1349.756) -- 0:01:13
      14000 -- (-1347.151) [-1341.812] (-1350.766) (-1353.923) * (-1341.682) (-1349.560) [-1343.583] (-1352.690) -- 0:01:10
      14500 -- (-1360.371) [-1347.795] (-1344.021) (-1339.914) * [-1341.664] (-1351.035) (-1341.842) (-1352.127) -- 0:01:07
      15000 -- [-1347.208] (-1347.528) (-1345.698) (-1350.064) * (-1343.249) (-1358.526) [-1343.814] (-1345.742) -- 0:01:05

      Average standard deviation of split frequencies: 0.092921

      15500 -- (-1341.430) (-1359.030) (-1344.145) [-1345.712] * (-1341.205) (-1344.760) (-1343.355) [-1346.855] -- 0:01:03
      16000 -- (-1343.389) (-1350.652) (-1344.261) [-1340.169] * (-1340.982) [-1343.323] (-1341.884) (-1342.997) -- 0:01:01
      16500 -- [-1343.703] (-1346.934) (-1340.808) (-1359.853) * (-1339.839) (-1345.288) [-1341.909] (-1346.951) -- 0:00:59
      17000 -- (-1346.277) [-1345.928] (-1345.300) (-1351.447) * (-1344.938) (-1359.210) (-1341.615) [-1342.270] -- 0:00:57
      17500 -- (-1345.100) (-1343.256) [-1341.243] (-1342.584) * (-1341.267) [-1339.812] (-1343.376) (-1340.469) -- 0:00:56
      18000 -- (-1341.822) (-1344.944) [-1344.096] (-1345.893) * (-1344.228) (-1339.250) [-1343.762] (-1341.248) -- 0:00:54
      18500 -- (-1342.023) (-1351.956) (-1344.445) [-1341.154] * [-1342.727] (-1344.810) (-1346.433) (-1341.800) -- 0:00:53
      19000 -- (-1340.896) (-1355.071) (-1342.353) [-1350.149] * (-1343.678) [-1343.423] (-1340.795) (-1343.787) -- 0:01:43
      19500 -- [-1342.944] (-1349.769) (-1341.269) (-1348.095) * (-1341.475) [-1350.231] (-1342.447) (-1343.520) -- 0:01:40
      20000 -- (-1341.046) [-1340.940] (-1343.372) (-1351.517) * (-1341.225) (-1350.588) [-1343.539] (-1341.749) -- 0:01:38

      Average standard deviation of split frequencies: 0.082945

      20500 -- (-1341.718) (-1339.363) (-1344.676) [-1344.137] * (-1341.796) [-1346.711] (-1342.975) (-1342.443) -- 0:01:35
      21000 -- (-1341.899) [-1342.442] (-1340.622) (-1345.084) * (-1340.404) (-1347.744) [-1342.592] (-1341.601) -- 0:01:33
      21500 -- (-1342.225) (-1341.532) (-1342.107) [-1344.480] * (-1340.919) (-1352.269) [-1341.631] (-1344.266) -- 0:01:31
      22000 -- (-1342.554) (-1341.453) [-1344.733] (-1356.641) * (-1346.336) (-1345.182) (-1346.089) [-1340.995] -- 0:01:28
      22500 -- (-1342.693) (-1344.255) [-1340.243] (-1362.125) * (-1342.996) (-1356.093) (-1343.583) [-1346.753] -- 0:01:26
      23000 -- [-1342.436] (-1343.421) (-1339.160) (-1346.736) * (-1344.778) (-1341.976) (-1342.498) [-1344.724] -- 0:01:24
      23500 -- (-1345.103) (-1342.118) (-1342.035) [-1340.874] * (-1343.354) [-1341.415] (-1342.893) (-1342.936) -- 0:01:23
      24000 -- (-1343.472) (-1341.668) (-1342.225) [-1343.905] * (-1346.466) (-1341.700) (-1342.982) [-1342.829] -- 0:01:21
      24500 -- (-1344.954) (-1343.563) (-1341.473) [-1340.967] * (-1341.662) (-1343.014) (-1343.563) [-1342.856] -- 0:01:19
      25000 -- (-1342.134) [-1342.076] (-1343.031) (-1340.849) * [-1341.398] (-1342.772) (-1341.107) (-1348.334) -- 0:01:18

      Average standard deviation of split frequencies: 0.056983

      25500 -- (-1345.508) [-1341.622] (-1342.318) (-1340.370) * (-1343.538) (-1343.419) (-1341.109) [-1343.466] -- 0:01:16
      26000 -- (-1343.378) (-1341.985) (-1341.512) [-1342.702] * (-1343.605) [-1340.939] (-1343.908) (-1341.270) -- 0:01:14
      26500 -- (-1342.626) (-1343.726) (-1340.341) [-1345.282] * (-1344.164) (-1341.757) [-1341.983] (-1341.889) -- 0:01:13
      27000 -- (-1349.779) (-1345.393) (-1341.865) [-1339.332] * (-1342.512) [-1342.059] (-1343.840) (-1343.733) -- 0:01:12
      27500 -- [-1348.079] (-1342.072) (-1342.370) (-1342.562) * (-1342.407) (-1341.323) (-1343.505) [-1343.039] -- 0:01:10
      28000 -- (-1342.515) (-1342.065) (-1339.653) [-1341.881] * (-1343.767) (-1343.246) [-1341.410] (-1340.654) -- 0:01:09
      28500 -- (-1343.617) (-1341.797) (-1341.282) [-1344.637] * (-1344.193) (-1341.987) [-1343.477] (-1342.129) -- 0:01:08
      29000 -- (-1344.765) (-1342.916) [-1340.775] (-1347.826) * (-1343.283) (-1348.586) [-1342.590] (-1344.365) -- 0:01:06
      29500 -- (-1345.181) (-1340.943) (-1342.070) [-1345.685] * [-1341.081] (-1343.562) (-1343.937) (-1344.766) -- 0:01:05
      30000 -- (-1341.092) (-1340.423) (-1343.505) [-1342.908] * (-1341.731) (-1338.990) [-1340.513] (-1346.143) -- 0:01:04

      Average standard deviation of split frequencies: 0.055575

      30500 -- (-1341.775) (-1340.483) [-1342.705] (-1351.036) * [-1342.974] (-1341.063) (-1343.600) (-1344.158) -- 0:01:03
      31000 -- (-1343.341) [-1341.740] (-1343.384) (-1345.194) * (-1343.075) (-1339.531) (-1346.291) [-1342.589] -- 0:01:02
      31500 -- (-1342.482) [-1340.548] (-1341.305) (-1342.684) * (-1342.593) (-1340.202) (-1345.489) [-1341.135] -- 0:01:01
      32000 -- (-1340.182) [-1341.959] (-1342.115) (-1356.824) * (-1340.297) [-1345.466] (-1344.037) (-1341.765) -- 0:01:00
      32500 -- [-1342.530] (-1341.577) (-1341.694) (-1345.260) * (-1342.204) [-1343.094] (-1344.461) (-1344.013) -- 0:00:59
      33000 -- (-1341.457) (-1342.259) (-1341.586) [-1343.259] * (-1343.943) [-1342.199] (-1344.058) (-1345.698) -- 0:01:27
      33500 -- (-1340.660) (-1342.923) (-1339.554) [-1344.569] * [-1342.293] (-1340.722) (-1344.892) (-1345.273) -- 0:01:26
      34000 -- (-1343.648) (-1343.047) (-1347.337) [-1346.574] * (-1342.073) [-1343.052] (-1343.583) (-1344.047) -- 0:01:25
      34500 -- (-1341.387) (-1341.641) (-1342.265) [-1358.227] * (-1341.327) (-1344.567) (-1343.509) [-1342.361] -- 0:01:23
      35000 -- [-1341.090] (-1342.439) (-1341.994) (-1343.335) * (-1340.617) (-1342.335) [-1344.910] (-1342.922) -- 0:01:22

      Average standard deviation of split frequencies: 0.051287

      35500 -- (-1340.790) (-1343.654) [-1341.948] (-1348.062) * (-1341.118) (-1345.465) [-1343.483] (-1342.732) -- 0:01:21
      36000 -- (-1342.656) (-1340.272) (-1341.631) [-1345.269] * (-1342.122) (-1340.898) (-1342.369) [-1342.218] -- 0:01:20
      36500 -- (-1343.329) [-1341.218] (-1341.193) (-1348.739) * (-1343.143) [-1343.255] (-1343.479) (-1342.981) -- 0:01:19
      37000 -- (-1343.137) [-1342.285] (-1342.013) (-1354.809) * (-1344.599) (-1343.990) (-1343.532) [-1342.611] -- 0:01:18
      37500 -- (-1342.823) [-1342.632] (-1343.045) (-1346.816) * (-1342.867) [-1343.311] (-1343.205) (-1341.234) -- 0:01:17
      38000 -- [-1341.096] (-1340.589) (-1341.606) (-1342.812) * (-1343.069) (-1346.611) (-1343.946) [-1341.072] -- 0:01:15
      38500 -- (-1341.362) (-1342.377) [-1340.701] (-1347.629) * (-1342.497) [-1341.377] (-1343.947) (-1342.474) -- 0:01:14
      39000 -- (-1342.256) [-1342.054] (-1343.028) (-1346.708) * [-1345.125] (-1341.207) (-1344.152) (-1341.367) -- 0:01:13
      39500 -- (-1342.014) (-1348.042) [-1342.559] (-1352.289) * (-1343.023) (-1341.137) (-1344.678) [-1342.085] -- 0:01:12
      40000 -- (-1341.778) (-1344.917) (-1340.770) [-1344.126] * [-1344.674] (-1341.259) (-1344.352) (-1343.638) -- 0:01:12

      Average standard deviation of split frequencies: 0.052164

      40500 -- (-1342.782) (-1345.323) [-1344.051] (-1346.739) * [-1346.025] (-1350.051) (-1348.186) (-1342.238) -- 0:01:11
      41000 -- (-1342.991) (-1346.992) [-1342.499] (-1343.657) * (-1341.690) [-1345.505] (-1341.262) (-1340.426) -- 0:01:10
      41500 -- (-1342.005) (-1342.098) (-1341.830) [-1344.834] * (-1344.078) (-1344.789) (-1343.200) [-1343.155] -- 0:01:09
      42000 -- (-1342.773) [-1341.597] (-1342.723) (-1348.425) * (-1342.148) (-1345.739) [-1343.345] (-1342.004) -- 0:01:08
      42500 -- (-1344.203) [-1341.706] (-1343.886) (-1344.616) * [-1343.122] (-1347.001) (-1340.340) (-1343.665) -- 0:01:07
      43000 -- (-1341.452) [-1339.935] (-1343.054) (-1343.038) * (-1341.907) (-1345.571) (-1341.503) [-1345.564] -- 0:01:06
      43500 -- (-1342.411) (-1344.212) (-1342.768) [-1341.031] * (-1343.229) (-1342.339) [-1343.363] (-1341.832) -- 0:01:05
      44000 -- (-1341.111) (-1342.507) (-1343.065) [-1349.575] * (-1343.308) [-1343.454] (-1346.508) (-1339.719) -- 0:01:05
      44500 -- [-1340.681] (-1344.679) (-1344.768) (-1344.355) * (-1343.339) [-1339.485] (-1343.146) (-1342.000) -- 0:01:04
      45000 -- (-1339.961) (-1346.210) [-1346.188] (-1347.775) * (-1345.728) (-1342.990) [-1345.300] (-1340.713) -- 0:01:03

      Average standard deviation of split frequencies: 0.048678

      45500 -- (-1340.064) (-1342.434) [-1340.919] (-1347.050) * (-1344.914) (-1343.807) (-1344.353) [-1340.832] -- 0:01:02
      46000 -- (-1342.428) (-1346.128) (-1341.418) [-1345.225] * [-1343.612] (-1343.173) (-1346.786) (-1340.306) -- 0:01:02
      46500 -- (-1344.061) [-1346.673] (-1339.191) (-1346.197) * (-1346.120) [-1342.226] (-1341.677) (-1344.346) -- 0:01:01
      47000 -- [-1341.873] (-1344.029) (-1339.481) (-1350.437) * (-1344.112) [-1348.741] (-1343.764) (-1343.986) -- 0:01:00
      47500 -- (-1343.128) (-1341.955) [-1342.229] (-1355.227) * (-1344.094) (-1346.955) (-1342.899) [-1345.922] -- 0:01:00
      48000 -- (-1344.925) (-1340.869) (-1342.822) [-1347.997] * (-1343.213) (-1344.394) (-1341.610) [-1342.610] -- 0:01:19
      48500 -- (-1341.675) (-1342.867) (-1343.886) [-1351.326] * [-1341.000] (-1342.416) (-1346.515) (-1341.978) -- 0:01:18
      49000 -- (-1348.856) (-1341.708) (-1346.071) [-1343.507] * [-1345.412] (-1342.437) (-1342.236) (-1342.615) -- 0:01:17
      49500 -- [-1341.761] (-1341.933) (-1344.802) (-1348.906) * [-1342.850] (-1342.333) (-1344.303) (-1342.489) -- 0:01:16
      50000 -- [-1341.762] (-1348.472) (-1344.212) (-1354.118) * (-1346.443) (-1343.403) (-1343.381) [-1341.720] -- 0:01:16

      Average standard deviation of split frequencies: 0.049001

      50500 -- (-1342.529) (-1350.305) (-1342.800) [-1347.574] * (-1343.894) (-1344.728) (-1342.083) [-1339.357] -- 0:01:15
      51000 -- (-1343.568) (-1346.052) (-1343.663) [-1355.474] * (-1344.435) (-1343.671) (-1343.425) [-1344.221] -- 0:01:14
      51500 -- (-1341.837) (-1345.729) (-1342.351) [-1351.157] * (-1344.700) (-1343.100) (-1343.365) [-1342.459] -- 0:01:13
      52000 -- (-1342.529) (-1343.115) (-1344.394) [-1346.936] * (-1347.133) (-1343.345) [-1341.040] (-1341.838) -- 0:01:12
      52500 -- (-1343.360) [-1341.583] (-1344.467) (-1342.728) * (-1342.490) [-1340.956] (-1340.529) (-1348.042) -- 0:01:12
      53000 -- (-1345.526) (-1344.612) (-1341.267) [-1342.779] * (-1341.315) (-1341.503) [-1341.493] (-1341.819) -- 0:01:11
      53500 -- (-1342.095) (-1342.447) [-1342.754] (-1345.603) * (-1341.508) (-1341.087) [-1341.680] (-1342.799) -- 0:01:10
      54000 -- (-1343.180) (-1342.037) (-1342.611) [-1342.417] * [-1341.963] (-1341.987) (-1342.282) (-1341.023) -- 0:01:10
      54500 -- (-1342.954) (-1344.497) (-1341.539) [-1343.856] * (-1348.663) (-1340.199) (-1344.193) [-1338.976] -- 0:01:09
      55000 -- (-1341.134) (-1340.908) (-1343.411) [-1343.989] * (-1341.469) (-1341.567) (-1344.739) [-1342.907] -- 0:01:08

      Average standard deviation of split frequencies: 0.052191

      55500 -- (-1341.094) (-1341.160) (-1338.912) [-1343.662] * (-1346.534) (-1341.619) [-1344.710] (-1345.275) -- 0:01:08
      56000 -- (-1341.007) (-1342.526) [-1342.176] (-1354.073) * (-1343.355) (-1344.181) [-1341.641] (-1345.072) -- 0:01:07
      56500 -- (-1341.457) [-1339.511] (-1345.772) (-1349.340) * (-1342.203) (-1344.064) [-1341.482] (-1344.225) -- 0:01:06
      57000 -- (-1342.330) (-1341.056) [-1341.364] (-1361.110) * (-1341.934) [-1341.960] (-1344.750) (-1342.067) -- 0:01:06
      57500 -- (-1342.572) (-1342.628) (-1340.986) [-1340.999] * (-1344.024) (-1343.643) [-1342.764] (-1346.010) -- 0:01:05
      58000 -- (-1342.343) (-1343.181) (-1341.683) [-1341.478] * (-1341.840) [-1340.663] (-1345.580) (-1343.970) -- 0:01:04
      58500 -- (-1341.851) [-1341.475] (-1341.900) (-1339.200) * (-1342.366) (-1344.745) [-1344.038] (-1342.929) -- 0:01:04
      59000 -- (-1345.128) (-1341.582) (-1343.367) [-1348.049] * (-1344.266) [-1342.045] (-1343.291) (-1345.834) -- 0:01:03
      59500 -- (-1342.000) (-1339.841) [-1342.963] (-1345.952) * (-1342.218) (-1340.058) [-1341.847] (-1350.180) -- 0:01:03
      60000 -- (-1347.347) (-1342.780) (-1342.672) [-1349.131] * (-1346.721) (-1341.430) (-1344.105) [-1341.588] -- 0:01:02

      Average standard deviation of split frequencies: 0.054393

      60500 -- (-1346.030) (-1342.489) (-1341.602) [-1345.354] * (-1343.561) (-1342.248) (-1342.437) [-1341.610] -- 0:01:02
      61000 -- (-1342.280) (-1341.831) (-1344.891) [-1341.907] * (-1344.517) (-1343.386) (-1348.702) [-1342.161] -- 0:01:01
      61500 -- (-1342.850) [-1343.023] (-1343.061) (-1347.543) * (-1345.218) [-1343.246] (-1343.371) (-1341.888) -- 0:01:01
      62000 -- (-1342.275) (-1342.466) [-1342.463] (-1356.714) * [-1343.576] (-1345.997) (-1340.868) (-1341.446) -- 0:01:00
      62500 -- (-1343.903) (-1342.636) [-1342.756] (-1343.658) * [-1342.019] (-1342.052) (-1342.608) (-1341.482) -- 0:01:15
      63000 -- [-1341.986] (-1343.024) (-1344.094) (-1343.727) * (-1341.776) (-1342.201) [-1341.238] (-1341.100) -- 0:01:14
      63500 -- [-1340.452] (-1342.333) (-1341.930) (-1348.556) * [-1342.894] (-1341.699) (-1344.605) (-1340.993) -- 0:01:13
      64000 -- (-1342.990) (-1344.857) (-1344.352) [-1342.359] * (-1343.583) [-1343.110] (-1342.328) (-1342.088) -- 0:01:13
      64500 -- [-1343.900] (-1341.832) (-1347.347) (-1348.838) * (-1342.129) [-1341.769] (-1345.015) (-1342.241) -- 0:01:12
      65000 -- [-1342.833] (-1341.687) (-1343.814) (-1346.171) * (-1341.495) (-1342.709) [-1340.257] (-1346.431) -- 0:01:11

