--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:50:42 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0129/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0129/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0129/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/ML0129/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1716.25         -1720.02
2      -1716.18         -1721.10
--------------------------------------
TOTAL    -1716.21         -1720.70
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/ML0129/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0129/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0129/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.894947    0.093169    0.372931    1.503267    0.853848   1026.58   1263.79    1.001
r(A<->C){all}   0.163048    0.018491    0.000044    0.434508    0.127760    213.46    214.23    1.001
r(A<->G){all}   0.159362    0.017870    0.000132    0.430933    0.125531    140.47    207.21    1.001
r(A<->T){all}   0.166980    0.018814    0.000101    0.444641    0.131535    135.23    145.88    1.006
r(C<->G){all}   0.158910    0.017468    0.000033    0.419966    0.124273    244.83    287.91    1.000
r(C<->T){all}   0.182685    0.020283    0.000012    0.469788    0.152201    331.61    336.73    1.000
r(G<->T){all}   0.169015    0.020386    0.000039    0.457479    0.133293    152.13    192.48    1.005
pi(A){all}      0.203874    0.000126    0.182464    0.225639    0.203800   1106.19   1213.39    1.000
pi(C){all}      0.298371    0.000161    0.274030    0.323698    0.298175   1156.32   1222.68    1.000
pi(G){all}      0.298292    0.000168    0.272056    0.323756    0.298509   1283.45   1370.14    1.000
pi(T){all}      0.199463    0.000127    0.178901    0.222735    0.198971   1181.39   1260.78    1.000
alpha{1,2}      0.423928    0.242097    0.000185    1.444760    0.255609   1121.72   1204.04    1.001
alpha{3}        0.464273    0.248208    0.000174    1.415179    0.305505   1359.80   1401.41    1.001
pinvar{all}     0.998840    0.000002    0.996226    0.999999    0.999282   1146.86   1189.33    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1690.919954
Model 2: PositiveSelection	-1690.919836
Model 0: one-ratio	-1690.919943
Model 7: beta	-1690.919944
Model 8: beta&w>1	-1690.919844


Model 0 vs 1	2.1999999717081664E-5

Model 2 vs 1	2.3599999985890463E-4

Model 8 vs 7	1.999999999497959E-4
>C1
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS
>C2
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS
>C3
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS
>C4
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS
>C5
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS
>C6
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=418 

C1              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
C2              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
C3              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
C4              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
C5              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
C6              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
                **************************************************

C1              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
C2              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
C3              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
C4              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
C5              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
C6              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
                **************************************************

C1              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
C2              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
C3              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
C4              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
C5              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
C6              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
                **************************************************

C1              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
C2              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
C3              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
C4              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
C5              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
C6              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
                **************************************************

C1              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
C2              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
C3              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
C4              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
C5              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
C6              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
                **************************************************

C1              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
C2              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
C3              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
C4              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
C5              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
C6              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
                **************************************************

C1              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
C2              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
C3              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
C4              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
C5              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
C6              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
                **************************************************

C1              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
C2              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
C3              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
C4              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
C5              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
C6              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
                **************************************************

C1              LLTRLPSAGVVIGTTRLS
C2              LLTRLPSAGVVIGTTRLS
C3              LLTRLPSAGVVIGTTRLS
C4              LLTRLPSAGVVIGTTRLS
C5              LLTRLPSAGVVIGTTRLS
C6              LLTRLPSAGVVIGTTRLS
                ******************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  418 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  418 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [12540]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [12540]--->[12540]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.538 Mb, Max= 31.002 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
C2              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
C3              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
C4              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
C5              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
C6              MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
                **************************************************

C1              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
C2              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
C3              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
C4              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
C5              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
C6              ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
                **************************************************

C1              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
C2              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
C3              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
C4              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
C5              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
C6              CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
                **************************************************

C1              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
C2              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
C3              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
C4              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
C5              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
C6              VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
                **************************************************

C1              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
C2              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
C3              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
C4              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
C5              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
C6              EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
                **************************************************

C1              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
C2              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
C3              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
C4              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
C5              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
C6              AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
                **************************************************

C1              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
C2              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
C3              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
C4              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
C5              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
C6              AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
                **************************************************

C1              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
C2              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
C3              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
C4              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
C5              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
C6              RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
                **************************************************