      Average standard deviation of split frequencies: 0.048410

      65500 -- (-1343.443) (-1341.489) (-1343.163) [-1346.901] * (-1341.464) (-1342.685) (-1346.140) [-1346.483] -- 0:01:11
      66000 -- (-1345.880) (-1341.870) (-1344.307) [-1347.841] * (-1344.169) [-1343.056] (-1342.186) (-1347.040) -- 0:01:10
      66500 -- (-1344.591) (-1342.008) (-1342.208) [-1346.917] * (-1341.375) (-1342.043) [-1339.691] (-1342.138) -- 0:01:10
      67000 -- [-1348.274] (-1341.720) (-1343.750) (-1353.917) * (-1343.046) [-1342.165] (-1341.864) (-1345.397) -- 0:01:09
      67500 -- (-1342.202) [-1341.105] (-1342.482) (-1345.189) * [-1341.898] (-1346.846) (-1344.450) (-1343.756) -- 0:01:09
      68000 -- (-1341.233) (-1341.677) (-1346.556) [-1346.394] * (-1343.952) (-1350.628) [-1341.078] (-1345.315) -- 0:01:08
      68500 -- (-1340.350) (-1342.594) (-1345.864) [-1347.581] * (-1345.608) (-1347.178) [-1341.023] (-1344.155) -- 0:01:07
      69000 -- (-1341.046) (-1342.319) (-1345.481) [-1341.415] * (-1344.258) (-1343.324) [-1340.903] (-1341.581) -- 0:01:07
      69500 -- (-1345.439) (-1341.776) (-1342.857) [-1342.669] * [-1342.533] (-1344.080) (-1342.447) (-1345.766) -- 0:01:06
      70000 -- (-1346.324) (-1343.023) (-1344.611) [-1345.848] * (-1341.393) (-1346.176) [-1342.709] (-1347.763) -- 0:01:06

      Average standard deviation of split frequencies: 0.049050

      70500 -- (-1347.860) (-1342.176) (-1343.798) [-1342.350] * (-1341.579) (-1346.802) [-1342.994] (-1343.215) -- 0:01:05
      71000 -- (-1344.826) (-1343.200) [-1342.763] (-1350.144) * (-1342.933) (-1344.820) (-1339.894) [-1343.522] -- 0:01:05
      71500 -- (-1343.264) (-1341.708) (-1340.481) [-1349.700] * (-1344.790) [-1342.378] (-1345.544) (-1340.944) -- 0:01:04
      72000 -- (-1341.001) (-1342.711) (-1346.971) [-1343.239] * (-1342.079) (-1342.470) [-1346.669] (-1343.216) -- 0:01:04
      72500 -- [-1341.034] (-1343.424) (-1347.019) (-1344.766) * (-1342.490) [-1342.454] (-1346.225) (-1342.378) -- 0:01:03
      73000 -- [-1341.743] (-1342.449) (-1341.537) (-1348.522) * (-1341.481) [-1342.522] (-1342.982) (-1347.555) -- 0:01:03
      73500 -- (-1341.179) (-1342.651) (-1341.931) [-1346.159] * (-1343.885) (-1346.237) [-1346.536] (-1347.938) -- 0:01:03
      74000 -- (-1341.382) (-1345.670) (-1342.386) [-1353.569] * [-1344.042] (-1342.563) (-1348.135) (-1345.084) -- 0:01:02
      74500 -- (-1342.180) (-1345.116) (-1341.721) [-1342.430] * (-1343.175) [-1341.206] (-1343.512) (-1343.439) -- 0:01:02
      75000 -- (-1342.342) (-1342.361) (-1343.392) [-1342.443] * (-1343.314) (-1341.835) (-1343.523) [-1342.296] -- 0:01:01

      Average standard deviation of split frequencies: 0.048846

      75500 -- (-1345.004) (-1343.322) [-1343.846] (-1351.153) * [-1343.050] (-1344.274) (-1343.029) (-1341.019) -- 0:01:01
      76000 -- [-1342.233] (-1343.916) (-1343.253) (-1351.692) * (-1346.504) [-1342.119] (-1342.980) (-1345.197) -- 0:01:00
      76500 -- [-1342.640] (-1342.123) (-1341.184) (-1349.933) * (-1344.323) (-1342.101) (-1342.891) [-1342.734] -- 0:01:00
      77000 -- (-1347.729) (-1343.190) (-1342.243) [-1342.892] * (-1343.370) [-1341.958] (-1344.274) (-1341.825) -- 0:01:11
      77500 -- (-1347.905) (-1343.767) (-1344.806) [-1351.306] * (-1344.591) [-1342.318] (-1344.504) (-1341.291) -- 0:01:11
      78000 -- (-1343.674) (-1341.236) (-1344.622) [-1345.023] * (-1344.857) (-1342.370) (-1344.617) [-1340.678] -- 0:01:10
      78500 -- (-1346.203) (-1342.131) (-1344.500) [-1348.261] * (-1342.238) (-1344.003) (-1341.362) [-1341.655] -- 0:01:10
      79000 -- (-1342.477) (-1343.202) (-1342.354) [-1346.726] * (-1344.344) [-1341.062] (-1341.929) (-1342.146) -- 0:01:09
      79500 -- (-1341.965) (-1344.893) (-1343.982) [-1349.812] * (-1341.928) (-1340.527) (-1345.201) [-1341.983] -- 0:01:09
      80000 -- (-1340.987) (-1343.945) [-1342.859] (-1343.724) * (-1343.206) [-1342.403] (-1345.106) (-1342.449) -- 0:01:09

      Average standard deviation of split frequencies: 0.050971

      80500 -- (-1342.110) (-1341.771) (-1343.769) [-1340.153] * [-1343.573] (-1344.662) (-1353.512) (-1342.637) -- 0:01:08
      81000 -- (-1343.137) (-1346.619) (-1343.601) [-1343.414] * (-1342.788) (-1346.171) [-1347.801] (-1342.781) -- 0:01:08
      81500 -- (-1344.830) (-1342.075) (-1342.636) [-1341.912] * (-1343.055) (-1343.122) [-1342.391] (-1344.047) -- 0:01:07
      82000 -- (-1343.719) (-1341.608) (-1343.077) [-1342.444] * (-1343.998) [-1342.632] (-1341.468) (-1343.610) -- 0:01:07
      82500 -- (-1340.927) (-1341.647) [-1343.439] (-1342.161) * (-1343.532) (-1341.475) (-1341.705) [-1342.269] -- 0:01:06
      83000 -- [-1343.297] (-1341.191) (-1342.967) (-1345.257) * (-1339.954) [-1341.449] (-1345.773) (-1345.536) -- 0:01:06
      83500 -- (-1343.001) (-1343.409) (-1349.417) [-1346.498] * (-1342.293) (-1342.304) (-1342.707) [-1341.790] -- 0:01:05
      84000 -- (-1342.823) (-1346.413) (-1346.855) [-1348.045] * (-1343.351) (-1344.643) (-1343.224) [-1342.842] -- 0:01:05
      84500 -- (-1343.134) [-1342.780] (-1342.287) (-1352.649) * (-1343.630) (-1341.861) [-1345.291] (-1343.555) -- 0:01:05
      85000 -- (-1344.107) (-1346.823) [-1346.758] (-1343.607) * [-1343.156] (-1342.086) (-1342.871) (-1343.355) -- 0:01:04

      Average standard deviation of split frequencies: 0.051160

      85500 -- (-1344.087) (-1342.405) (-1345.932) [-1344.072] * (-1343.402) [-1341.902] (-1342.382) (-1342.943) -- 0:01:04
      86000 -- [-1343.754] (-1340.402) (-1342.164) (-1352.408) * (-1342.873) [-1343.167] (-1339.854) (-1341.353) -- 0:01:03
      86500 -- (-1343.551) (-1341.768) (-1342.439) [-1347.504] * (-1341.526) (-1349.944) [-1346.587] (-1342.655) -- 0:01:03
      87000 -- (-1342.326) (-1340.667) [-1345.540] (-1348.059) * (-1342.299) (-1341.873) (-1341.552) [-1342.630] -- 0:01:02
      87500 -- (-1342.556) (-1342.327) (-1344.246) [-1349.424] * (-1342.018) [-1343.031] (-1344.130) (-1342.670) -- 0:01:02
      88000 -- (-1341.715) (-1341.349) (-1348.802) [-1346.583] * (-1349.493) [-1345.735] (-1343.038) (-1342.734) -- 0:01:02
      88500 -- (-1342.934) (-1345.415) (-1347.847) [-1345.474] * (-1341.799) (-1342.896) [-1343.180] (-1342.827) -- 0:01:01
      89000 -- (-1343.418) (-1344.842) [-1345.330] (-1344.045) * (-1343.912) (-1343.013) (-1341.912) [-1343.432] -- 0:01:01
      89500 -- (-1341.866) [-1345.524] (-1343.544) (-1343.111) * (-1343.552) [-1343.239] (-1345.020) (-1345.692) -- 0:01:01
      90000 -- (-1342.995) (-1344.263) (-1345.835) [-1341.363] * (-1341.535) [-1344.856] (-1342.595) (-1343.031) -- 0:01:00

      Average standard deviation of split frequencies: 0.053828

      90500 -- (-1345.025) (-1342.767) (-1343.784) [-1340.790] * [-1342.214] (-1343.382) (-1341.131) (-1341.856) -- 0:01:00
      91000 -- (-1342.950) (-1342.212) (-1347.393) [-1345.868] * [-1340.390] (-1342.242) (-1347.249) (-1343.040) -- 0:00:59
      91500 -- (-1345.822) (-1341.455) (-1343.546) [-1348.725] * (-1343.635) (-1342.382) [-1344.295] (-1343.462) -- 0:00:59
      92000 -- [-1342.908] (-1342.036) (-1343.295) (-1344.575) * [-1344.500] (-1345.679) (-1343.801) (-1345.188) -- 0:01:09
      92500 -- (-1342.010) [-1341.853] (-1340.836) (-1348.303) * (-1345.082) (-1347.852) (-1343.959) [-1342.073] -- 0:01:08
      93000 -- [-1344.062] (-1341.860) (-1343.794) (-1351.132) * (-1344.313) (-1348.057) (-1344.011) [-1341.762] -- 0:01:08
      93500 -- [-1341.400] (-1345.027) (-1341.445) (-1353.516) * (-1342.890) (-1343.849) [-1345.055] (-1342.067) -- 0:01:07
      94000 -- [-1344.974] (-1347.834) (-1341.445) (-1343.313) * (-1343.752) (-1343.222) [-1345.639] (-1341.357) -- 0:01:07
      94500 -- (-1342.797) (-1343.528) (-1342.817) [-1347.274] * (-1342.582) (-1341.089) [-1343.771] (-1341.912) -- 0:01:07
      95000 -- [-1341.369] (-1343.091) (-1342.588) (-1346.038) * (-1341.367) [-1341.173] (-1342.974) (-1342.059) -- 0:01:06

      Average standard deviation of split frequencies: 0.054882

      95500 -- (-1343.128) (-1342.289) [-1342.739] (-1341.585) * (-1343.594) (-1343.084) [-1347.235] (-1342.136) -- 0:01:06
      96000 -- (-1343.458) (-1343.504) [-1342.428] (-1342.576) * (-1340.998) (-1343.155) [-1343.599] (-1343.752) -- 0:01:05
      96500 -- (-1343.347) (-1343.296) (-1341.603) [-1346.017] * (-1341.225) (-1342.994) [-1343.937] (-1341.737) -- 0:01:05
      97000 -- (-1343.424) (-1341.645) [-1341.583] (-1342.887) * (-1341.462) (-1342.125) [-1342.316] (-1341.582) -- 0:01:05
      97500 -- [-1345.248] (-1340.166) (-1340.651) (-1350.632) * (-1344.422) (-1342.096) [-1342.211] (-1343.065) -- 0:01:04
      98000 -- (-1343.545) (-1340.969) (-1341.301) [-1341.888] * (-1345.255) (-1341.991) (-1342.290) [-1345.327] -- 0:01:04
      98500 -- (-1340.671) [-1342.035] (-1341.534) (-1345.272) * (-1342.083) [-1342.539] (-1342.085) (-1344.763) -- 0:01:04
      99000 -- (-1342.672) (-1343.672) (-1341.505) [-1343.551] * [-1346.184] (-1344.231) (-1342.294) (-1342.302) -- 0:01:03
      99500 -- (-1345.333) (-1346.343) [-1342.623] (-1349.473) * (-1343.539) [-1342.247] (-1341.175) (-1343.431) -- 0:01:03
      100000 -- (-1347.243) (-1344.301) [-1341.293] (-1346.390) * [-1343.936] (-1341.991) (-1346.361) (-1342.330) -- 0:01:02

      Average standard deviation of split frequencies: 0.058379

      100500 -- (-1343.396) (-1341.761) (-1341.304) [-1348.163] * [-1344.478] (-1341.345) (-1341.736) (-1344.740) -- 0:01:02
      101000 -- (-1341.687) (-1342.654) (-1342.484) [-1343.369] * [-1342.797] (-1341.207) (-1347.778) (-1344.448) -- 0:01:02
      101500 -- (-1342.552) (-1341.989) (-1343.373) [-1351.509] * [-1342.486] (-1341.023) (-1343.608) (-1343.104) -- 0:01:01
      102000 -- (-1341.868) [-1342.779] (-1344.556) (-1347.586) * [-1341.157] (-1344.293) (-1343.674) (-1341.488) -- 0:01:01
      102500 -- (-1341.200) [-1341.875] (-1341.311) (-1345.080) * (-1348.758) (-1342.719) (-1342.962) [-1341.513] -- 0:01:01
      103000 -- (-1341.062) (-1346.764) (-1343.920) [-1341.933] * (-1343.735) (-1344.285) [-1341.788] (-1344.695) -- 0:01:00
      103500 -- (-1341.590) (-1344.377) (-1341.390) [-1345.106] * [-1342.266] (-1344.439) (-1341.839) (-1342.626) -- 0:01:00
      104000 -- (-1342.829) [-1343.271] (-1345.241) (-1339.732) * (-1342.249) (-1341.359) [-1342.562] (-1343.338) -- 0:01:00
      104500 -- (-1345.010) (-1341.920) [-1346.766] (-1346.041) * (-1342.064) [-1342.209] (-1339.745) (-1341.426) -- 0:00:59
      105000 -- (-1342.782) [-1340.797] (-1342.499) (-1345.993) * (-1342.486) (-1341.244) [-1343.463] (-1343.394) -- 0:00:59

      Average standard deviation of split frequencies: 0.051494

      105500 -- (-1342.180) [-1343.140] (-1342.602) (-1344.082) * (-1343.876) (-1342.029) [-1344.318] (-1344.981) -- 0:00:59
      106000 -- (-1344.900) [-1344.519] (-1342.601) (-1345.010) * (-1345.024) [-1341.230] (-1343.220) (-1343.337) -- 0:00:59
      106500 -- (-1345.948) (-1339.688) (-1342.771) [-1348.105] * [-1341.549] (-1342.350) (-1343.107) (-1344.482) -- 0:00:58
      107000 -- (-1342.855) (-1342.209) (-1348.443) [-1342.875] * [-1341.729] (-1341.157) (-1342.398) (-1343.279) -- 0:01:06
      107500 -- (-1345.176) [-1344.273] (-1344.592) (-1340.271) * (-1340.812) [-1341.848] (-1341.855) (-1342.160) -- 0:01:06
      108000 -- (-1343.332) (-1344.234) (-1342.863) [-1344.611] * (-1344.476) (-1342.441) [-1341.914] (-1341.265) -- 0:01:06
      108500 -- (-1344.539) (-1341.232) [-1342.526] (-1347.038) * (-1346.835) (-1344.966) (-1344.685) [-1342.577] -- 0:01:05
      109000 -- (-1341.944) (-1343.135) (-1345.017) [-1342.639] * (-1342.547) (-1345.366) (-1343.830) [-1340.955] -- 0:01:05
      109500 -- (-1341.921) (-1343.893) [-1344.222] (-1340.797) * (-1349.184) [-1341.684] (-1344.810) (-1341.157) -- 0:01:05
      110000 -- (-1342.382) (-1345.302) (-1342.249) [-1347.252] * [-1346.201] (-1343.780) (-1342.773) (-1342.533) -- 0:01:04

      Average standard deviation of split frequencies: 0.053121

      110500 -- (-1341.893) (-1345.300) (-1341.653) [-1349.963] * (-1351.780) (-1346.189) [-1342.617] (-1340.767) -- 0:01:04
      111000 -- (-1341.889) [-1345.256] (-1340.740) (-1350.345) * (-1342.556) (-1342.029) (-1339.554) [-1341.496] -- 0:01:04
      111500 -- (-1341.664) (-1342.221) (-1340.915) [-1351.368] * (-1342.769) [-1342.260] (-1343.498) (-1342.765) -- 0:01:03
      112000 -- (-1341.828) (-1343.790) (-1342.474) [-1348.280] * (-1341.376) (-1343.613) [-1341.843] (-1343.652) -- 0:01:03
      112500 -- (-1343.423) (-1344.165) (-1341.057) [-1341.256] * (-1340.900) (-1342.015) [-1342.914] (-1342.610) -- 0:01:03
      113000 -- (-1344.521) (-1341.775) [-1342.500] (-1346.025) * [-1341.780] (-1340.409) (-1343.542) (-1346.052) -- 0:01:02
      113500 -- [-1342.279] (-1341.978) (-1344.467) (-1344.937) * (-1341.537) [-1341.606] (-1341.151) (-1342.783) -- 0:01:02
      114000 -- (-1341.761) (-1344.578) [-1342.969] (-1343.753) * (-1341.128) (-1344.802) [-1342.001] (-1345.037) -- 0:01:02
      114500 -- (-1343.081) [-1341.774] (-1344.071) (-1344.875) * (-1344.245) (-1343.530) (-1341.479) [-1341.254] -- 0:01:01
      115000 -- (-1344.107) (-1340.257) [-1345.633] (-1344.607) * (-1344.678) (-1345.634) [-1341.369] (-1343.100) -- 0:01:01

      Average standard deviation of split frequencies: 0.056655

      115500 -- (-1341.777) (-1343.858) [-1342.286] (-1342.245) * (-1345.353) (-1345.408) [-1342.167] (-1345.633) -- 0:01:01
      116000 -- (-1341.744) (-1344.432) [-1344.093] (-1363.953) * (-1343.901) [-1343.836] (-1342.327) (-1341.103) -- 0:01:00
      116500 -- (-1343.254) (-1342.757) [-1342.384] (-1343.389) * (-1344.571) (-1341.623) [-1342.813] (-1342.525) -- 0:01:00
      117000 -- (-1341.712) [-1343.136] (-1345.745) (-1342.840) * (-1342.874) [-1343.195] (-1344.204) (-1342.339) -- 0:01:00
      117500 -- [-1342.702] (-1341.436) (-1344.132) (-1343.377) * (-1342.871) (-1347.506) [-1341.858] (-1342.356) -- 0:01:00
      118000 -- (-1340.941) [-1342.090] (-1344.503) (-1342.709) * [-1344.496] (-1345.115) (-1341.912) (-1341.584) -- 0:00:59
      118500 -- (-1344.187) [-1341.027] (-1342.679) (-1343.182) * (-1343.549) (-1341.602) (-1346.672) [-1341.049] -- 0:00:59
      119000 -- (-1341.653) [-1342.117] (-1341.965) (-1340.207) * (-1343.450) (-1341.635) [-1343.527] (-1346.522) -- 0:00:59
      119500 -- (-1342.893) [-1339.777] (-1342.339) (-1344.447) * (-1344.825) (-1341.258) (-1342.913) [-1343.009] -- 0:00:58
      120000 -- (-1341.753) (-1340.565) (-1342.103) [-1342.813] * (-1344.789) (-1344.899) (-1342.425) [-1344.462] -- 0:00:58

      Average standard deviation of split frequencies: 0.052306

      120500 -- (-1341.754) [-1341.779] (-1343.055) (-1345.504) * (-1343.787) (-1342.363) (-1342.112) [-1341.825] -- 0:00:58
      121000 -- (-1341.466) (-1340.941) [-1341.459] (-1342.277) * (-1341.867) (-1346.002) [-1344.718] (-1342.403) -- 0:00:58
      121500 -- (-1341.067) (-1341.821) (-1341.658) [-1341.843] * (-1342.041) (-1340.699) (-1348.192) [-1341.288] -- 0:00:57
      122000 -- (-1344.291) (-1344.111) (-1341.239) [-1341.165] * [-1343.925] (-1339.001) (-1342.127) (-1343.725) -- 0:00:57
      122500 -- (-1342.255) (-1342.713) (-1344.070) [-1342.239] * (-1343.406) [-1342.992] (-1343.994) (-1343.920) -- 0:01:04
      123000 -- (-1340.368) [-1344.165] (-1341.770) (-1341.155) * (-1342.767) (-1347.449) (-1342.587) [-1341.743] -- 0:01:04
      123500 -- (-1341.161) [-1342.464] (-1341.703) (-1349.178) * (-1342.703) (-1343.803) [-1340.865] (-1342.240) -- 0:01:03
      124000 -- (-1342.998) [-1344.616] (-1341.337) (-1352.728) * [-1341.815] (-1346.229) (-1342.386) (-1343.595) -- 0:01:03
      124500 -- (-1341.908) [-1342.637] (-1342.354) (-1346.906) * (-1341.054) [-1341.938] (-1344.064) (-1342.698) -- 0:01:03
      125000 -- (-1344.546) (-1343.695) [-1341.677] (-1344.076) * (-1342.013) (-1342.626) (-1342.338) [-1341.989] -- 0:01:03

      Average standard deviation of split frequencies: 0.048845

      125500 -- (-1344.733) [-1342.544] (-1342.415) (-1341.885) * (-1344.697) [-1342.056] (-1341.325) (-1342.503) -- 0:01:02
      126000 -- (-1341.357) (-1341.611) (-1341.757) [-1342.631] * (-1343.375) (-1341.084) [-1348.464] (-1341.510) -- 0:01:02
      126500 -- [-1339.103] (-1342.664) (-1341.372) (-1346.514) * [-1342.210] (-1345.093) (-1354.561) (-1342.283) -- 0:01:02
      127000 -- [-1340.814] (-1343.859) (-1348.857) (-1341.914) * [-1343.521] (-1345.067) (-1342.298) (-1341.833) -- 0:01:01
      127500 -- (-1343.879) (-1347.298) (-1342.765) [-1341.630] * [-1342.000] (-1343.316) (-1341.651) (-1343.057) -- 0:01:01
      128000 -- (-1345.240) (-1343.860) (-1341.354) [-1339.684] * (-1343.854) (-1341.450) (-1343.013) [-1341.558] -- 0:01:01
      128500 -- (-1343.358) [-1342.666] (-1342.886) (-1341.049) * (-1343.393) (-1344.168) (-1344.223) [-1341.362] -- 0:01:01
      129000 -- (-1343.213) (-1342.831) (-1341.792) [-1343.825] * [-1341.613] (-1341.148) (-1342.023) (-1343.668) -- 0:01:00
      129500 -- (-1341.635) (-1341.223) [-1343.588] (-1343.536) * (-1346.136) [-1341.447] (-1341.333) (-1343.733) -- 0:01:00
      130000 -- [-1342.108] (-1339.302) (-1341.840) (-1344.089) * (-1343.507) (-1340.627) [-1343.212] (-1344.371) -- 0:01:00

      Average standard deviation of split frequencies: 0.046700

      130500 -- [-1343.748] (-1341.380) (-1340.845) (-1346.635) * [-1343.204] (-1339.240) (-1343.889) (-1341.662) -- 0:00:59
      131000 -- (-1342.339) [-1341.308] (-1342.798) (-1342.620) * (-1342.461) (-1342.435) (-1340.852) [-1344.641] -- 0:00:59
      131500 -- (-1341.771) [-1342.102] (-1343.202) (-1342.376) * (-1342.789) (-1344.651) [-1342.280] (-1343.948) -- 0:00:59
      132000 -- (-1342.334) (-1341.450) (-1347.454) [-1344.048] * (-1341.875) (-1345.995) (-1343.558) [-1341.463] -- 0:00:59
      132500 -- (-1342.433) [-1340.365] (-1352.750) (-1342.050) * (-1340.686) (-1343.804) [-1343.853] (-1343.818) -- 0:00:58
      133000 -- (-1342.952) [-1340.529] (-1343.628) (-1342.994) * (-1344.498) (-1341.865) [-1343.373] (-1341.125) -- 0:00:58
      133500 -- (-1344.208) [-1343.088] (-1342.013) (-1343.218) * (-1343.398) (-1345.637) (-1343.769) [-1344.818] -- 0:00:58
      134000 -- [-1341.381] (-1341.470) (-1344.754) (-1342.432) * (-1344.925) [-1342.207] (-1346.136) (-1345.665) -- 0:00:58
      134500 -- (-1342.284) (-1343.109) [-1341.707] (-1342.064) * (-1343.991) (-1342.875) (-1347.356) [-1343.860] -- 0:00:57
      135000 -- (-1341.005) (-1342.343) [-1340.184] (-1342.908) * (-1345.120) (-1341.185) (-1346.366) [-1342.217] -- 0:00:57

      Average standard deviation of split frequencies: 0.048912

      135500 -- [-1339.882] (-1343.501) (-1344.524) (-1343.265) * (-1343.600) (-1342.490) (-1343.609) [-1342.765] -- 0:00:57
      136000 -- (-1341.031) [-1342.561] (-1340.518) (-1345.485) * (-1346.627) (-1344.976) (-1343.825) [-1343.315] -- 0:00:57
      136500 -- (-1345.232) [-1343.613] (-1342.094) (-1342.457) * [-1342.041] (-1344.015) (-1342.837) (-1342.121) -- 0:00:56
      137000 -- (-1341.531) [-1342.274] (-1341.821) (-1342.850) * (-1341.434) [-1343.109] (-1346.910) (-1343.812) -- 0:00:56
      137500 -- (-1343.559) (-1343.276) (-1345.790) [-1342.934] * (-1341.011) (-1343.596) (-1341.995) [-1340.833] -- 0:01:02
      138000 -- (-1344.873) (-1344.412) [-1343.696] (-1341.584) * (-1343.346) [-1344.086] (-1343.702) (-1341.443) -- 0:01:02
      138500 -- (-1342.944) [-1343.477] (-1342.585) (-1341.614) * (-1343.369) (-1344.503) (-1341.648) [-1340.877] -- 0:01:02
      139000 -- (-1344.503) [-1340.420] (-1340.701) (-1343.545) * (-1342.878) (-1343.031) (-1346.197) [-1342.000] -- 0:01:01
      139500 -- (-1341.413) [-1341.828] (-1340.317) (-1341.638) * (-1345.310) [-1343.480] (-1340.441) (-1344.054) -- 0:01:01
      140000 -- (-1343.139) (-1343.009) [-1340.841] (-1342.477) * [-1345.545] (-1341.427) (-1342.840) (-1342.580) -- 0:01:01

      Average standard deviation of split frequencies: 0.048328

      140500 -- (-1343.832) (-1344.646) (-1342.015) [-1342.000] * [-1343.408] (-1343.448) (-1342.879) (-1341.605) -- 0:01:01
      141000 -- (-1344.947) (-1343.343) (-1342.256) [-1341.724] * (-1342.424) (-1346.091) [-1338.751] (-1342.412) -- 0:01:00
      141500 -- (-1345.561) (-1343.215) [-1341.264] (-1346.252) * (-1342.146) (-1347.761) [-1345.207] (-1341.528) -- 0:01:00
      142000 -- (-1342.763) (-1341.156) [-1340.446] (-1341.977) * (-1339.958) (-1343.198) [-1342.163] (-1344.540) -- 0:01:00
      142500 -- (-1343.091) (-1341.567) (-1342.374) [-1343.275] * (-1342.197) (-1342.358) (-1341.866) [-1341.450] -- 0:01:00
      143000 -- [-1342.829] (-1344.367) (-1342.246) (-1343.482) * (-1341.679) (-1342.437) (-1342.590) [-1342.025] -- 0:00:59
      143500 -- (-1342.222) [-1341.397] (-1343.469) (-1347.558) * (-1346.017) (-1345.364) (-1341.963) [-1343.397] -- 0:00:59
      144000 -- (-1342.248) (-1342.698) [-1341.805] (-1343.830) * (-1343.669) (-1346.050) [-1343.279] (-1342.511) -- 0:00:59
      144500 -- (-1342.265) [-1342.660] (-1343.854) (-1343.272) * (-1344.321) [-1341.743] (-1342.025) (-1345.569) -- 0:00:59
      145000 -- (-1342.146) [-1343.807] (-1346.104) (-1344.234) * (-1342.691) (-1342.816) (-1343.823) [-1342.765] -- 0:00:58

      Average standard deviation of split frequencies: 0.046903

      145500 -- [-1341.538] (-1344.305) (-1345.674) (-1342.101) * (-1345.597) (-1342.070) (-1343.425) [-1342.620] -- 0:00:58
      146000 -- (-1343.038) [-1343.663] (-1342.841) (-1341.862) * [-1345.210] (-1345.770) (-1343.057) (-1343.880) -- 0:00:58
      146500 -- [-1342.984] (-1343.654) (-1341.613) (-1343.587) * (-1341.457) [-1344.003] (-1344.862) (-1339.165) -- 0:00:58
      147000 -- [-1343.167] (-1339.910) (-1343.322) (-1342.602) * (-1343.291) (-1340.696) [-1343.615] (-1343.001) -- 0:00:58
      147500 -- (-1342.650) [-1341.686] (-1342.365) (-1341.253) * [-1344.227] (-1343.926) (-1342.070) (-1342.278) -- 0:00:57
      148000 -- (-1341.839) (-1342.733) [-1339.561] (-1345.224) * (-1342.429) (-1341.780) (-1342.382) [-1339.944] -- 0:00:57
      148500 -- (-1342.460) (-1342.468) [-1343.207] (-1348.346) * [-1342.311] (-1343.715) (-1343.097) (-1342.186) -- 0:00:57
      149000 -- (-1342.514) [-1343.440] (-1341.429) (-1345.496) * (-1345.997) [-1342.693] (-1340.629) (-1343.191) -- 0:00:57
      149500 -- (-1345.535) [-1342.643] (-1340.315) (-1342.547) * (-1343.590) [-1343.489] (-1342.347) (-1341.612) -- 0:00:56
      150000 -- (-1343.516) [-1345.480] (-1342.119) (-1345.737) * (-1342.624) (-1344.480) (-1342.842) [-1342.358] -- 0:00:56

      Average standard deviation of split frequencies: 0.043638

      150500 -- (-1343.754) (-1345.556) [-1342.022] (-1343.245) * (-1342.606) (-1342.238) [-1342.825] (-1347.355) -- 0:00:56
      151000 -- [-1342.707] (-1343.385) (-1342.649) (-1344.793) * (-1341.979) [-1343.658] (-1340.632) (-1342.969) -- 0:00:56
      151500 -- (-1346.660) (-1345.986) [-1342.272] (-1344.301) * (-1342.299) (-1339.907) [-1341.268] (-1341.027) -- 0:00:56
      152000 -- (-1345.494) (-1342.542) [-1343.606] (-1346.249) * (-1342.451) (-1342.113) (-1341.751) [-1342.229] -- 0:00:55
      152500 -- (-1342.245) (-1345.283) (-1342.072) [-1342.688] * (-1343.514) (-1341.274) [-1341.925] (-1342.170) -- 0:01:01
      153000 -- (-1341.933) [-1341.732] (-1343.664) (-1344.986) * (-1344.058) [-1342.016] (-1342.489) (-1342.259) -- 0:01:00
      153500 -- (-1340.969) (-1345.321) (-1343.151) [-1344.392] * (-1343.070) (-1341.121) [-1341.448] (-1342.172) -- 0:01:00
      154000 -- (-1340.841) [-1342.130] (-1343.325) (-1342.152) * (-1343.184) [-1341.306] (-1343.670) (-1341.006) -- 0:01:00
      154500 -- [-1340.513] (-1343.900) (-1345.414) (-1342.177) * (-1343.889) (-1346.466) [-1341.889] (-1341.166) -- 0:01:00
      155000 -- (-1341.806) (-1344.113) (-1344.175) [-1340.410] * [-1342.727] (-1345.647) (-1342.574) (-1342.872) -- 0:00:59

      Average standard deviation of split frequencies: 0.040397

      155500 -- (-1340.611) (-1344.758) [-1342.111] (-1343.002) * (-1342.047) [-1342.533] (-1345.593) (-1342.911) -- 0:00:59
      156000 -- [-1341.958] (-1343.141) (-1342.214) (-1343.529) * (-1341.574) [-1342.511] (-1342.364) (-1345.589) -- 0:00:59
      156500 -- (-1344.836) [-1343.084] (-1341.879) (-1341.181) * (-1344.593) [-1343.082] (-1348.144) (-1342.981) -- 0:00:59
      157000 -- (-1343.730) [-1341.284] (-1345.264) (-1341.183) * (-1345.411) (-1341.712) (-1343.660) [-1344.935] -- 0:00:59
      157500 -- [-1343.886] (-1341.351) (-1341.379) (-1341.113) * (-1343.041) (-1346.337) [-1342.867] (-1342.482) -- 0:00:58
      158000 -- (-1343.120) (-1341.553) (-1341.341) [-1343.110] * (-1344.329) [-1344.664] (-1342.013) (-1341.742) -- 0:00:58
      158500 -- (-1344.405) [-1343.742] (-1339.912) (-1341.955) * [-1342.900] (-1344.586) (-1342.108) (-1341.449) -- 0:00:58
      159000 -- [-1340.352] (-1344.031) (-1341.432) (-1347.013) * (-1342.901) (-1344.697) [-1341.483] (-1341.609) -- 0:00:58
      159500 -- (-1342.412) [-1341.459] (-1342.267) (-1340.988) * (-1341.153) (-1344.736) [-1343.461] (-1341.765) -- 0:00:57
      160000 -- (-1343.672) (-1340.920) [-1340.976] (-1339.695) * (-1342.064) (-1341.233) [-1341.506] (-1347.005) -- 0:00:57

      Average standard deviation of split frequencies: 0.040099

      160500 -- (-1345.923) (-1342.504) [-1341.037] (-1342.600) * [-1342.451] (-1342.525) (-1340.816) (-1344.212) -- 0:00:57
      161000 -- (-1343.014) (-1342.774) [-1343.082] (-1345.444) * (-1342.036) (-1343.541) (-1340.096) [-1347.805] -- 0:00:57
      161500 -- (-1342.169) (-1346.020) [-1343.239] (-1346.570) * (-1342.155) (-1343.423) (-1345.464) [-1343.339] -- 0:00:57
      162000 -- (-1344.246) (-1341.887) (-1342.872) [-1343.195] * [-1341.257] (-1343.208) (-1343.245) (-1342.306) -- 0:00:56
      162500 -- (-1343.989) (-1341.849) (-1344.779) [-1342.837] * [-1342.954] (-1343.218) (-1344.367) (-1343.716) -- 0:00:56
      163000 -- (-1346.211) (-1341.305) (-1341.647) [-1342.636] * [-1342.074] (-1343.852) (-1342.121) (-1342.166) -- 0:00:56
      163500 -- (-1342.617) (-1342.284) (-1341.087) [-1343.227] * (-1341.534) (-1345.874) [-1347.652] (-1343.918) -- 0:00:56
      164000 -- (-1341.750) (-1340.938) [-1342.857] (-1343.384) * (-1343.318) (-1347.073) [-1343.608] (-1345.435) -- 0:00:56
      164500 -- (-1341.030) (-1342.339) [-1342.446] (-1345.774) * (-1339.617) [-1347.761] (-1347.495) (-1342.756) -- 0:00:55
      165000 -- (-1340.820) [-1343.886] (-1342.501) (-1344.706) * (-1342.297) (-1346.361) (-1344.189) [-1342.847] -- 0:00:55

      Average standard deviation of split frequencies: 0.037366

      165500 -- (-1340.697) (-1343.847) (-1347.560) [-1341.181] * (-1342.482) (-1351.847) (-1342.327) [-1341.329] -- 0:00:55
      166000 -- (-1341.710) (-1343.630) (-1343.948) [-1340.200] * (-1340.910) (-1350.096) [-1340.444] (-1342.413) -- 0:00:55
      166500 -- [-1342.411] (-1341.854) (-1342.274) (-1342.567) * [-1342.225] (-1341.897) (-1341.540) (-1343.039) -- 0:00:55
      167000 -- (-1341.823) (-1341.218) (-1343.183) [-1341.746] * (-1338.490) (-1343.545) [-1342.751] (-1343.586) -- 0:00:54
      167500 -- (-1339.614) (-1341.217) [-1344.032] (-1342.185) * (-1341.532) [-1341.111] (-1343.763) (-1342.208) -- 0:00:59
      168000 -- (-1342.879) [-1343.338] (-1343.746) (-1339.774) * (-1340.954) [-1341.301] (-1345.031) (-1342.114) -- 0:00:59
      168500 -- (-1341.462) (-1344.231) (-1346.573) [-1342.617] * (-1343.284) [-1341.400] (-1341.084) (-1341.238) -- 0:00:59
      169000 -- (-1341.265) [-1342.031] (-1338.709) (-1343.855) * (-1343.028) (-1342.521) (-1342.596) [-1341.900] -- 0:00:59
      169500 -- [-1341.742] (-1342.656) (-1344.151) (-1342.418) * (-1343.605) (-1346.366) [-1343.177] (-1341.515) -- 0:00:58
      170000 -- (-1343.098) (-1340.967) [-1345.264] (-1341.258) * (-1344.950) [-1342.892] (-1342.169) (-1344.230) -- 0:00:58

      Average standard deviation of split frequencies: 0.036925

      170500 -- (-1345.950) (-1344.580) [-1342.969] (-1341.372) * [-1348.265] (-1341.058) (-1341.121) (-1341.880) -- 0:00:58
      171000 -- (-1343.627) [-1342.642] (-1342.717) (-1342.429) * (-1344.915) (-1343.623) [-1342.984] (-1347.581) -- 0:00:58
      171500 -- [-1340.900] (-1341.526) (-1342.353) (-1342.005) * (-1340.857) [-1343.180] (-1342.806) (-1343.298) -- 0:00:57
      172000 -- [-1339.654] (-1341.001) (-1342.980) (-1344.842) * (-1342.268) (-1343.247) [-1339.743] (-1342.802) -- 0:00:57
      172500 -- (-1341.181) (-1341.041) [-1346.552] (-1347.673) * (-1343.992) (-1343.992) [-1343.825] (-1342.404) -- 0:00:57
      173000 -- [-1346.141] (-1341.597) (-1346.660) (-1343.586) * (-1343.280) [-1343.337] (-1341.261) (-1340.605) -- 0:00:57
      173500 -- (-1347.663) [-1342.249] (-1342.604) (-1345.012) * (-1342.612) (-1346.139) [-1342.630] (-1342.122) -- 0:00:57
      174000 -- (-1342.352) [-1345.513] (-1341.332) (-1342.560) * (-1343.516) [-1344.120] (-1344.151) (-1341.709) -- 0:00:56
      174500 -- (-1342.517) [-1343.155] (-1342.700) (-1343.821) * (-1343.427) [-1344.700] (-1340.955) (-1341.235) -- 0:00:56
      175000 -- (-1340.355) [-1341.967] (-1348.660) (-1343.887) * (-1343.232) (-1343.944) [-1339.519] (-1341.608) -- 0:00:56