C1              LLTRLPSAGVVIGTTRLS
C2              LLTRLPSAGVVIGTTRLS
C3              LLTRLPSAGVVIGTTRLS
C4              LLTRLPSAGVVIGTTRLS
C5              LLTRLPSAGVVIGTTRLS
C6              LLTRLPSAGVVIGTTRLS
                ******************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
C2              ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
C3              ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
C4              ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
C5              ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
C6              ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
                **************************************************

C1              CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
C2              CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
C3              CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
C4              CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
C5              CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
C6              CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
                **************************************************

C1              CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
C2              CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
C3              CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
C4              CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
C5              CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
C6              CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
                **************************************************

C1              GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
C2              GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
C3              GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
C4              GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
C5              GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
C6              GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
                **************************************************

C1              GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
C2              GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
C3              GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
C4              GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
C5              GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
C6              GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
                **************************************************

C1              TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
C2              TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
C3              TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
C4              TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
C5              TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
C6              TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
                **************************************************

C1              TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
C2              TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
C3              TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
C4              TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
C5              TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
C6              TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
                **************************************************

C1              TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
C2              TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
C3              TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
C4              TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
C5              TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
C6              TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
                **************************************************

C1              CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
C2              CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
C3              CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
C4              CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
C5              CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
C6              CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
                **************************************************

C1              GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
C2              GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
C3              GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
C4              GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
C5              GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
C6              GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
                **************************************************

C1              CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
C2              CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
C3              CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
C4              CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
C5              CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
C6              CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
                **************************************************

C1              GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
C2              GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
C3              GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
C4              GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
C5              GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
C6              GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
                **************************************************

C1              GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
C2              GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
C3              GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
C4              GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
C5              GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
C6              GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
                **************************************************

C1              CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
C2              CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
C3              CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
C4              CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
C5              CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
C6              CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
                **************************************************

C1              GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
C2              GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
C3              GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
C4              GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
C5              GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
C6              GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
                **************************************************

C1              GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
C2              GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
C3              GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
C4              GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
C5              GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
C6              GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
                **************************************************

C1              GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
C2              GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
C3              GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
C4              GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
C5              GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
C6              GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
                **************************************************

C1              CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
C2              CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
C3              CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
C4              CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
C5              CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
C6              CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
                **************************************************

C1              GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
C2              GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
C3              GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
C4              GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
C5              GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
C6              GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
                **************************************************

C1              GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
C2              GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
C3              GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
C4              GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
C5              GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
C6              GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
                **************************************************

C1              CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
C2              CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
C3              CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
C4              CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
C5              CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
C6              CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
                **************************************************

C1              CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
C2              CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
C3              CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
C4              CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
C5              CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
C6              CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
                **************************************************

C1              GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
C2              GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
C3              GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
C4              GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
C5              GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
C6              GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
                **************************************************

C1              TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
C2              TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
C3              TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
C4              TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
C5              TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
C6              TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
                **************************************************

C1              CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
C2              CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
C3              CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
C4              CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
C5              CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
C6              CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
                **************************************************

C1              GAGC
C2              GAGC
C3              GAGC
C4              GAGC
C5              GAGC
C6              GAGC
                ****