      Average standard deviation of split frequencies: 0.036903

      175500 -- (-1342.810) (-1342.562) [-1341.864] (-1344.405) * (-1343.512) (-1342.246) [-1342.527] (-1344.268) -- 0:00:56
      176000 -- [-1343.644] (-1342.828) (-1342.015) (-1340.971) * [-1343.399] (-1342.887) (-1341.236) (-1342.187) -- 0:00:56
      176500 -- [-1341.983] (-1341.479) (-1341.506) (-1341.652) * [-1349.228] (-1343.490) (-1338.469) (-1341.746) -- 0:00:55
      177000 -- [-1341.777] (-1341.703) (-1341.571) (-1343.872) * [-1345.288] (-1345.157) (-1342.650) (-1342.659) -- 0:00:55
      177500 -- (-1342.921) (-1341.368) (-1341.952) [-1342.446] * (-1342.606) (-1344.188) [-1341.588] (-1343.556) -- 0:00:55
      178000 -- [-1342.071] (-1341.250) (-1342.272) (-1342.580) * (-1341.146) (-1343.605) [-1344.105] (-1344.159) -- 0:00:55
      178500 -- (-1342.299) (-1349.693) [-1341.369] (-1342.394) * (-1341.554) (-1344.388) [-1342.492] (-1345.397) -- 0:00:55
      179000 -- [-1341.771] (-1346.388) (-1343.282) (-1341.103) * (-1340.781) (-1348.156) [-1341.277] (-1344.279) -- 0:00:55
      179500 -- [-1342.025] (-1345.172) (-1341.969) (-1343.371) * [-1341.533] (-1344.292) (-1340.170) (-1344.268) -- 0:00:54
      180000 -- (-1341.488) [-1342.993] (-1342.237) (-1341.935) * (-1342.516) (-1345.379) (-1344.261) [-1341.398] -- 0:00:54

      Average standard deviation of split frequencies: 0.035225

      180500 -- (-1341.266) (-1344.460) (-1341.108) [-1340.469] * (-1341.406) (-1343.138) [-1340.968] (-1343.031) -- 0:00:54
      181000 -- (-1346.529) [-1341.309] (-1342.913) (-1338.143) * [-1340.770] (-1346.000) (-1342.796) (-1344.177) -- 0:00:54
      181500 -- (-1344.638) (-1340.898) (-1343.250) [-1343.820] * [-1344.939] (-1342.221) (-1344.630) (-1346.294) -- 0:00:54
      182000 -- (-1343.102) (-1343.825) [-1342.801] (-1340.062) * [-1344.714] (-1344.537) (-1343.547) (-1343.269) -- 0:00:53
      182500 -- (-1342.155) [-1343.086] (-1343.711) (-1341.729) * [-1342.102] (-1345.066) (-1344.133) (-1342.867) -- 0:00:58
      183000 -- [-1344.328] (-1341.571) (-1344.732) (-1341.629) * [-1342.755] (-1341.786) (-1344.329) (-1349.037) -- 0:00:58
      183500 -- (-1345.298) [-1342.032] (-1340.337) (-1340.735) * (-1344.814) (-1341.750) [-1344.407] (-1343.865) -- 0:00:57
      184000 -- [-1342.381] (-1341.553) (-1345.319) (-1340.653) * [-1347.053] (-1343.322) (-1344.388) (-1350.678) -- 0:00:57
      184500 -- (-1343.540) [-1341.868] (-1344.063) (-1343.549) * [-1347.484] (-1341.749) (-1344.117) (-1342.934) -- 0:00:57
      185000 -- (-1342.232) (-1343.767) (-1341.721) [-1343.268] * (-1345.745) [-1349.922] (-1347.191) (-1342.437) -- 0:00:57

      Average standard deviation of split frequencies: 0.032014

      185500 -- (-1341.729) [-1342.435] (-1342.981) (-1342.788) * (-1344.495) (-1344.967) (-1342.798) [-1342.753] -- 0:00:57
      186000 -- (-1340.941) (-1342.619) (-1341.514) [-1340.707] * [-1343.891] (-1341.289) (-1349.748) (-1345.982) -- 0:00:56
      186500 -- (-1342.031) (-1341.884) [-1341.433] (-1342.298) * (-1343.839) (-1341.303) (-1344.296) [-1342.700] -- 0:00:56
      187000 -- (-1345.335) [-1345.490] (-1343.900) (-1344.230) * (-1344.880) [-1342.915] (-1344.478) (-1342.154) -- 0:00:56
      187500 -- (-1347.196) [-1345.032] (-1346.844) (-1343.411) * (-1343.626) (-1340.293) (-1343.482) [-1341.779] -- 0:00:56
      188000 -- (-1342.746) (-1346.069) (-1343.006) [-1341.183] * (-1340.884) (-1342.784) (-1342.689) [-1341.566] -- 0:00:56
      188500 -- (-1343.718) (-1345.843) (-1341.610) [-1342.913] * (-1341.656) (-1344.748) (-1341.284) [-1341.949] -- 0:00:55
      189000 -- (-1345.249) [-1343.868] (-1341.035) (-1344.340) * (-1341.491) (-1347.466) [-1341.612] (-1341.301) -- 0:00:55
      189500 -- (-1342.289) [-1342.680] (-1342.565) (-1344.767) * [-1341.160] (-1341.758) (-1344.860) (-1343.048) -- 0:00:55
      190000 -- (-1341.876) (-1341.400) [-1343.015] (-1342.508) * (-1341.688) (-1343.520) (-1343.319) [-1341.088] -- 0:00:55

      Average standard deviation of split frequencies: 0.029409

      190500 -- (-1341.615) (-1341.703) (-1342.738) [-1343.659] * (-1342.739) (-1342.702) [-1343.063] (-1345.910) -- 0:00:55
      191000 -- (-1341.676) (-1341.487) (-1342.756) [-1342.631] * [-1342.002] (-1341.730) (-1344.116) (-1342.279) -- 0:00:55
      191500 -- (-1342.867) (-1346.771) (-1343.670) [-1346.533] * (-1343.955) (-1341.193) (-1347.765) [-1342.769] -- 0:00:54
      192000 -- (-1341.837) (-1343.493) [-1341.500] (-1346.872) * (-1342.026) (-1341.657) (-1343.748) [-1341.752] -- 0:00:54
      192500 -- [-1340.377] (-1346.175) (-1342.841) (-1345.292) * (-1347.456) (-1342.117) (-1343.303) [-1341.937] -- 0:00:54
      193000 -- [-1341.088] (-1348.541) (-1343.852) (-1341.696) * (-1341.438) (-1343.214) [-1342.914] (-1340.677) -- 0:00:54
      193500 -- (-1343.427) (-1343.450) (-1342.455) [-1344.257] * [-1343.381] (-1344.477) (-1343.154) (-1341.825) -- 0:00:54
      194000 -- (-1351.197) (-1342.453) [-1344.979] (-1341.153) * (-1342.876) [-1347.885] (-1342.335) (-1342.540) -- 0:00:54
      194500 -- (-1343.168) (-1341.561) [-1343.208] (-1343.521) * (-1341.393) [-1342.165] (-1341.789) (-1345.289) -- 0:00:53
      195000 -- (-1342.072) (-1342.342) [-1341.936] (-1342.243) * (-1344.483) (-1343.224) [-1341.295] (-1346.906) -- 0:00:53

      Average standard deviation of split frequencies: 0.028102

      195500 -- (-1342.277) (-1342.419) (-1341.886) [-1341.221] * (-1342.406) [-1343.903] (-1341.150) (-1341.804) -- 0:00:53
      196000 -- [-1345.097] (-1343.224) (-1342.845) (-1339.413) * (-1342.669) (-1344.116) (-1344.592) [-1341.536] -- 0:00:53
      196500 -- (-1345.019) (-1343.130) [-1343.546] (-1342.896) * (-1343.573) (-1348.032) (-1342.564) [-1340.947] -- 0:00:53
      197000 -- [-1346.669] (-1339.305) (-1343.700) (-1343.701) * (-1342.557) (-1345.181) [-1341.525] (-1342.795) -- 0:00:52
      197500 -- (-1343.839) (-1341.447) [-1342.562] (-1343.252) * (-1342.765) (-1341.797) [-1349.064] (-1342.183) -- 0:00:56
      198000 -- (-1342.128) (-1343.537) (-1342.693) [-1340.855] * (-1342.014) [-1344.318] (-1345.605) (-1340.928) -- 0:00:56
      198500 -- (-1343.585) (-1349.165) (-1343.809) [-1345.843] * (-1343.565) (-1344.675) (-1344.446) [-1341.191] -- 0:00:56
      199000 -- [-1343.924] (-1345.604) (-1343.667) (-1345.435) * (-1341.183) (-1347.998) [-1342.820] (-1340.404) -- 0:00:56
      199500 -- (-1343.549) (-1343.543) (-1342.027) [-1345.456] * (-1343.882) (-1343.555) [-1344.243] (-1342.395) -- 0:00:56
      200000 -- (-1342.658) (-1341.934) [-1343.574] (-1341.824) * (-1343.227) (-1349.336) (-1344.706) [-1342.601] -- 0:00:55

      Average standard deviation of split frequencies: 0.027720

      200500 -- (-1341.856) (-1341.267) (-1343.808) [-1341.374] * (-1342.120) (-1342.191) [-1341.744] (-1343.071) -- 0:00:55
      201000 -- (-1345.234) [-1341.506] (-1343.783) (-1340.984) * (-1341.960) (-1344.004) [-1342.891] (-1343.059) -- 0:00:55
      201500 -- [-1342.940] (-1341.674) (-1343.242) (-1342.739) * (-1341.573) [-1341.039] (-1344.834) (-1342.831) -- 0:00:55
      202000 -- [-1345.466] (-1343.248) (-1341.716) (-1342.915) * (-1341.739) (-1340.967) [-1341.687] (-1341.765) -- 0:00:55
      202500 -- (-1341.862) [-1344.291] (-1341.607) (-1346.463) * (-1342.020) (-1340.353) (-1345.002) [-1342.545] -- 0:00:55
      203000 -- (-1342.165) (-1344.099) (-1345.392) [-1342.717] * [-1342.313] (-1345.712) (-1341.053) (-1342.281) -- 0:00:54
      203500 -- [-1341.807] (-1342.261) (-1342.654) (-1342.449) * (-1342.506) (-1343.309) (-1344.020) [-1341.892] -- 0:00:54
      204000 -- (-1341.057) (-1343.017) (-1341.945) [-1343.504] * (-1344.266) [-1343.077] (-1345.207) (-1341.888) -- 0:00:54
      204500 -- (-1343.672) (-1342.405) (-1342.983) [-1342.559] * (-1342.787) [-1340.104] (-1342.130) (-1341.548) -- 0:00:54
      205000 -- (-1340.517) [-1340.899] (-1342.771) (-1342.444) * (-1343.336) (-1340.942) [-1340.145] (-1343.272) -- 0:00:54

      Average standard deviation of split frequencies: 0.025172

      205500 -- (-1342.089) [-1341.445] (-1342.296) (-1342.631) * (-1341.973) [-1345.262] (-1341.428) (-1341.325) -- 0:00:54
      206000 -- (-1344.007) (-1341.613) [-1342.688] (-1342.961) * (-1341.563) (-1341.190) [-1340.854] (-1341.494) -- 0:00:53
      206500 -- (-1342.263) [-1342.599] (-1344.393) (-1340.857) * (-1344.196) [-1339.320] (-1342.991) (-1345.720) -- 0:00:53
      207000 -- (-1344.649) [-1341.501] (-1341.781) (-1342.114) * (-1348.732) [-1342.962] (-1344.715) (-1345.538) -- 0:00:53
      207500 -- (-1345.153) (-1343.314) (-1341.423) [-1343.791] * (-1345.596) (-1342.754) (-1342.161) [-1340.812] -- 0:00:53
      208000 -- (-1342.492) [-1341.696] (-1341.059) (-1343.433) * (-1341.282) (-1347.108) (-1343.032) [-1342.539] -- 0:00:53
      208500 -- (-1343.549) (-1345.126) [-1341.695] (-1349.054) * [-1344.137] (-1345.496) (-1344.337) (-1340.205) -- 0:00:53
      209000 -- [-1344.091] (-1349.320) (-1341.170) (-1346.101) * (-1343.054) (-1346.739) (-1341.698) [-1341.435] -- 0:00:52
      209500 -- [-1342.715] (-1344.592) (-1342.112) (-1341.269) * (-1343.074) (-1341.804) [-1343.419] (-1345.099) -- 0:00:52
      210000 -- (-1345.329) [-1342.599] (-1342.242) (-1341.556) * (-1345.151) (-1342.056) (-1342.634) [-1344.847] -- 0:00:52

      Average standard deviation of split frequencies: 0.024379

      210500 -- (-1341.799) (-1346.324) [-1342.779] (-1341.478) * [-1345.011] (-1341.413) (-1343.121) (-1342.054) -- 0:00:52
      211000 -- (-1342.023) (-1342.862) [-1342.232] (-1341.788) * (-1344.357) (-1340.795) (-1342.876) [-1343.836] -- 0:00:52
      211500 -- (-1348.109) (-1342.255) (-1342.157) [-1344.974] * (-1344.333) (-1342.018) (-1341.546) [-1342.927] -- 0:00:52
      212000 -- [-1343.137] (-1341.936) (-1344.896) (-1345.782) * (-1342.172) (-1345.545) [-1341.947] (-1342.415) -- 0:00:52
      212500 -- [-1342.030] (-1341.262) (-1343.996) (-1342.915) * (-1342.070) (-1342.036) (-1342.401) [-1341.379] -- 0:00:55
      213000 -- (-1343.540) [-1341.653] (-1347.807) (-1341.479) * [-1342.877] (-1343.708) (-1342.759) (-1341.599) -- 0:00:55
      213500 -- (-1343.069) (-1342.838) (-1343.667) [-1340.252] * (-1342.542) (-1344.263) (-1343.151) [-1343.549] -- 0:00:55
      214000 -- (-1343.938) (-1342.864) (-1342.290) [-1341.836] * [-1342.145] (-1346.742) (-1342.115) (-1341.134) -- 0:00:55
      214500 -- (-1340.108) (-1342.388) [-1342.487] (-1341.908) * (-1342.720) (-1343.274) [-1344.043] (-1342.889) -- 0:00:54
      215000 -- [-1341.755] (-1342.646) (-1345.695) (-1343.443) * (-1343.760) [-1346.409] (-1344.961) (-1341.976) -- 0:00:54

      Average standard deviation of split frequencies: 0.023892

      215500 -- (-1342.693) (-1344.391) (-1344.111) [-1341.164] * (-1342.072) (-1342.118) [-1342.225] (-1342.303) -- 0:00:54
      216000 -- (-1347.324) [-1342.829] (-1342.114) (-1342.299) * [-1343.306] (-1342.470) (-1343.035) (-1343.337) -- 0:00:54
      216500 -- [-1341.703] (-1349.804) (-1345.480) (-1341.928) * (-1342.614) (-1343.320) (-1342.638) [-1342.202] -- 0:00:54
      217000 -- [-1341.458] (-1341.369) (-1341.972) (-1342.742) * (-1341.331) [-1343.266] (-1342.120) (-1342.947) -- 0:00:54
      217500 -- (-1346.098) (-1342.198) (-1346.153) [-1342.124] * (-1340.974) [-1341.434] (-1344.176) (-1344.326) -- 0:00:53
      218000 -- [-1341.437] (-1342.546) (-1344.601) (-1344.287) * (-1341.517) (-1342.840) (-1342.591) [-1344.191] -- 0:00:53
      218500 -- (-1344.144) [-1341.788] (-1345.096) (-1341.974) * (-1342.376) (-1341.115) [-1341.857] (-1341.765) -- 0:00:53
      219000 -- (-1343.629) [-1341.253] (-1343.022) (-1342.574) * (-1342.483) (-1342.349) (-1341.808) [-1341.765] -- 0:00:53
      219500 -- (-1347.131) [-1342.914] (-1343.005) (-1341.927) * (-1341.002) (-1345.492) (-1342.199) [-1343.821] -- 0:00:53
      220000 -- (-1341.731) (-1342.802) (-1342.029) [-1342.249] * (-1341.695) (-1343.991) (-1347.364) [-1343.888] -- 0:00:53

      Average standard deviation of split frequencies: 0.022600

      220500 -- (-1342.825) (-1344.603) (-1342.565) [-1342.137] * (-1343.301) (-1341.000) [-1346.649] (-1343.105) -- 0:00:53
      221000 -- (-1345.102) [-1344.434] (-1346.574) (-1344.161) * (-1342.236) (-1342.540) [-1343.519] (-1341.548) -- 0:00:52
      221500 -- (-1344.364) (-1342.942) (-1343.415) [-1344.370] * (-1341.867) [-1341.954] (-1342.463) (-1343.789) -- 0:00:52
      222000 -- [-1344.430] (-1342.720) (-1341.853) (-1341.370) * (-1341.951) (-1341.824) (-1342.891) [-1341.490] -- 0:00:52
      222500 -- (-1339.805) [-1343.194] (-1341.821) (-1341.634) * (-1344.938) (-1342.054) (-1343.635) [-1343.024] -- 0:00:52
      223000 -- [-1342.021] (-1348.819) (-1342.131) (-1341.915) * (-1342.916) [-1342.161] (-1341.954) (-1341.076) -- 0:00:52
      223500 -- (-1342.122) (-1342.214) [-1341.980] (-1343.668) * (-1342.545) (-1343.269) [-1341.954] (-1341.984) -- 0:00:52
      224000 -- [-1341.932] (-1342.052) (-1342.104) (-1342.149) * (-1342.971) (-1343.209) [-1341.040] (-1342.024) -- 0:00:51
      224500 -- [-1343.180] (-1344.685) (-1342.783) (-1342.134) * (-1344.050) (-1342.389) (-1344.640) [-1342.164] -- 0:00:51
      225000 -- (-1343.201) (-1343.899) (-1343.805) [-1344.682] * (-1343.553) (-1341.613) [-1341.779] (-1344.412) -- 0:00:51

      Average standard deviation of split frequencies: 0.022505

      225500 -- (-1341.958) (-1341.665) [-1344.112] (-1344.682) * (-1341.533) (-1340.844) (-1345.210) [-1342.947] -- 0:00:51
      226000 -- (-1345.243) (-1344.506) [-1342.357] (-1342.814) * [-1340.251] (-1340.051) (-1342.016) (-1344.430) -- 0:00:51
      226500 -- (-1343.401) [-1342.019] (-1342.927) (-1342.885) * (-1342.589) (-1343.096) (-1341.450) [-1344.242] -- 0:00:51
      227000 -- (-1341.925) (-1342.106) (-1341.873) [-1341.101] * (-1343.254) [-1342.038] (-1340.929) (-1342.671) -- 0:00:51
      227500 -- (-1340.841) (-1342.899) [-1342.553] (-1341.516) * (-1343.496) (-1341.806) [-1343.781] (-1345.745) -- 0:00:50
      228000 -- [-1344.178] (-1344.358) (-1342.984) (-1341.284) * [-1342.268] (-1344.462) (-1342.089) (-1341.895) -- 0:00:54
      228500 -- (-1344.962) [-1341.625] (-1342.491) (-1345.697) * [-1345.738] (-1342.580) (-1342.288) (-1342.796) -- 0:00:54
      229000 -- (-1342.583) [-1342.137] (-1345.400) (-1345.502) * (-1342.699) (-1345.015) (-1342.141) [-1343.227] -- 0:00:53
      229500 -- [-1342.080] (-1344.765) (-1345.574) (-1344.370) * [-1342.731] (-1344.782) (-1341.289) (-1342.168) -- 0:00:53
      230000 -- (-1341.725) (-1345.225) (-1344.344) [-1341.218] * (-1342.066) (-1343.335) (-1342.131) [-1341.455] -- 0:00:53

      Average standard deviation of split frequencies: 0.021458

      230500 -- (-1344.824) (-1342.667) (-1341.964) [-1341.026] * (-1342.875) (-1343.568) (-1342.784) [-1341.476] -- 0:00:53
      231000 -- [-1341.495] (-1341.039) (-1345.432) (-1342.052) * (-1342.579) (-1345.705) [-1344.018] (-1346.807) -- 0:00:53
      231500 -- (-1343.889) (-1345.291) (-1343.144) [-1342.320] * (-1340.070) (-1342.146) (-1343.540) [-1341.560] -- 0:00:53
      232000 -- (-1343.236) [-1342.956] (-1343.408) (-1342.827) * (-1340.740) (-1342.829) (-1343.025) [-1341.876] -- 0:00:52
      232500 -- (-1343.299) (-1342.417) (-1342.480) [-1342.244] * (-1341.946) (-1346.550) (-1342.186) [-1341.534] -- 0:00:52
      233000 -- (-1342.809) [-1341.520] (-1344.018) (-1342.724) * (-1340.516) (-1340.576) (-1343.563) [-1343.432] -- 0:00:52
      233500 -- (-1342.828) [-1342.191] (-1342.459) (-1342.224) * (-1342.345) [-1342.194] (-1345.529) (-1342.394) -- 0:00:52
      234000 -- (-1341.985) (-1347.540) [-1341.225] (-1343.636) * (-1343.416) (-1342.598) (-1342.796) [-1342.509] -- 0:00:52
      234500 -- (-1342.744) (-1341.737) (-1346.027) [-1341.265] * (-1344.257) [-1342.273] (-1343.856) (-1341.858) -- 0:00:52
      235000 -- (-1341.152) [-1343.584] (-1342.764) (-1343.347) * (-1342.754) (-1342.715) [-1341.932] (-1342.958) -- 0:00:52

      Average standard deviation of split frequencies: 0.021236

      235500 -- [-1341.359] (-1346.019) (-1340.820) (-1343.724) * (-1342.339) (-1342.229) (-1342.177) [-1343.270] -- 0:00:51
      236000 -- (-1343.440) (-1344.646) [-1340.987] (-1346.562) * [-1342.273] (-1342.368) (-1340.383) (-1342.963) -- 0:00:51
      236500 -- [-1342.430] (-1344.282) (-1342.772) (-1343.624) * [-1340.962] (-1343.030) (-1341.517) (-1344.300) -- 0:00:51
      237000 -- [-1343.146] (-1343.294) (-1347.698) (-1342.091) * [-1342.546] (-1343.859) (-1340.391) (-1343.506) -- 0:00:51
      237500 -- (-1343.711) [-1340.484] (-1346.426) (-1343.038) * (-1345.735) (-1342.163) [-1344.474] (-1341.650) -- 0:00:51
      238000 -- (-1342.692) (-1340.221) (-1341.674) [-1344.139] * (-1344.406) [-1341.655] (-1342.610) (-1342.557) -- 0:00:51
      238500 -- [-1343.249] (-1343.632) (-1340.794) (-1342.635) * (-1350.118) (-1342.023) [-1341.500] (-1343.052) -- 0:00:51
      239000 -- (-1342.948) (-1344.749) [-1342.733] (-1342.660) * (-1345.397) [-1341.309] (-1342.204) (-1341.814) -- 0:00:50
      239500 -- (-1341.152) [-1342.210] (-1343.743) (-1341.778) * (-1349.396) (-1341.507) [-1343.538] (-1339.062) -- 0:00:50
      240000 -- (-1342.004) (-1343.559) (-1344.721) [-1343.004] * (-1345.999) (-1341.799) (-1344.732) [-1341.383] -- 0:00:50

      Average standard deviation of split frequencies: 0.020825

      240500 -- [-1340.945] (-1348.088) (-1341.344) (-1344.167) * (-1341.326) (-1340.262) (-1347.657) [-1344.230] -- 0:00:50
      241000 -- (-1341.858) (-1346.594) [-1342.207] (-1346.373) * (-1343.592) [-1341.183] (-1344.501) (-1342.402) -- 0:00:50
      241500 -- [-1342.759] (-1345.482) (-1341.998) (-1344.474) * (-1344.040) (-1343.380) [-1342.024] (-1339.931) -- 0:00:50
      242000 -- (-1341.946) [-1344.277] (-1344.252) (-1347.681) * (-1344.789) (-1341.990) [-1348.800] (-1343.500) -- 0:00:50
      242500 -- (-1344.889) (-1341.438) (-1345.474) [-1347.766] * (-1344.459) (-1341.768) [-1340.527] (-1340.745) -- 0:00:49
      243000 -- (-1341.733) [-1342.867] (-1343.622) (-1342.313) * [-1343.607] (-1343.129) (-1345.818) (-1343.160) -- 0:00:52
      243500 -- (-1343.937) [-1344.819] (-1341.457) (-1343.029) * [-1343.279] (-1343.386) (-1342.637) (-1342.728) -- 0:00:52
      244000 -- [-1344.624] (-1342.971) (-1341.004) (-1348.114) * (-1341.579) (-1344.571) (-1342.642) [-1342.973] -- 0:00:52
      244500 -- [-1344.917] (-1346.188) (-1342.290) (-1347.147) * (-1341.335) (-1344.676) [-1341.739] (-1342.082) -- 0:00:52
      245000 -- (-1341.533) (-1343.739) [-1345.043] (-1345.541) * (-1340.395) [-1343.256] (-1348.014) (-1342.163) -- 0:00:52

      Average standard deviation of split frequencies: 0.020070

      245500 -- [-1342.830] (-1342.505) (-1343.694) (-1345.733) * [-1343.656] (-1342.064) (-1341.896) (-1346.621) -- 0:00:52
      246000 -- (-1342.921) [-1341.250] (-1346.518) (-1344.501) * (-1342.907) (-1344.639) (-1347.328) [-1342.882] -- 0:00:52
      246500 -- [-1342.338] (-1343.642) (-1341.320) (-1342.015) * (-1341.760) (-1346.672) [-1343.449] (-1344.193) -- 0:00:51
      247000 -- (-1341.993) (-1344.116) (-1341.034) [-1340.038] * (-1341.882) [-1345.313] (-1341.624) (-1340.928) -- 0:00:51
      247500 -- (-1342.590) [-1344.209] (-1343.146) (-1341.981) * (-1340.746) (-1342.156) [-1343.973] (-1341.624) -- 0:00:51
      248000 -- (-1342.770) (-1342.376) [-1341.008] (-1342.484) * (-1342.513) (-1341.777) (-1345.732) [-1338.589] -- 0:00:51
      248500 -- (-1343.951) (-1345.624) (-1340.990) [-1342.128] * (-1341.813) (-1342.255) (-1344.019) [-1339.148] -- 0:00:51
      249000 -- (-1346.335) (-1344.060) (-1341.163) [-1345.182] * (-1343.603) (-1345.446) (-1343.913) [-1342.016] -- 0:00:51
      249500 -- (-1343.685) (-1343.295) (-1340.961) [-1340.548] * [-1342.080] (-1342.919) (-1342.160) (-1340.918) -- 0:00:51
      250000 -- (-1341.819) [-1343.378] (-1341.273) (-1341.921) * (-1341.910) (-1342.752) [-1340.069] (-1340.195) -- 0:00:51

      Average standard deviation of split frequencies: 0.019895

      250500 -- (-1345.317) [-1342.380] (-1341.324) (-1341.847) * (-1346.572) (-1341.200) (-1342.838) [-1343.367] -- 0:00:50
      251000 -- (-1341.908) (-1341.551) (-1342.766) [-1342.029] * (-1343.955) [-1343.275] (-1343.246) (-1342.151) -- 0:00:50
      251500 -- (-1343.412) (-1341.154) (-1344.467) [-1341.867] * (-1342.570) (-1341.224) [-1341.781] (-1344.540) -- 0:00:50
      252000 -- (-1341.545) [-1341.507] (-1342.035) (-1341.951) * (-1342.989) (-1342.204) [-1342.478] (-1349.641) -- 0:00:50
      252500 -- (-1341.142) (-1341.654) (-1342.515) [-1341.190] * [-1342.740] (-1340.778) (-1342.729) (-1347.450) -- 0:00:50
      253000 -- (-1345.945) [-1341.156] (-1344.582) (-1341.340) * [-1342.778] (-1341.508) (-1344.099) (-1341.133) -- 0:00:50
      253500 -- [-1343.145] (-1345.441) (-1342.893) (-1342.274) * (-1344.623) (-1343.452) (-1343.653) [-1341.285] -- 0:00:50
      254000 -- (-1343.485) [-1346.035] (-1345.045) (-1341.589) * (-1341.222) (-1342.653) [-1342.566] (-1342.561) -- 0:00:49
      254500 -- [-1344.899] (-1345.067) (-1346.661) (-1341.476) * (-1344.058) (-1341.844) (-1343.649) [-1342.432] -- 0:00:49
      255000 -- (-1344.434) (-1343.369) [-1342.222] (-1342.607) * (-1341.696) (-1341.734) [-1342.946] (-1347.425) -- 0:00:49

      Average standard deviation of split frequencies: 0.019286

      255500 -- (-1343.192) (-1342.222) [-1344.878] (-1340.893) * (-1344.244) [-1340.996] (-1343.808) (-1345.908) -- 0:00:49
      256000 -- (-1341.831) (-1342.507) (-1342.171) [-1342.538] * (-1345.574) (-1342.987) (-1341.304) [-1344.134] -- 0:00:49
      256500 -- (-1342.550) (-1341.479) [-1341.504] (-1345.384) * (-1343.133) (-1342.780) (-1341.193) [-1340.682] -- 0:00:49
      257000 -- (-1344.781) (-1341.486) [-1340.509] (-1344.953) * [-1341.771] (-1340.941) (-1349.190) (-1342.642) -- 0:00:49
      257500 -- (-1342.483) (-1343.080) [-1344.020] (-1343.067) * (-1344.822) [-1341.587] (-1342.636) (-1342.646) -- 0:00:49
      258000 -- (-1342.557) (-1342.561) [-1341.458] (-1344.318) * [-1344.247] (-1341.440) (-1343.537) (-1342.232) -- 0:00:51
      258500 -- (-1343.330) (-1342.466) [-1342.219] (-1344.516) * [-1346.835] (-1343.443) (-1352.534) (-1343.540) -- 0:00:51
      259000 -- (-1345.959) [-1342.998] (-1341.992) (-1343.252) * (-1343.739) (-1342.283) [-1344.419] (-1343.915) -- 0:00:51
      259500 -- (-1347.587) (-1341.847) [-1342.877] (-1342.722) * (-1345.444) [-1342.015] (-1343.836) (-1342.176) -- 0:00:51
      260000 -- [-1342.756] (-1343.823) (-1344.930) (-1342.352) * (-1343.447) (-1342.735) [-1341.496] (-1343.151) -- 0:00:51

      Average standard deviation of split frequencies: 0.018751

      260500 -- [-1342.236] (-1342.872) (-1341.648) (-1342.940) * [-1342.563] (-1342.854) (-1343.114) (-1344.950) -- 0:00:51
      261000 -- (-1341.500) (-1341.732) [-1341.994] (-1346.175) * (-1341.323) (-1343.606) [-1344.345] (-1341.791) -- 0:00:50
      261500 -- [-1340.262] (-1342.971) (-1342.196) (-1341.609) * [-1341.737] (-1344.885) (-1342.111) (-1341.582) -- 0:00:50
      262000 -- (-1343.580) [-1340.854] (-1342.368) (-1341.712) * (-1343.090) [-1344.194] (-1342.404) (-1342.751) -- 0:00:50
      262500 -- (-1340.978) [-1341.945] (-1347.536) (-1340.956) * (-1344.452) (-1344.067) [-1341.954] (-1343.015) -- 0:00:50
      263000 -- (-1341.606) (-1351.892) [-1343.468] (-1344.432) * (-1342.023) (-1342.765) [-1342.059] (-1342.738) -- 0:00:50
      263500 -- (-1343.995) (-1342.040) (-1344.227) [-1342.054] * (-1341.226) (-1344.044) (-1342.360) [-1342.792] -- 0:00:50
      264000 -- (-1343.185) (-1342.837) (-1342.547) [-1342.089] * [-1341.473] (-1342.202) (-1341.860) (-1344.222) -- 0:00:50
      264500 -- [-1342.452] (-1345.719) (-1343.288) (-1341.921) * [-1338.948] (-1341.962) (-1343.698) (-1343.220) -- 0:00:50
      265000 -- [-1342.740] (-1342.080) (-1342.852) (-1340.816) * [-1339.767] (-1342.238) (-1340.472) (-1343.513) -- 0:00:49

      Average standard deviation of split frequencies: 0.018841

      265500 -- [-1342.175] (-1340.288) (-1345.980) (-1342.318) * (-1341.087) (-1342.927) (-1342.425) [-1341.667] -- 0:00:49
      266000 -- (-1342.520) (-1341.751) (-1344.488) [-1339.502] * [-1343.024] (-1343.716) (-1341.809) (-1341.867) -- 0:00:49
      266500 -- (-1344.221) [-1341.021] (-1346.887) (-1344.010) * (-1341.864) (-1344.933) [-1341.767] (-1343.965) -- 0:00:49
      267000 -- (-1343.523) (-1341.529) (-1345.651) [-1341.511] * (-1346.256) (-1344.370) (-1342.794) [-1340.971] -- 0:00:49
      267500 -- (-1343.094) (-1350.745) [-1342.293] (-1342.358) * (-1342.048) [-1344.127] (-1341.932) (-1342.746) -- 0:00:49
      268000 -- (-1341.789) [-1342.517] (-1342.437) (-1340.987) * [-1344.807] (-1341.414) (-1342.023) (-1346.325) -- 0:00:49
      268500 -- [-1344.942] (-1341.519) (-1342.511) (-1339.486) * (-1342.298) (-1343.463) [-1341.168] (-1347.041) -- 0:00:49
      269000 -- (-1343.160) [-1342.500] (-1340.058) (-1340.601) * [-1341.978] (-1344.086) (-1341.088) (-1347.404) -- 0:00:48
      269500 -- (-1342.250) (-1344.984) (-1340.020) [-1343.147] * (-1342.104) (-1348.120) [-1341.783] (-1345.056) -- 0:00:48
      270000 -- (-1345.606) [-1341.684] (-1345.664) (-1341.273) * (-1343.110) (-1345.359) [-1343.836] (-1352.642) -- 0:00:48

      Average standard deviation of split frequencies: 0.018608

      270500 -- (-1342.583) (-1342.160) [-1344.097] (-1340.922) * [-1343.324] (-1342.706) (-1343.417) (-1343.245) -- 0:00:48
      271000 -- (-1344.384) (-1342.827) [-1343.633] (-1342.019) * (-1342.201) (-1342.953) [-1343.745] (-1343.403) -- 0:00:48
      271500 -- (-1342.110) (-1344.584) [-1340.369] (-1341.311) * [-1341.493] (-1339.790) (-1345.377) (-1344.306) -- 0:00:48
      272000 -- (-1342.302) (-1343.122) [-1340.358] (-1341.563) * (-1341.439) (-1341.817) [-1344.108] (-1342.649) -- 0:00:48
      272500 -- (-1342.442) (-1342.511) (-1339.924) [-1340.686] * (-1344.901) (-1341.094) [-1342.867] (-1341.356) -- 0:00:48
      273000 -- (-1344.666) (-1342.569) (-1341.797) [-1341.227] * (-1342.161) (-1344.636) [-1343.326] (-1344.228) -- 0:00:47
      273500 -- (-1346.412) (-1342.103) [-1340.910] (-1343.187) * (-1342.052) (-1346.861) (-1344.442) [-1345.365] -- 0:00:50
      274000 -- (-1343.709) (-1343.369) [-1341.811] (-1342.553) * [-1345.502] (-1343.903) (-1343.349) (-1343.286) -- 0:00:50
      274500 -- (-1341.927) (-1344.145) (-1343.038) [-1345.330] * [-1343.030] (-1343.651) (-1344.842) (-1343.707) -- 0:00:50
      275000 -- [-1344.450] (-1341.468) (-1340.861) (-1347.520) * (-1339.144) (-1341.272) [-1343.723] (-1343.226) -- 0:00:50

      Average standard deviation of split frequencies: 0.018159

      275500 -- (-1343.883) [-1342.062] (-1342.707) (-1344.758) * [-1341.952] (-1341.668) (-1343.670) (-1341.194) -- 0:00:49
      276000 -- (-1344.477) (-1341.797) [-1341.600] (-1343.499) * (-1341.265) [-1342.647] (-1341.683) (-1343.796) -- 0:00:49
      276500 -- (-1344.935) (-1341.883) (-1345.605) [-1345.858] * (-1348.007) [-1342.368] (-1344.103) (-1341.664) -- 0:00:49
      277000 -- (-1343.700) (-1344.348) (-1343.002) [-1342.007] * [-1342.197] (-1343.579) (-1342.163) (-1342.291) -- 0:00:49
      277500 -- (-1342.518) (-1342.106) [-1345.252] (-1342.824) * (-1340.794) (-1343.270) [-1340.887] (-1340.343) -- 0:00:49
      278000 -- (-1344.131) (-1345.799) (-1341.765) [-1341.741] * [-1342.588] (-1344.230) (-1343.852) (-1341.887) -- 0:00:49
      278500 -- (-1342.091) (-1343.970) [-1341.468] (-1341.667) * (-1340.198) (-1344.332) (-1342.609) [-1344.757] -- 0:00:49
      279000 -- (-1343.182) (-1341.115) [-1340.474] (-1342.703) * (-1341.502) (-1342.648) (-1343.024) [-1343.094] -- 0:00:49
      279500 -- (-1342.954) (-1341.806) (-1342.861) [-1346.243] * [-1340.820] (-1341.006) (-1345.088) (-1342.105) -- 0:00:48
      280000 -- (-1345.910) [-1341.329] (-1342.231) (-1345.365) * (-1343.500) (-1341.272) [-1343.987] (-1342.263) -- 0:00:48