>C1
ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
GAGC
>C2
ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
GAGC
>C3
ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
GAGC
>C4
ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
GAGC
>C5
ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
GAGC
>C6
ATGAGCCCAGATAAGCGTGAGTTCGACATTGTTTTGTACGGCGCTACAGG
CTTCTCTGGCAAGTTGACCGCCGAACATCTCGCACTTAGCGAGTCCACAG
CACGGATCGCGCTGGCCGGCCGGTCAAGCGAACGGTTACGGAACGTGCGG
GCGCTGTTAGGCCCAAACGCACAGGACTGGCCGCTGATTGTCGCCGACGC
GTCACAACCGTCGACGCTCGAGGCGATGGCGGGTCGAGCCCAGGTGGTGC
TAACGACTGTTGGGCCGTATACGCGCTACGGACTGCCGCTGGTGGCGGCC
TGCGCGAGAACTGGAACGGACTATGCCGACTTGACCGGCGAACTGATGTT
TTGCCGAAACAGTATTGATTTGCACCACAAACAAGCAGCCGCCACTGGCG
CCCGGATAATCTTGGCGTGCGGATTCGATTCGGTCCCTTCAGATCTAAAC
GTTTACCAGCTGTACCGCCGGGTGATCGAAGACCGCACCGGTGAACTCTG
CGACACCGACCTTGTGCTTCGCTCGTTCTCTCAGCGCTGGGTTTCCGGTG
GCTCAGTTGCGGCATATTCGGAGGCAATGCTGACTACATCCAACGATCCC
GAGGCCCTTCGGCTCGTCACCGACCCATATACTCTGACCACAGACCGAGA
CGCCGAACCTGACCTGGGTCCGCAGCCAGACTTTCCCCGGCATCGAGGAA
GTGATCTGGCCCCCGAACTTGCCGGATTCTGGACCGGGGGATTTGTTCAA
GCCCAATTCAATACTCGAATTGTTCGGCGTAGCAATGCATTACAGAATTG
GTCCTATGGCCGGCAATTCCGATACTCAGAGACGATGAGTCTGGGCAAGT
CGTGGGCGGCACCAGTTGCTTCTGCAGCTGTCACCAGTGTTGTGGCTGGT
GCTGTCGGCTTGGGAAACAAGTATTTCAACCGATTACCCCGGCGGGTAGT
GGAACGCGTCACACCCAAATCAGGCACTGGTCCAAGCCGAAAAACTCAAG
CGCGGGGCCATTACACGTTCGAGACATACACCACGACAACCACCGGTGCA
CGCTATATGGCGACTTTCGCGCACAACGTTGACGCGTACAAGTCGACAGC
GGGGCTGCTTGCCGCAAGTGGTCTGACACTGGCGCTCGATCGCGATCGGC
TCTCCGAGCTGCGGGGTGTGCTTACTCCCGCCGCGGCGATGGGCGAGGCG
CTGCTGACGCGGCTCCCCAGCGCAGGCGTGGTCATAGGGACAACCCGGCT
GAGC
>C1
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS
>C2
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS
>C3
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS
>C4
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS
>C5
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS
>C6
MSPDKREFDIVLYGATGFSGKLTAEHLALSESTARIALAGRSSERLRNVR
ALLGPNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYTRYGLPLVAA
CARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVPSDLN
VYQLYRRVIEDRTGELCDTDLVLRSFSQRWVSGGSVAAYSEAMLTTSNDP
EALRLVTDPYTLTTDRDAEPDLGPQPDFPRHRGSDLAPELAGFWTGGFVQ
AQFNTRIVRRSNALQNWSYGRQFRYSETMSLGKSWAAPVASAAVTSVVAG
AVGLGNKYFNRLPRRVVERVTPKSGTGPSRKTQARGHYTFETYTTTTTGA
RYMATFAHNVDAYKSTAGLLAASGLTLALDRDRLSELRGVLTPAAAMGEA
LLTRLPSAGVVIGTTRLS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/ML0129/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1254 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579790956
      Setting output file names to "/data/3res/ML0129/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1080947219
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0033322036
      Seed = 1298617097
      Swapseed = 1579790956
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2806.511959 -- -24.965149
         Chain 2 -- -2806.511959 -- -24.965149
         Chain 3 -- -2806.511959 -- -24.965149
         Chain 4 -- -2806.511692 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2806.512120 -- -24.965149
         Chain 2 -- -2806.511959 -- -24.965149
         Chain 3 -- -2806.512120 -- -24.965149
         Chain 4 -- -2806.512120 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2806.512] (-2806.512) (-2806.512) (-2806.512) * [-2806.512] (-2806.512) (-2806.512) (-2806.512) 
        500 -- (-1743.956) (-1722.802) [-1723.599] (-1735.030) * (-1734.553) (-1724.677) (-1750.143) [-1728.834] -- 0:00:00
       1000 -- (-1738.408) (-1731.805) [-1720.591] (-1726.295) * (-1731.100) [-1727.744] (-1724.061) (-1726.509) -- 0:00:00
       1500 -- (-1729.966) (-1725.721) [-1720.597] (-1728.747) * (-1731.689) (-1724.743) (-1728.998) [-1725.235] -- 0:00:00
       2000 -- (-1723.523) (-1720.624) (-1729.598) [-1732.399] * (-1729.192) [-1726.878] (-1728.705) (-1730.052) -- 0:00:00
       2500 -- (-1727.930) (-1724.383) (-1729.462) [-1724.585] * [-1731.486] (-1730.553) (-1724.986) (-1725.811) -- 0:00:00
       3000 -- (-1724.976) (-1730.029) [-1729.226] (-1731.343) * (-1727.252) [-1727.327] (-1730.154) (-1729.067) -- 0:00:00
       3500 -- [-1724.879] (-1723.722) (-1726.256) (-1730.058) * (-1719.813) [-1722.031] (-1723.464) (-1724.816) -- 0:00:00
       4000 -- (-1729.310) (-1727.667) (-1729.381) [-1727.465] * (-1737.275) [-1721.560] (-1728.185) (-1722.446) -- 0:00:00
       4500 -- (-1728.683) [-1722.661] (-1723.339) (-1726.295) * [-1726.110] (-1726.814) (-1730.663) (-1735.718) -- 0:00:00
       5000 -- [-1726.400] (-1724.456) (-1723.454) (-1721.640) * (-1732.203) [-1721.556] (-1728.633) (-1728.511) -- 0:00:00