      Average standard deviation of split frequencies: 0.015863

      280500 -- (-1342.933) [-1342.918] (-1346.658) (-1348.224) * (-1343.554) (-1344.098) (-1342.308) [-1340.806] -- 0:00:48
      281000 -- (-1348.214) [-1344.193] (-1341.663) (-1342.239) * (-1342.347) (-1342.211) [-1341.751] (-1339.982) -- 0:00:48
      281500 -- (-1343.544) (-1342.425) [-1343.233] (-1341.404) * [-1344.738] (-1340.919) (-1341.640) (-1340.651) -- 0:00:48
      282000 -- [-1344.068] (-1341.955) (-1343.470) (-1341.903) * (-1342.919) (-1346.574) (-1343.837) [-1339.570] -- 0:00:48
      282500 -- (-1344.913) (-1346.721) [-1342.496] (-1342.040) * (-1343.683) [-1341.730] (-1341.628) (-1343.492) -- 0:00:48
      283000 -- (-1351.817) (-1345.488) (-1345.419) [-1342.160] * [-1339.789] (-1341.978) (-1342.020) (-1345.617) -- 0:00:48
      283500 -- [-1341.095] (-1342.314) (-1343.520) (-1343.813) * (-1341.992) (-1341.651) [-1344.641] (-1342.188) -- 0:00:48
      284000 -- (-1344.645) (-1343.889) (-1344.652) [-1344.018] * (-1343.036) [-1342.658] (-1344.937) (-1342.138) -- 0:00:47
      284500 -- (-1343.938) (-1345.193) (-1341.478) [-1342.798] * (-1346.005) [-1340.352] (-1344.186) (-1342.240) -- 0:00:47
      285000 -- (-1344.124) (-1342.930) (-1343.085) [-1340.842] * (-1342.251) (-1341.457) [-1342.354] (-1341.695) -- 0:00:47

      Average standard deviation of split frequencies: 0.015659

      285500 -- (-1342.529) (-1341.713) (-1343.493) [-1343.330] * (-1341.529) (-1341.724) [-1340.468] (-1342.239) -- 0:00:47
      286000 -- (-1343.436) (-1341.542) [-1343.672] (-1342.486) * [-1341.291] (-1343.211) (-1340.048) (-1342.289) -- 0:00:47
      286500 -- (-1344.765) (-1342.576) (-1344.721) [-1341.178] * (-1342.541) [-1341.581] (-1341.939) (-1341.666) -- 0:00:47
      287000 -- [-1344.032] (-1341.577) (-1345.793) (-1340.823) * (-1341.852) [-1339.764] (-1345.989) (-1341.761) -- 0:00:47
      287500 -- [-1347.047] (-1341.588) (-1345.431) (-1347.329) * [-1339.470] (-1342.055) (-1342.534) (-1341.545) -- 0:00:47
      288000 -- (-1348.842) [-1342.519] (-1352.122) (-1344.743) * (-1340.863) [-1343.142] (-1342.440) (-1343.200) -- 0:00:46
      288500 -- (-1346.075) (-1342.436) [-1343.619] (-1342.706) * (-1341.419) [-1341.753] (-1339.489) (-1342.973) -- 0:00:49
      289000 -- (-1341.385) (-1342.604) (-1347.167) [-1346.880] * (-1341.372) (-1343.088) [-1344.299] (-1340.981) -- 0:00:49
      289500 -- (-1344.172) (-1341.947) (-1343.525) [-1339.773] * (-1343.134) (-1346.717) (-1342.585) [-1340.693] -- 0:00:49
      290000 -- (-1342.409) (-1341.479) [-1340.316] (-1343.096) * (-1341.178) (-1344.675) [-1343.282] (-1344.201) -- 0:00:48

      Average standard deviation of split frequencies: 0.015768

      290500 -- (-1343.287) (-1343.944) [-1341.790] (-1344.047) * (-1342.121) (-1343.353) (-1345.328) [-1342.876] -- 0:00:48
      291000 -- (-1342.180) (-1346.710) (-1342.030) [-1339.856] * (-1347.075) [-1344.340] (-1340.692) (-1343.196) -- 0:00:48
      291500 -- (-1341.416) [-1341.683] (-1342.294) (-1343.348) * (-1344.767) [-1341.976] (-1342.772) (-1343.796) -- 0:00:48
      292000 -- (-1344.355) [-1342.997] (-1342.050) (-1341.217) * (-1341.801) (-1343.193) (-1341.892) [-1342.274] -- 0:00:48
      292500 -- (-1345.531) (-1342.714) (-1344.873) [-1340.909] * [-1343.409] (-1344.827) (-1342.897) (-1342.220) -- 0:00:48
      293000 -- (-1345.777) [-1342.747] (-1344.176) (-1344.909) * (-1343.535) (-1345.605) [-1341.725] (-1347.027) -- 0:00:48
      293500 -- [-1342.458] (-1342.635) (-1344.913) (-1343.174) * (-1343.266) (-1341.964) [-1341.955] (-1343.119) -- 0:00:48
      294000 -- (-1342.998) (-1345.403) [-1344.032] (-1345.158) * (-1341.708) [-1340.938] (-1344.956) (-1341.844) -- 0:00:48
      294500 -- (-1342.488) [-1342.425] (-1345.463) (-1340.959) * (-1345.163) (-1342.096) [-1343.072] (-1342.024) -- 0:00:47
      295000 -- (-1343.030) (-1342.190) (-1344.188) [-1338.943] * (-1342.039) (-1345.215) [-1340.217] (-1342.215) -- 0:00:47

      Average standard deviation of split frequencies: 0.014953

      295500 -- (-1343.344) (-1345.440) [-1342.216] (-1339.344) * (-1341.801) (-1344.391) (-1343.814) [-1343.645] -- 0:00:47
      296000 -- (-1343.373) (-1341.372) (-1341.618) [-1341.082] * (-1344.391) [-1342.326] (-1341.268) (-1346.341) -- 0:00:47
      296500 -- (-1344.328) (-1341.272) [-1342.902] (-1341.230) * (-1341.749) [-1341.596] (-1339.954) (-1345.458) -- 0:00:47
      297000 -- (-1344.507) (-1342.007) [-1341.771] (-1341.107) * (-1341.503) (-1343.940) (-1341.353) [-1345.221] -- 0:00:47
      297500 -- (-1343.181) [-1343.530] (-1343.947) (-1344.842) * (-1343.341) (-1345.265) [-1342.748] (-1343.732) -- 0:00:47
      298000 -- (-1343.390) (-1341.516) [-1343.962] (-1344.385) * (-1342.754) (-1344.592) [-1343.281] (-1342.537) -- 0:00:47
      298500 -- (-1343.002) (-1341.298) [-1343.093] (-1341.070) * (-1340.062) [-1347.356] (-1344.524) (-1345.430) -- 0:00:47
      299000 -- (-1343.373) (-1343.128) (-1343.632) [-1343.996] * (-1340.848) (-1344.170) (-1341.709) [-1345.383] -- 0:00:46
      299500 -- (-1342.613) [-1344.364] (-1339.890) (-1350.224) * (-1342.332) (-1341.905) [-1341.421] (-1346.030) -- 0:00:46
      300000 -- (-1342.216) (-1343.348) [-1341.760] (-1342.344) * [-1342.703] (-1347.171) (-1342.675) (-1343.640) -- 0:00:46

      Average standard deviation of split frequencies: 0.015853

      300500 -- [-1341.136] (-1342.560) (-1345.454) (-1342.016) * (-1340.071) (-1346.463) [-1342.549] (-1344.972) -- 0:00:46
      301000 -- (-1342.798) [-1343.231] (-1343.259) (-1340.319) * [-1340.834] (-1343.951) (-1341.258) (-1342.370) -- 0:00:46
      301500 -- (-1345.162) (-1342.775) (-1348.037) [-1344.015] * (-1342.437) (-1342.621) (-1342.644) [-1342.970] -- 0:00:46
      302000 -- (-1345.307) [-1342.875] (-1342.519) (-1343.915) * [-1342.261] (-1346.110) (-1344.110) (-1341.662) -- 0:00:46
      302500 -- (-1341.869) [-1343.715] (-1342.077) (-1345.245) * (-1345.940) (-1347.090) (-1342.642) [-1342.093] -- 0:00:46
      303000 -- (-1342.889) (-1342.271) [-1343.243] (-1346.098) * (-1344.925) [-1344.926] (-1342.209) (-1342.276) -- 0:00:46
      303500 -- (-1342.966) (-1346.316) [-1341.605] (-1343.295) * [-1341.521] (-1343.156) (-1341.726) (-1342.861) -- 0:00:48
      304000 -- [-1342.931] (-1347.176) (-1341.297) (-1342.284) * [-1343.674] (-1342.013) (-1343.020) (-1346.460) -- 0:00:48
      304500 -- (-1343.279) (-1342.240) [-1341.577] (-1344.611) * [-1344.988] (-1340.067) (-1341.122) (-1341.298) -- 0:00:47
      305000 -- [-1343.494] (-1344.305) (-1341.460) (-1347.391) * (-1343.957) (-1342.298) [-1343.530] (-1342.956) -- 0:00:47

      Average standard deviation of split frequencies: 0.015405

      305500 -- (-1348.248) [-1344.177] (-1341.484) (-1345.973) * (-1342.065) [-1342.875] (-1342.308) (-1348.213) -- 0:00:47
      306000 -- (-1343.543) (-1342.934) [-1344.028] (-1342.489) * (-1344.550) (-1342.748) (-1342.668) [-1342.461] -- 0:00:47
      306500 -- (-1342.092) (-1341.940) (-1343.268) [-1340.971] * (-1345.196) (-1340.415) [-1341.767] (-1341.101) -- 0:00:47
      307000 -- [-1341.693] (-1342.473) (-1345.260) (-1341.774) * [-1347.577] (-1341.571) (-1342.267) (-1341.034) -- 0:00:47
      307500 -- (-1341.621) [-1341.245] (-1342.708) (-1343.548) * (-1346.149) [-1343.333] (-1343.286) (-1343.007) -- 0:00:47
      308000 -- [-1342.050] (-1345.146) (-1343.646) (-1341.242) * (-1344.163) (-1342.606) [-1344.263] (-1346.140) -- 0:00:47
      308500 -- [-1341.159] (-1341.713) (-1343.616) (-1343.693) * (-1342.903) [-1342.921] (-1346.009) (-1343.747) -- 0:00:47
      309000 -- [-1341.933] (-1341.957) (-1343.544) (-1344.085) * (-1344.143) (-1343.442) (-1345.897) [-1341.026] -- 0:00:46
      309500 -- (-1341.957) [-1342.226] (-1344.061) (-1343.672) * (-1344.432) (-1342.217) (-1343.729) [-1340.601] -- 0:00:46
      310000 -- (-1342.219) [-1341.346] (-1342.492) (-1342.098) * [-1344.310] (-1342.665) (-1343.630) (-1342.350) -- 0:00:46

      Average standard deviation of split frequencies: 0.014668

      310500 -- (-1342.025) (-1342.679) (-1342.573) [-1344.639] * (-1345.051) (-1342.316) (-1342.760) [-1342.062] -- 0:00:46
      311000 -- [-1344.372] (-1340.632) (-1341.217) (-1341.857) * [-1341.921] (-1341.860) (-1342.455) (-1342.657) -- 0:00:46
      311500 -- (-1348.042) [-1343.075] (-1341.316) (-1341.887) * (-1342.755) (-1344.080) [-1341.739] (-1343.418) -- 0:00:46
      312000 -- [-1344.403] (-1342.196) (-1344.498) (-1342.418) * (-1343.215) [-1341.741] (-1348.386) (-1343.568) -- 0:00:46
      312500 -- [-1343.526] (-1341.010) (-1347.004) (-1342.941) * (-1344.354) (-1341.977) (-1342.000) [-1346.087] -- 0:00:46
      313000 -- [-1343.457] (-1343.538) (-1344.921) (-1346.627) * [-1344.249] (-1342.176) (-1342.576) (-1343.481) -- 0:00:46
      313500 -- (-1344.051) (-1342.908) [-1344.726] (-1345.106) * (-1344.780) [-1343.119] (-1341.769) (-1346.476) -- 0:00:45
      314000 -- [-1341.795] (-1342.291) (-1342.127) (-1343.207) * [-1340.712] (-1342.868) (-1341.560) (-1346.694) -- 0:00:45
      314500 -- (-1342.877) (-1342.186) [-1342.132] (-1345.516) * (-1342.695) (-1342.144) [-1345.321] (-1344.320) -- 0:00:45
      315000 -- (-1342.643) [-1343.977] (-1344.929) (-1339.453) * (-1341.141) (-1343.115) [-1343.117] (-1341.700) -- 0:00:45

      Average standard deviation of split frequencies: 0.013758

      315500 -- (-1343.829) (-1343.549) (-1342.377) [-1342.144] * (-1341.049) (-1342.523) [-1341.679] (-1342.330) -- 0:00:45
      316000 -- [-1346.169] (-1341.677) (-1343.202) (-1345.547) * (-1341.023) [-1344.034] (-1342.435) (-1347.981) -- 0:00:45
      316500 -- (-1344.407) (-1343.776) (-1344.946) [-1343.801] * (-1342.878) (-1341.750) [-1342.558] (-1345.002) -- 0:00:45
      317000 -- [-1341.634] (-1342.940) (-1343.534) (-1347.257) * (-1341.537) (-1341.831) (-1342.623) [-1343.159] -- 0:00:45
      317500 -- (-1344.135) (-1343.415) (-1347.782) [-1343.358] * (-1342.248) (-1342.041) (-1342.562) [-1342.225] -- 0:00:45
      318000 -- (-1343.032) [-1343.448] (-1345.879) (-1342.230) * (-1347.018) [-1348.003] (-1343.295) (-1341.763) -- 0:00:45
      318500 -- (-1343.894) [-1343.334] (-1341.767) (-1345.397) * (-1341.100) [-1341.261] (-1344.010) (-1341.643) -- 0:00:44
      319000 -- [-1343.204] (-1343.815) (-1342.207) (-1344.276) * [-1342.752] (-1341.320) (-1342.194) (-1342.187) -- 0:00:46
      319500 -- [-1342.689] (-1342.925) (-1342.468) (-1342.431) * [-1343.990] (-1342.225) (-1345.766) (-1342.154) -- 0:00:46
      320000 -- (-1343.491) (-1342.189) (-1344.222) [-1344.497] * (-1342.062) (-1342.408) [-1342.826] (-1342.045) -- 0:00:46

      Average standard deviation of split frequencies: 0.011434

      320500 -- (-1341.243) (-1341.316) (-1341.960) [-1344.961] * [-1342.299] (-1341.329) (-1347.226) (-1341.173) -- 0:00:46
      321000 -- (-1341.947) (-1341.472) (-1342.407) [-1344.126] * [-1341.939] (-1341.849) (-1342.450) (-1343.451) -- 0:00:46
      321500 -- [-1341.682] (-1342.811) (-1340.982) (-1344.520) * (-1341.583) (-1342.842) [-1341.536] (-1343.395) -- 0:00:46
      322000 -- (-1343.400) (-1343.137) [-1345.217] (-1343.960) * (-1343.797) (-1341.958) [-1342.949] (-1344.087) -- 0:00:46
      322500 -- [-1341.117] (-1341.552) (-1341.559) (-1340.401) * (-1341.816) (-1341.779) [-1341.306] (-1344.427) -- 0:00:46
      323000 -- [-1343.651] (-1341.778) (-1344.263) (-1341.784) * (-1342.800) [-1343.384] (-1342.033) (-1344.877) -- 0:00:46
      323500 -- (-1342.983) (-1340.446) (-1344.283) [-1342.075] * (-1342.379) (-1343.381) (-1340.911) [-1340.405] -- 0:00:46
      324000 -- (-1351.002) (-1342.224) [-1343.715] (-1342.199) * (-1343.265) [-1340.975] (-1345.042) (-1342.118) -- 0:00:45
      324500 -- (-1339.454) [-1343.813] (-1342.074) (-1344.198) * (-1347.981) (-1342.349) (-1341.461) [-1342.011] -- 0:00:45
      325000 -- (-1341.952) (-1342.962) [-1342.292] (-1342.279) * (-1343.246) (-1344.529) [-1340.020] (-1344.606) -- 0:00:45

      Average standard deviation of split frequencies: 0.011644

      325500 -- (-1344.571) (-1343.169) [-1345.001] (-1341.357) * [-1342.671] (-1341.630) (-1341.795) (-1343.605) -- 0:00:45
      326000 -- (-1343.768) (-1341.600) (-1344.147) [-1343.557] * (-1341.621) [-1340.196] (-1343.567) (-1344.731) -- 0:00:45
      326500 -- (-1342.262) (-1341.155) (-1342.993) [-1342.050] * (-1344.736) (-1341.593) (-1347.340) [-1343.246] -- 0:00:45
      327000 -- [-1345.316] (-1341.973) (-1341.307) (-1342.981) * (-1342.255) [-1342.088] (-1343.451) (-1346.527) -- 0:00:45
      327500 -- (-1344.896) (-1342.886) [-1342.413] (-1348.231) * [-1343.483] (-1344.765) (-1342.081) (-1341.468) -- 0:00:45
      328000 -- (-1341.369) [-1345.484] (-1342.071) (-1346.516) * (-1342.317) (-1344.009) [-1341.347] (-1342.873) -- 0:00:45
      328500 -- (-1340.759) (-1342.165) (-1342.281) [-1340.410] * (-1344.607) (-1345.680) (-1342.570) [-1343.208] -- 0:00:44
      329000 -- [-1341.097] (-1346.346) (-1344.890) (-1344.478) * (-1341.133) (-1344.889) (-1344.993) [-1341.922] -- 0:00:44
      329500 -- (-1343.278) (-1341.630) (-1342.547) [-1341.643] * (-1340.988) [-1344.286] (-1343.144) (-1342.973) -- 0:00:44
      330000 -- (-1343.113) (-1347.555) (-1340.659) [-1343.224] * (-1343.952) [-1342.106] (-1343.530) (-1344.804) -- 0:00:44

      Average standard deviation of split frequencies: 0.012039

      330500 -- (-1342.530) (-1343.422) [-1341.385] (-1341.886) * (-1342.842) [-1341.638] (-1343.777) (-1344.520) -- 0:00:44
      331000 -- (-1341.734) (-1341.808) (-1345.389) [-1343.796] * (-1342.070) [-1342.027] (-1344.759) (-1341.343) -- 0:00:44
      331500 -- (-1341.296) (-1343.284) (-1344.277) [-1341.572] * [-1343.732] (-1342.560) (-1344.951) (-1342.119) -- 0:00:44
      332000 -- [-1341.906] (-1342.279) (-1342.614) (-1341.327) * [-1344.272] (-1346.821) (-1341.734) (-1343.106) -- 0:00:44
      332500 -- (-1343.323) [-1342.230] (-1342.355) (-1343.313) * (-1343.653) (-1347.074) (-1344.465) [-1342.779] -- 0:00:44
      333000 -- (-1341.709) (-1346.117) (-1345.822) [-1342.938] * (-1341.602) [-1342.707] (-1342.575) (-1342.140) -- 0:00:44
      333500 -- (-1341.628) [-1343.232] (-1342.649) (-1340.038) * (-1342.472) (-1341.341) [-1341.521] (-1344.881) -- 0:00:43
      334000 -- (-1341.688) [-1344.657] (-1341.884) (-1344.250) * (-1343.113) (-1348.830) [-1341.716] (-1341.242) -- 0:00:45
      334500 -- (-1343.786) [-1343.263] (-1341.755) (-1345.220) * (-1344.321) [-1342.239] (-1341.730) (-1340.702) -- 0:00:45
      335000 -- (-1341.239) (-1346.583) (-1347.338) [-1341.136] * (-1343.034) [-1344.865] (-1341.221) (-1340.982) -- 0:00:45

      Average standard deviation of split frequencies: 0.013017

      335500 -- [-1342.045] (-1347.476) (-1342.417) (-1342.534) * (-1343.332) (-1344.661) (-1349.741) [-1341.465] -- 0:00:45
      336000 -- (-1344.731) [-1341.965] (-1347.217) (-1341.941) * (-1345.879) (-1348.785) (-1342.236) [-1341.464] -- 0:00:45
      336500 -- (-1343.107) (-1343.332) (-1341.644) [-1343.404] * (-1344.092) (-1341.191) [-1341.265] (-1343.041) -- 0:00:45
      337000 -- (-1343.196) (-1341.283) [-1340.347] (-1345.212) * (-1342.640) [-1344.881] (-1341.043) (-1341.809) -- 0:00:45
      337500 -- (-1342.587) (-1341.603) (-1344.178) [-1342.072] * [-1341.863] (-1343.715) (-1342.083) (-1344.244) -- 0:00:45
      338000 -- (-1341.804) (-1341.457) (-1346.587) [-1341.523] * (-1343.065) (-1344.733) (-1343.187) [-1342.320] -- 0:00:45
      338500 -- [-1343.430] (-1344.948) (-1344.709) (-1342.727) * [-1340.643] (-1342.697) (-1342.359) (-1343.866) -- 0:00:44
      339000 -- (-1341.393) (-1341.625) (-1344.203) [-1340.516] * (-1341.651) (-1341.642) [-1341.815] (-1341.852) -- 0:00:44
      339500 -- [-1342.058] (-1345.399) (-1342.534) (-1341.582) * (-1340.491) [-1341.602] (-1342.427) (-1343.781) -- 0:00:44
      340000 -- (-1342.809) (-1342.362) [-1343.350] (-1341.330) * [-1342.411] (-1345.365) (-1343.472) (-1341.756) -- 0:00:44

      Average standard deviation of split frequencies: 0.013761

      340500 -- (-1340.499) (-1347.415) (-1343.007) [-1344.870] * (-1340.071) (-1341.744) (-1344.333) [-1342.183] -- 0:00:44
      341000 -- (-1341.757) [-1344.297] (-1346.141) (-1344.287) * (-1346.001) [-1345.366] (-1341.642) (-1341.241) -- 0:00:44
      341500 -- (-1342.361) [-1342.145] (-1343.065) (-1341.829) * [-1340.251] (-1346.333) (-1343.426) (-1346.583) -- 0:00:44
      342000 -- (-1341.426) (-1341.448) (-1342.045) [-1341.251] * [-1341.588] (-1345.052) (-1342.907) (-1343.183) -- 0:00:44
      342500 -- (-1342.297) (-1342.860) [-1341.655] (-1343.082) * [-1344.043] (-1346.305) (-1345.269) (-1343.771) -- 0:00:44
      343000 -- (-1342.137) (-1342.579) [-1339.480] (-1341.698) * (-1343.941) (-1345.793) [-1342.782] (-1343.883) -- 0:00:44
      343500 -- (-1342.046) (-1341.309) (-1343.677) [-1343.403] * (-1341.316) (-1344.281) [-1344.231] (-1347.229) -- 0:00:43
      344000 -- (-1344.425) [-1341.667] (-1345.100) (-1342.605) * (-1341.028) [-1342.812] (-1342.135) (-1346.325) -- 0:00:43
      344500 -- [-1344.259] (-1343.018) (-1342.054) (-1341.960) * (-1341.222) [-1342.105] (-1345.363) (-1343.310) -- 0:00:43
      345000 -- (-1343.150) (-1345.942) [-1340.761] (-1344.866) * (-1341.118) [-1342.130] (-1344.003) (-1344.558) -- 0:00:43

      Average standard deviation of split frequencies: 0.014079

      345500 -- (-1341.398) [-1346.115] (-1349.170) (-1344.782) * (-1344.048) (-1341.652) (-1344.419) [-1347.248] -- 0:00:43
      346000 -- (-1344.610) (-1343.692) [-1346.233] (-1341.834) * [-1342.712] (-1343.111) (-1345.728) (-1346.448) -- 0:00:43
      346500 -- (-1341.608) (-1344.844) [-1341.169] (-1341.925) * (-1341.675) [-1342.910] (-1346.066) (-1341.477) -- 0:00:43
      347000 -- (-1345.568) [-1342.658] (-1341.604) (-1342.282) * (-1341.544) [-1344.308] (-1342.772) (-1341.487) -- 0:00:43
      347500 -- [-1346.114] (-1342.990) (-1340.277) (-1341.564) * [-1341.531] (-1342.198) (-1344.930) (-1342.303) -- 0:00:43
      348000 -- (-1341.915) (-1342.869) [-1343.821] (-1341.150) * (-1343.295) [-1341.236] (-1341.751) (-1340.868) -- 0:00:43
      348500 -- (-1344.059) (-1343.330) (-1340.740) [-1344.025] * (-1343.410) (-1344.169) (-1341.642) [-1342.790] -- 0:00:42
      349000 -- [-1344.614] (-1342.979) (-1341.750) (-1342.037) * [-1343.000] (-1346.535) (-1342.113) (-1342.577) -- 0:00:44
      349500 -- (-1344.329) (-1342.063) (-1341.654) [-1342.371] * (-1343.478) [-1344.371] (-1344.671) (-1342.931) -- 0:00:44
      350000 -- [-1342.212] (-1343.124) (-1343.318) (-1341.605) * (-1344.476) [-1347.342] (-1342.685) (-1344.546) -- 0:00:44

      Average standard deviation of split frequencies: 0.013368

      350500 -- (-1342.588) [-1342.367] (-1340.531) (-1339.596) * (-1344.029) (-1342.199) [-1343.574] (-1341.380) -- 0:00:44
      351000 -- [-1344.493] (-1343.337) (-1339.181) (-1341.661) * (-1343.381) (-1343.498) (-1343.579) [-1340.690] -- 0:00:44
      351500 -- [-1343.138] (-1343.742) (-1341.554) (-1342.314) * (-1345.621) [-1343.005] (-1343.227) (-1341.958) -- 0:00:44
      352000 -- (-1343.019) (-1340.504) (-1342.050) [-1340.582] * (-1344.787) (-1342.438) [-1343.735] (-1343.678) -- 0:00:44
      352500 -- (-1343.082) (-1341.008) (-1346.551) [-1343.081] * [-1342.560] (-1339.911) (-1344.089) (-1344.806) -- 0:00:44
      353000 -- [-1346.293] (-1349.055) (-1342.876) (-1343.601) * (-1345.022) (-1342.068) [-1339.840] (-1344.191) -- 0:00:43
      353500 -- (-1342.307) (-1342.201) (-1343.946) [-1342.376] * (-1343.894) (-1343.090) [-1341.515] (-1343.038) -- 0:00:43
      354000 -- (-1341.601) [-1343.336] (-1343.699) (-1342.436) * (-1342.225) [-1347.896] (-1342.682) (-1342.059) -- 0:00:43
      354500 -- (-1341.768) [-1340.246] (-1342.453) (-1342.265) * (-1342.265) (-1343.157) [-1342.535] (-1342.458) -- 0:00:43
      355000 -- (-1341.209) [-1342.530] (-1341.116) (-1343.298) * [-1344.251] (-1341.730) (-1342.526) (-1342.784) -- 0:00:43

      Average standard deviation of split frequencies: 0.012947

      355500 -- (-1342.909) (-1346.269) [-1341.279] (-1341.875) * [-1345.843] (-1341.771) (-1342.847) (-1342.513) -- 0:00:43
      356000 -- (-1342.972) (-1342.518) [-1341.531] (-1343.137) * (-1345.766) [-1342.544] (-1342.329) (-1343.242) -- 0:00:43
      356500 -- (-1342.589) [-1342.527] (-1340.543) (-1340.843) * (-1353.463) [-1341.425] (-1342.772) (-1342.161) -- 0:00:43
      357000 -- (-1340.956) (-1347.156) (-1344.008) [-1340.843] * (-1345.304) (-1346.084) (-1348.395) [-1340.358] -- 0:00:43
      357500 -- (-1342.490) [-1341.585] (-1343.518) (-1342.135) * [-1346.029] (-1345.133) (-1342.285) (-1340.237) -- 0:00:43
      358000 -- (-1343.839) (-1341.377) [-1343.729] (-1344.945) * (-1343.450) (-1345.200) (-1343.358) [-1342.684] -- 0:00:43
      358500 -- (-1344.114) (-1341.419) [-1342.566] (-1342.633) * (-1343.309) (-1343.354) (-1342.242) [-1341.210] -- 0:00:42
      359000 -- (-1342.497) (-1342.825) (-1341.791) [-1344.012] * (-1345.181) (-1343.451) (-1342.069) [-1344.031] -- 0:00:42
      359500 -- (-1340.775) [-1341.723] (-1340.391) (-1343.272) * (-1345.516) (-1341.983) [-1342.442] (-1349.274) -- 0:00:42
      360000 -- (-1340.375) [-1341.550] (-1342.511) (-1342.051) * (-1345.409) (-1341.464) (-1342.497) [-1341.208] -- 0:00:42

      Average standard deviation of split frequencies: 0.012199

      360500 -- (-1342.384) [-1343.062] (-1344.671) (-1341.556) * (-1342.066) (-1342.911) (-1345.192) [-1341.439] -- 0:00:42
      361000 -- (-1344.731) (-1342.400) (-1347.401) [-1346.204] * (-1342.065) (-1344.633) (-1343.295) [-1341.383] -- 0:00:42
      361500 -- [-1341.667] (-1341.968) (-1344.822) (-1342.842) * (-1343.258) (-1343.866) [-1340.089] (-1342.929) -- 0:00:42
      362000 -- (-1342.102) [-1344.162] (-1343.816) (-1342.866) * (-1341.743) (-1342.098) (-1342.603) [-1345.799] -- 0:00:42
      362500 -- (-1344.696) [-1342.576] (-1341.045) (-1342.172) * (-1343.996) (-1341.989) (-1341.010) [-1345.983] -- 0:00:42
      363000 -- [-1343.243] (-1342.167) (-1341.481) (-1344.388) * (-1344.292) [-1342.548] (-1341.518) (-1341.473) -- 0:00:42
      363500 -- (-1341.546) (-1342.652) (-1341.674) [-1343.593] * [-1342.759] (-1342.583) (-1341.355) (-1347.865) -- 0:00:42
      364000 -- (-1341.490) (-1344.625) [-1341.277] (-1343.859) * (-1342.195) (-1342.935) [-1342.728] (-1345.775) -- 0:00:41
      364500 -- (-1342.207) (-1341.477) [-1340.462] (-1342.122) * [-1345.413] (-1342.364) (-1345.274) (-1344.658) -- 0:00:43
      365000 -- (-1342.292) (-1342.054) [-1341.017] (-1339.781) * (-1343.336) (-1345.763) (-1344.399) [-1344.835] -- 0:00:43

      Average standard deviation of split frequencies: 0.013667

      365500 -- (-1342.412) (-1342.004) (-1343.131) [-1342.502] * [-1342.186] (-1342.035) (-1345.891) (-1344.367) -- 0:00:43
      366000 -- [-1344.303] (-1344.248) (-1340.638) (-1342.291) * [-1343.250] (-1342.289) (-1342.291) (-1342.328) -- 0:00:43
      366500 -- (-1345.086) (-1345.015) [-1340.699] (-1344.052) * [-1345.087] (-1341.608) (-1342.983) (-1342.289) -- 0:00:43
      367000 -- (-1344.861) [-1342.724] (-1338.696) (-1344.566) * [-1341.188] (-1341.944) (-1342.343) (-1343.605) -- 0:00:43
      367500 -- (-1341.814) (-1341.850) [-1341.718] (-1342.721) * (-1346.941) (-1343.809) (-1341.769) [-1343.504] -- 0:00:43
      368000 -- (-1343.061) (-1342.570) (-1342.001) [-1342.907] * (-1348.436) (-1348.007) (-1342.343) [-1343.105] -- 0:00:42
      368500 -- (-1344.519) (-1341.285) [-1342.025] (-1343.992) * [-1345.499] (-1344.977) (-1342.030) (-1345.101) -- 0:00:42
      369000 -- (-1344.938) [-1343.606] (-1344.226) (-1344.439) * (-1342.408) (-1346.803) (-1343.378) [-1342.076] -- 0:00:42
      369500 -- (-1345.024) [-1343.079] (-1341.141) (-1346.316) * (-1343.013) [-1345.003] (-1340.278) (-1342.153) -- 0:00:42
      370000 -- (-1341.634) (-1346.417) (-1342.637) [-1340.989] * (-1347.013) [-1342.986] (-1344.927) (-1344.634) -- 0:00:42

      Average standard deviation of split frequencies: 0.013636

      370500 -- (-1341.839) [-1342.976] (-1345.748) (-1344.673) * (-1348.080) (-1342.823) (-1344.996) [-1343.536] -- 0:00:42
      371000 -- (-1347.232) (-1343.003) [-1340.396] (-1346.084) * [-1341.634] (-1345.971) (-1343.724) (-1342.959) -- 0:00:42
      371500 -- (-1341.813) (-1343.674) [-1342.204] (-1343.973) * [-1342.096] (-1344.593) (-1343.424) (-1340.762) -- 0:00:42
      372000 -- (-1341.242) [-1344.206] (-1341.960) (-1344.113) * (-1348.318) (-1344.114) [-1345.418] (-1343.072) -- 0:00:42
      372500 -- (-1341.401) (-1342.804) [-1341.851] (-1343.990) * (-1341.655) (-1344.535) [-1344.692] (-1341.285) -- 0:00:42
      373000 -- (-1343.860) [-1341.693] (-1342.607) (-1340.072) * (-1348.164) (-1344.143) (-1343.373) [-1341.499] -- 0:00:42
      373500 -- (-1344.549) (-1341.516) [-1343.020] (-1341.154) * (-1342.357) (-1345.328) (-1343.026) [-1341.716] -- 0:00:41
      374000 -- (-1345.635) (-1341.672) (-1341.882) [-1342.920] * (-1343.403) (-1342.718) [-1342.249] (-1343.667) -- 0:00:41
      374500 -- [-1342.315] (-1345.086) (-1342.286) (-1340.926) * (-1343.075) [-1343.383] (-1343.319) (-1344.273) -- 0:00:41
      375000 -- (-1343.329) (-1343.004) [-1340.225] (-1342.845) * [-1342.454] (-1344.509) (-1342.595) (-1345.652) -- 0:00:41

      Average standard deviation of split frequencies: 0.013930

      375500 -- (-1341.670) (-1340.850) [-1341.433] (-1342.541) * (-1341.278) (-1342.867) (-1343.271) [-1344.254] -- 0:00:41
      376000 -- (-1341.698) (-1342.317) (-1343.312) [-1341.380] * (-1342.297) [-1342.906] (-1343.744) (-1343.604) -- 0:00:41
      376500 -- (-1341.521) [-1342.509] (-1341.389) (-1342.757) * (-1343.060) [-1341.950] (-1348.159) (-1340.678) -- 0:00:41
      377000 -- (-1341.313) (-1345.697) (-1343.261) [-1342.207] * [-1345.361] (-1344.296) (-1341.327) (-1341.506) -- 0:00:41
      377500 -- (-1342.553) [-1343.111] (-1344.317) (-1343.414) * (-1343.499) (-1342.181) (-1342.860) [-1341.719] -- 0:00:41
      378000 -- (-1341.494) [-1342.065] (-1341.826) (-1343.435) * [-1343.037] (-1340.797) (-1346.192) (-1340.510) -- 0:00:41
      378500 -- (-1341.978) [-1342.571] (-1346.898) (-1345.105) * (-1343.662) (-1341.685) (-1342.294) [-1341.693] -- 0:00:41
      379000 -- (-1344.721) [-1342.991] (-1340.278) (-1345.601) * [-1340.437] (-1342.315) (-1342.350) (-1340.400) -- 0:00:40
      379500 -- [-1343.089] (-1342.940) (-1343.499) (-1342.211) * (-1341.599) (-1345.521) [-1341.677] (-1341.440) -- 0:00:40
      380000 -- (-1342.609) (-1344.130) (-1343.648) [-1343.908] * (-1340.863) (-1342.582) [-1343.630] (-1342.547) -- 0:00:42

      Average standard deviation of split frequencies: 0.013897

      380500 -- (-1344.673) (-1342.868) (-1343.460) [-1343.517] * [-1342.329] (-1344.882) (-1341.419) (-1342.097) -- 0:00:42
      381000 -- (-1344.311) (-1343.840) [-1341.632] (-1342.531) * (-1342.818) [-1342.942] (-1342.855) (-1341.437) -- 0:00:42
      381500 -- (-1345.163) (-1341.667) (-1343.135) [-1342.930] * (-1344.121) [-1341.937] (-1343.232) (-1342.825) -- 0:00:42
      382000 -- (-1343.328) [-1341.880] (-1341.916) (-1341.169) * (-1342.336) (-1342.437) (-1343.979) [-1343.089] -- 0:00:42
      382500 -- [-1343.352] (-1345.105) (-1342.069) (-1343.104) * (-1346.962) (-1343.390) (-1345.259) [-1343.421] -- 0:00:41
      383000 -- (-1342.653) (-1340.201) (-1341.877) [-1341.745] * (-1342.891) (-1343.369) (-1344.753) [-1340.383] -- 0:00:41
      383500 -- (-1343.870) [-1338.757] (-1345.552) (-1343.072) * (-1341.812) (-1345.291) (-1344.901) [-1342.906] -- 0:00:41
      384000 -- (-1343.059) [-1345.909] (-1341.338) (-1345.191) * (-1343.523) [-1340.721] (-1344.282) (-1341.483) -- 0:00:41
      384500 -- (-1342.710) [-1343.031] (-1340.989) (-1342.778) * [-1344.110] (-1345.028) (-1342.215) (-1342.212) -- 0:00:41
      385000 -- (-1343.167) [-1343.518] (-1343.265) (-1342.558) * (-1345.206) (-1342.315) [-1344.585] (-1342.276) -- 0:00:41