      Average standard deviation of split frequencies: 0.121422

       5500 -- [-1721.624] (-1728.454) (-1730.724) (-1728.595) * (-1730.215) [-1720.877] (-1726.137) (-1731.578) -- 0:00:00
       6000 -- (-1728.853) (-1728.431) [-1726.671] (-1725.323) * (-1727.336) [-1722.497] (-1719.527) (-1727.086) -- 0:00:00
       6500 -- [-1733.312] (-1723.052) (-1729.681) (-1724.852) * [-1720.577] (-1723.268) (-1728.694) (-1727.192) -- 0:00:00
       7000 -- (-1729.601) (-1727.170) (-1733.970) [-1726.324] * (-1726.618) [-1724.306] (-1722.799) (-1728.552) -- 0:00:00
       7500 -- (-1724.462) (-1725.780) [-1724.705] (-1733.211) * (-1732.979) (-1725.507) [-1723.567] (-1726.688) -- 0:00:00
       8000 -- (-1721.363) [-1724.953] (-1726.173) (-1734.049) * [-1721.543] (-1723.204) (-1723.370) (-1728.263) -- 0:00:00
       8500 -- (-1724.131) (-1722.674) (-1724.833) [-1728.301] * (-1728.462) (-1735.900) [-1728.799] (-1730.098) -- 0:00:00
       9000 -- (-1725.639) (-1717.873) [-1722.387] (-1736.897) * (-1730.051) (-1722.969) [-1723.145] (-1723.481) -- 0:01:50
       9500 -- [-1725.591] (-1716.871) (-1722.351) (-1730.187) * (-1723.636) [-1724.106] (-1726.005) (-1726.393) -- 0:01:44
      10000 -- (-1720.832) (-1716.871) (-1723.707) [-1721.042] * (-1733.107) [-1720.720] (-1726.251) (-1728.703) -- 0:01:39

      Average standard deviation of split frequencies: 0.073657

      10500 -- [-1724.304] (-1717.219) (-1727.008) (-1727.412) * (-1735.262) [-1724.406] (-1723.398) (-1723.056) -- 0:01:34
      11000 -- [-1730.207] (-1716.692) (-1722.199) (-1730.248) * (-1734.775) (-1729.230) (-1726.558) [-1725.859] -- 0:01:29
      11500 -- [-1723.838] (-1714.952) (-1722.339) (-1728.583) * [-1717.791] (-1723.164) (-1724.104) (-1725.631) -- 0:01:25
      12000 -- (-1724.087) (-1720.154) [-1730.738] (-1720.501) * [-1727.127] (-1720.176) (-1726.682) (-1724.175) -- 0:01:22
      12500 -- [-1735.064] (-1716.380) (-1724.042) (-1726.096) * (-1726.993) (-1723.179) [-1726.473] (-1725.179) -- 0:01:19
      13000 -- (-1721.566) (-1717.227) [-1722.170] (-1729.814) * (-1726.271) (-1725.279) [-1722.104] (-1728.882) -- 0:01:15
      13500 -- (-1719.173) (-1716.243) (-1729.507) [-1727.604] * [-1727.943] (-1727.460) (-1729.541) (-1723.718) -- 0:01:13
      14000 -- (-1720.630) [-1715.703] (-1726.113) (-1727.476) * (-1723.011) (-1730.724) [-1723.308] (-1731.353) -- 0:01:10
      14500 -- (-1722.208) (-1718.452) [-1728.417] (-1728.709) * (-1728.241) [-1724.173] (-1724.975) (-1722.453) -- 0:01:07
      15000 -- [-1721.461] (-1718.280) (-1720.834) (-1726.878) * (-1724.293) [-1732.710] (-1731.685) (-1721.326) -- 0:01:05