      Average standard deviation of split frequencies: 0.013502

      385500 -- (-1342.411) (-1344.511) [-1343.752] (-1341.632) * (-1346.316) (-1340.131) (-1345.972) [-1341.114] -- 0:00:41
      386000 -- (-1342.836) (-1343.246) (-1342.547) [-1340.743] * [-1343.255] (-1342.034) (-1343.384) (-1343.291) -- 0:00:41
      386500 -- (-1342.015) [-1343.874] (-1340.452) (-1341.944) * (-1344.744) (-1343.020) [-1342.233] (-1348.469) -- 0:00:41
      387000 -- (-1342.161) (-1341.889) [-1341.023] (-1347.745) * (-1342.950) [-1340.485] (-1341.585) (-1349.715) -- 0:00:41
      387500 -- [-1341.816] (-1341.915) (-1343.875) (-1345.363) * (-1341.606) [-1341.997] (-1346.427) (-1342.408) -- 0:00:41
      388000 -- (-1347.148) (-1346.453) [-1345.685] (-1350.630) * [-1341.797] (-1344.231) (-1345.065) (-1341.074) -- 0:00:41
      388500 -- (-1347.632) [-1345.811] (-1346.389) (-1344.005) * (-1341.539) [-1341.789] (-1345.479) (-1343.785) -- 0:00:40
      389000 -- (-1342.770) [-1341.835] (-1347.797) (-1342.492) * (-1343.909) [-1342.470] (-1343.155) (-1345.056) -- 0:00:40
      389500 -- (-1346.365) [-1341.132] (-1345.693) (-1342.217) * [-1345.819] (-1341.113) (-1341.589) (-1342.720) -- 0:00:40
      390000 -- (-1341.675) (-1342.312) (-1344.709) [-1348.876] * [-1342.186] (-1341.212) (-1342.485) (-1343.158) -- 0:00:40

      Average standard deviation of split frequencies: 0.014011

      390500 -- (-1343.728) [-1345.837] (-1341.440) (-1348.680) * (-1341.495) (-1342.561) [-1343.326] (-1342.864) -- 0:00:40
      391000 -- (-1339.784) (-1340.649) (-1340.525) [-1341.278] * (-1341.897) [-1343.440] (-1343.415) (-1346.145) -- 0:00:40
      391500 -- (-1341.104) [-1344.321] (-1340.987) (-1341.785) * (-1341.497) (-1342.927) (-1341.862) [-1341.673] -- 0:00:40
      392000 -- (-1341.471) (-1344.763) (-1340.769) [-1341.196] * (-1343.458) (-1342.184) (-1341.722) [-1344.213] -- 0:00:40
      392500 -- (-1341.357) [-1341.553] (-1341.230) (-1342.831) * (-1344.262) [-1341.850] (-1343.348) (-1353.232) -- 0:00:40
      393000 -- (-1343.027) (-1350.930) [-1340.388] (-1344.112) * (-1346.130) (-1340.257) [-1341.841] (-1349.188) -- 0:00:40
      393500 -- (-1344.698) (-1346.170) [-1344.046] (-1344.009) * [-1343.495] (-1343.109) (-1342.465) (-1341.940) -- 0:00:40
      394000 -- (-1343.306) (-1343.395) [-1341.623] (-1343.409) * (-1345.488) (-1341.595) (-1343.128) [-1340.109] -- 0:00:39
      394500 -- [-1342.546] (-1342.699) (-1344.473) (-1343.892) * (-1341.771) [-1343.025] (-1340.650) (-1341.230) -- 0:00:39
      395000 -- [-1341.673] (-1341.859) (-1341.799) (-1345.231) * (-1344.863) (-1341.197) (-1342.134) [-1341.630] -- 0:00:41

      Average standard deviation of split frequencies: 0.014219

      395500 -- [-1341.254] (-1341.178) (-1343.089) (-1340.583) * (-1342.964) (-1341.190) (-1343.333) [-1340.789] -- 0:00:41
      396000 -- (-1340.532) (-1341.394) [-1341.853] (-1341.600) * (-1341.945) (-1343.160) (-1344.130) [-1342.711] -- 0:00:41
      396500 -- [-1340.979] (-1342.027) (-1340.978) (-1342.849) * [-1344.003] (-1343.976) (-1342.243) (-1344.223) -- 0:00:41
      397000 -- (-1341.951) (-1341.226) (-1345.296) [-1342.520] * [-1347.050] (-1343.222) (-1342.209) (-1342.756) -- 0:00:41
      397500 -- [-1343.095] (-1341.432) (-1345.613) (-1345.493) * (-1344.457) (-1340.877) (-1341.375) [-1340.961] -- 0:00:40
      398000 -- (-1342.976) (-1343.579) [-1340.310] (-1344.002) * (-1342.826) (-1342.068) (-1342.341) [-1341.560] -- 0:00:40
      398500 -- (-1341.989) (-1345.159) [-1341.818] (-1342.115) * (-1341.112) (-1344.995) [-1345.857] (-1342.441) -- 0:00:40
      399000 -- (-1341.541) (-1341.194) (-1343.479) [-1341.810] * (-1342.447) (-1345.602) (-1346.509) [-1341.695] -- 0:00:40
      399500 -- (-1340.978) (-1342.278) [-1343.808] (-1342.584) * (-1342.569) [-1341.579] (-1348.676) (-1341.239) -- 0:00:40
      400000 -- (-1341.604) (-1342.323) [-1347.797] (-1341.816) * (-1342.481) (-1346.289) [-1341.968] (-1341.545) -- 0:00:40

      Average standard deviation of split frequencies: 0.014380

      400500 -- (-1340.248) [-1344.688] (-1345.150) (-1345.452) * (-1344.153) (-1342.536) (-1341.857) [-1342.696] -- 0:00:40
      401000 -- (-1342.234) [-1342.569] (-1342.340) (-1347.679) * (-1341.997) (-1340.362) (-1341.259) [-1341.602] -- 0:00:40
      401500 -- (-1345.521) [-1341.351] (-1344.481) (-1344.719) * [-1343.468] (-1341.145) (-1344.575) (-1341.687) -- 0:00:40
      402000 -- [-1343.220] (-1341.531) (-1341.618) (-1342.632) * (-1344.938) (-1342.418) (-1342.268) [-1341.080] -- 0:00:40
      402500 -- (-1343.761) [-1341.629] (-1342.388) (-1346.534) * (-1345.437) [-1341.745] (-1342.076) (-1344.895) -- 0:00:40
      403000 -- (-1348.824) (-1343.426) (-1339.583) [-1344.310] * (-1340.416) [-1341.979] (-1341.731) (-1342.915) -- 0:00:39
      403500 -- [-1344.326] (-1343.140) (-1340.623) (-1341.691) * [-1345.303] (-1340.534) (-1339.943) (-1345.604) -- 0:00:39
      404000 -- (-1344.205) (-1347.448) [-1340.037] (-1342.134) * (-1344.753) (-1341.643) (-1341.707) [-1347.548] -- 0:00:39
      404500 -- (-1342.906) (-1345.223) [-1342.340] (-1342.018) * (-1343.446) [-1344.221] (-1344.390) (-1342.636) -- 0:00:39
      405000 -- [-1342.131] (-1342.539) (-1343.406) (-1342.764) * [-1343.340] (-1345.553) (-1346.729) (-1343.081) -- 0:00:39

      Average standard deviation of split frequencies: 0.014256

      405500 -- (-1344.314) (-1342.688) [-1341.360] (-1343.051) * (-1342.684) (-1343.563) (-1343.421) [-1343.991] -- 0:00:39
      406000 -- (-1346.794) [-1342.758] (-1341.837) (-1341.330) * (-1342.330) [-1344.137] (-1344.515) (-1343.667) -- 0:00:39
      406500 -- (-1343.035) (-1344.927) [-1340.273] (-1342.172) * (-1342.696) (-1342.254) [-1342.986] (-1342.610) -- 0:00:39
      407000 -- (-1342.614) (-1343.130) [-1341.276] (-1344.154) * (-1344.657) [-1341.947] (-1342.160) (-1344.803) -- 0:00:39
      407500 -- (-1341.814) [-1342.337] (-1343.212) (-1346.645) * (-1343.444) [-1343.495] (-1341.178) (-1342.069) -- 0:00:39
      408000 -- (-1341.719) (-1342.509) [-1342.857] (-1343.641) * (-1344.571) (-1341.492) [-1344.722] (-1346.152) -- 0:00:39
      408500 -- (-1343.009) (-1344.965) [-1342.052] (-1345.332) * (-1341.668) [-1342.180] (-1344.973) (-1341.621) -- 0:00:39
      409000 -- (-1342.393) [-1342.375] (-1343.320) (-1344.289) * (-1341.773) [-1340.157] (-1344.470) (-1342.062) -- 0:00:39
      409500 -- (-1342.550) (-1344.805) [-1339.914] (-1342.941) * (-1345.491) [-1343.333] (-1344.317) (-1343.215) -- 0:00:38
      410000 -- [-1340.267] (-1343.755) (-1340.923) (-1343.560) * (-1345.892) (-1346.577) (-1340.345) [-1341.242] -- 0:00:40

      Average standard deviation of split frequencies: 0.014349

      410500 -- [-1343.207] (-1343.975) (-1341.994) (-1343.056) * (-1341.685) [-1340.461] (-1342.694) (-1342.952) -- 0:00:40
      411000 -- (-1340.408) (-1341.661) [-1341.639] (-1342.422) * (-1345.752) (-1342.389) [-1344.592] (-1343.052) -- 0:00:40
      411500 -- (-1342.686) (-1342.957) (-1342.267) [-1343.027] * (-1345.415) [-1342.250] (-1343.140) (-1345.498) -- 0:00:40
      412000 -- (-1342.351) (-1341.366) [-1342.785] (-1343.283) * (-1343.528) (-1342.401) (-1343.749) [-1342.490] -- 0:00:39
      412500 -- (-1341.561) [-1341.924] (-1341.675) (-1342.900) * [-1346.091] (-1343.190) (-1349.168) (-1343.661) -- 0:00:39
      413000 -- (-1346.467) [-1343.544] (-1342.415) (-1342.517) * (-1346.263) (-1344.797) (-1341.408) [-1341.792] -- 0:00:39
      413500 -- (-1346.375) (-1343.765) (-1342.241) [-1342.107] * (-1345.341) (-1343.802) (-1342.530) [-1343.622] -- 0:00:39
      414000 -- [-1343.576] (-1341.508) (-1342.049) (-1341.217) * [-1341.467] (-1344.859) (-1341.496) (-1341.816) -- 0:00:39
      414500 -- [-1341.634] (-1340.608) (-1341.870) (-1344.758) * [-1341.319] (-1341.871) (-1340.377) (-1348.454) -- 0:00:39
      415000 -- (-1340.894) (-1341.767) [-1343.001] (-1341.832) * (-1347.088) (-1341.523) [-1339.849] (-1351.017) -- 0:00:39

      Average standard deviation of split frequencies: 0.014493

      415500 -- [-1344.028] (-1342.586) (-1342.279) (-1342.433) * (-1345.999) (-1342.357) [-1341.270] (-1341.998) -- 0:00:39
      416000 -- (-1345.216) (-1342.419) [-1342.111] (-1343.400) * (-1341.879) (-1341.875) [-1344.412] (-1345.525) -- 0:00:39
      416500 -- (-1341.676) (-1344.944) (-1342.700) [-1338.561] * [-1341.894] (-1343.635) (-1342.247) (-1343.403) -- 0:00:39
      417000 -- (-1347.104) (-1341.528) (-1343.839) [-1342.733] * [-1341.588] (-1343.138) (-1344.415) (-1343.296) -- 0:00:39
      417500 -- [-1343.538] (-1347.494) (-1344.306) (-1342.916) * [-1339.842] (-1342.695) (-1342.124) (-1341.674) -- 0:00:39
      418000 -- (-1344.876) [-1342.486] (-1342.704) (-1343.671) * (-1347.733) [-1342.079] (-1358.075) (-1341.692) -- 0:00:38
      418500 -- (-1344.079) (-1341.463) (-1344.303) [-1342.116] * [-1342.751] (-1341.120) (-1342.737) (-1344.422) -- 0:00:38
      419000 -- (-1346.319) [-1342.189] (-1341.150) (-1342.714) * (-1340.788) (-1341.557) [-1345.646] (-1343.478) -- 0:00:38
      419500 -- (-1343.991) (-1344.192) [-1342.059] (-1339.326) * (-1341.421) (-1344.255) [-1343.073] (-1342.042) -- 0:00:38
      420000 -- (-1343.322) (-1339.696) [-1343.489] (-1341.846) * (-1342.731) (-1343.004) (-1341.774) [-1343.319] -- 0:00:38

      Average standard deviation of split frequencies: 0.014096

      420500 -- (-1343.443) (-1345.745) [-1342.550] (-1341.115) * (-1345.683) (-1343.236) (-1343.139) [-1342.377] -- 0:00:38
      421000 -- (-1345.743) [-1345.390] (-1343.101) (-1341.311) * (-1343.685) (-1338.752) (-1347.035) [-1341.770] -- 0:00:38
      421500 -- (-1346.522) (-1341.675) (-1342.247) [-1341.034] * (-1342.412) [-1341.283] (-1343.114) (-1341.933) -- 0:00:38
      422000 -- [-1344.277] (-1341.994) (-1341.941) (-1341.043) * (-1343.208) [-1341.955] (-1341.548) (-1342.758) -- 0:00:38
      422500 -- [-1342.898] (-1339.459) (-1344.142) (-1343.455) * (-1342.296) [-1346.981] (-1343.030) (-1344.372) -- 0:00:38
      423000 -- [-1341.999] (-1344.401) (-1341.297) (-1341.942) * (-1341.493) (-1343.597) (-1342.157) [-1341.545] -- 0:00:38
      423500 -- (-1342.059) [-1347.443] (-1342.432) (-1343.458) * (-1340.418) [-1344.480] (-1342.049) (-1343.122) -- 0:00:38
      424000 -- (-1341.879) [-1342.503] (-1343.611) (-1345.565) * (-1343.682) (-1346.359) [-1341.929] (-1343.676) -- 0:00:38
      424500 -- (-1342.562) (-1345.328) [-1342.189] (-1341.702) * (-1344.007) (-1346.189) [-1342.749] (-1342.056) -- 0:00:37
      425000 -- [-1342.153] (-1343.080) (-1342.296) (-1342.920) * (-1342.114) (-1344.213) (-1342.042) [-1344.112] -- 0:00:39

      Average standard deviation of split frequencies: 0.013803

      425500 -- [-1342.699] (-1341.211) (-1345.145) (-1343.702) * (-1342.672) [-1343.010] (-1342.582) (-1346.279) -- 0:00:39
      426000 -- [-1341.519] (-1343.679) (-1344.844) (-1343.402) * (-1342.933) (-1343.242) [-1341.075] (-1343.648) -- 0:00:39
      426500 -- (-1345.413) (-1341.371) (-1342.437) [-1343.280] * [-1342.689] (-1341.595) (-1341.291) (-1343.035) -- 0:00:38
      427000 -- [-1343.096] (-1343.418) (-1341.593) (-1346.814) * (-1342.879) (-1342.097) (-1349.709) [-1341.117] -- 0:00:38
      427500 -- (-1342.726) (-1342.774) [-1342.459] (-1345.346) * [-1342.168] (-1344.697) (-1344.803) (-1345.981) -- 0:00:38
      428000 -- [-1343.377] (-1342.199) (-1343.839) (-1342.384) * [-1341.596] (-1342.593) (-1342.651) (-1343.615) -- 0:00:38
      428500 -- [-1343.949] (-1341.065) (-1343.633) (-1342.071) * (-1342.842) (-1342.472) [-1341.779] (-1342.606) -- 0:00:38
      429000 -- [-1344.862] (-1341.646) (-1343.433) (-1342.646) * (-1344.738) (-1344.349) (-1341.953) [-1341.885] -- 0:00:38
      429500 -- (-1344.280) (-1343.224) (-1342.807) [-1342.099] * (-1344.457) (-1341.877) (-1341.229) [-1343.503] -- 0:00:38
      430000 -- (-1343.442) [-1341.632] (-1343.671) (-1343.280) * (-1341.640) (-1341.358) [-1344.018] (-1344.383) -- 0:00:38

      Average standard deviation of split frequencies: 0.013999

      430500 -- (-1344.074) (-1340.740) (-1343.807) [-1342.101] * (-1344.448) (-1341.228) [-1349.092] (-1342.006) -- 0:00:38
      431000 -- [-1343.344] (-1341.512) (-1342.886) (-1352.759) * (-1342.444) (-1342.925) [-1345.260] (-1343.698) -- 0:00:38
      431500 -- [-1343.404] (-1343.010) (-1342.010) (-1345.818) * [-1342.142] (-1340.873) (-1341.503) (-1342.054) -- 0:00:38
      432000 -- (-1340.227) (-1342.191) [-1341.851] (-1344.097) * (-1342.754) (-1341.315) (-1344.107) [-1342.467] -- 0:00:38
      432500 -- (-1341.324) (-1341.385) [-1340.821] (-1343.691) * (-1341.588) [-1340.712] (-1347.339) (-1341.455) -- 0:00:38
      433000 -- (-1341.963) (-1340.975) [-1342.443] (-1343.110) * (-1352.082) (-1340.694) [-1339.979] (-1339.950) -- 0:00:37
      433500 -- (-1341.071) (-1341.763) (-1342.544) [-1342.684] * (-1347.400) [-1340.817] (-1343.520) (-1345.789) -- 0:00:37
      434000 -- (-1340.830) [-1343.374] (-1344.038) (-1342.419) * (-1346.906) (-1342.545) [-1344.427] (-1343.361) -- 0:00:37
      434500 -- (-1343.696) (-1345.350) [-1341.602] (-1342.677) * [-1341.167] (-1341.870) (-1344.505) (-1343.760) -- 0:00:37
      435000 -- (-1344.338) (-1341.637) [-1341.828] (-1341.610) * (-1342.136) (-1342.215) [-1342.762] (-1342.420) -- 0:00:37

      Average standard deviation of split frequencies: 0.013999

      435500 -- [-1344.573] (-1343.448) (-1345.073) (-1342.205) * (-1346.449) (-1342.346) (-1344.352) [-1343.459] -- 0:00:37
      436000 -- (-1343.434) (-1343.109) (-1342.172) [-1342.079] * (-1345.130) [-1343.505] (-1341.620) (-1345.289) -- 0:00:37
      436500 -- (-1344.812) (-1342.820) (-1344.507) [-1341.645] * (-1343.595) (-1343.210) (-1343.187) [-1340.493] -- 0:00:37
      437000 -- (-1343.514) [-1344.655] (-1342.922) (-1341.671) * [-1342.146] (-1341.922) (-1341.816) (-1344.043) -- 0:00:37
      437500 -- (-1341.433) (-1343.369) [-1341.843] (-1341.146) * [-1344.373] (-1342.431) (-1344.033) (-1342.486) -- 0:00:37
      438000 -- [-1343.001] (-1342.797) (-1342.857) (-1340.832) * (-1345.774) (-1345.536) [-1