      Average standard deviation of split frequencies: 0.051172

      15500 -- (-1715.338) (-1718.899) [-1720.755] (-1719.396) * [-1723.628] (-1724.854) (-1730.550) (-1733.866) -- 0:01:03
      16000 -- (-1715.379) (-1717.701) (-1725.299) [-1719.993] * (-1726.684) (-1725.079) (-1728.202) [-1734.015] -- 0:01:01
      16500 -- [-1715.796] (-1718.910) (-1732.150) (-1718.576) * (-1726.394) (-1726.072) [-1721.614] (-1724.681) -- 0:00:59
      17000 -- (-1717.024) (-1717.651) [-1732.079] (-1720.598) * (-1731.780) (-1730.901) (-1731.418) [-1722.943] -- 0:00:57
      17500 -- (-1714.720) (-1719.084) [-1729.373] (-1721.618) * (-1731.497) [-1725.728] (-1728.062) (-1728.532) -- 0:00:56
      18000 -- [-1715.690] (-1720.339) (-1722.252) (-1722.731) * (-1731.703) [-1721.768] (-1728.662) (-1727.124) -- 0:00:54
      18500 -- (-1719.026) (-1721.346) [-1725.672] (-1724.872) * (-1731.930) (-1726.755) (-1722.841) [-1728.581] -- 0:00:53
      19000 -- (-1715.387) [-1717.145] (-1721.680) (-1723.498) * (-1735.611) (-1724.429) (-1727.310) [-1729.791] -- 0:00:51
      19500 -- [-1715.337] (-1715.594) (-1721.971) (-1726.990) * (-1729.524) (-1735.948) (-1725.364) [-1721.310] -- 0:00:50
      20000 -- [-1716.552] (-1715.625) (-1724.199) (-1720.095) * (-1726.669) (-1728.886) [-1730.016] (-1727.656) -- 0:00:49

      Average standard deviation of split frequencies: 0.048303

      20500 -- (-1718.286) [-1715.884] (-1734.084) (-1721.382) * [-1722.218] (-1721.328) (-1727.729) (-1724.405) -- 0:00:47
      21000 -- (-1715.122) (-1715.301) (-1722.655) [-1717.541] * (-1726.553) [-1723.330] (-1719.679) (-1731.315) -- 0:00:46
      21500 -- (-1716.473) [-1717.329] (-1730.347) (-1718.419) * [-1725.727] (-1718.101) (-1725.699) (-1727.501) -- 0:00:45
      22000 -- (-1715.870) [-1718.511] (-1726.493) (-1718.734) * [-1722.903] (-1715.386) (-1729.130) (-1730.662) -- 0:00:44
      22500 -- (-1715.459) [-1717.391] (-1723.818) (-1718.782) * [-1733.068] (-1715.280) (-1732.659) (-1722.676) -- 0:00:43
      23000 -- (-1717.134) [-1717.679] (-1725.304) (-1715.909) * (-1729.267) (-1718.207) [-1725.500] (-1726.385) -- 0:01:24
      23500 -- (-1720.315) (-1716.485) [-1723.880] (-1715.976) * (-1749.550) (-1715.012) (-1726.537) [-1724.547] -- 0:01:23
      24000 -- (-1717.233) (-1722.572) (-1726.807) [-1715.532] * [-1715.174] (-1715.182) (-1724.700) (-1728.903) -- 0:01:21
      24500 -- (-1717.752) (-1718.158) (-1724.124) [-1715.886] * (-1715.356) (-1716.336) [-1725.574] (-1721.704) -- 0:01:19
      25000 -- [-1717.300] (-1715.129) (-1729.189) (-1715.662) * [-1716.475] (-1718.952) (-1726.872) (-1727.886) -- 0:01:18

      Average standard deviation of split frequencies: 0.034614

      25500 -- [-1716.714] (-1719.282) (-1731.945) (-1715.793) * [-1716.144] (-1721.689) (-1726.551) (-1719.087) -- 0:01:16
      26000 -- (-1716.277) (-1721.346) (-1740.485) [-1717.613] * (-1715.644) (-1719.297) (-1726.316) [-1724.555] -- 0:01:14
      26500 -- (-1716.344) (-1719.909) [-1721.567] (-1716.913) * (-1718.114) (-1719.986) [-1724.046] (-1725.015) -- 0:01:13
      27000 -- [-1716.524] (-1718.691) (-1730.027) (-1716.914) * (-1719.314) (-1718.882) (-1723.039) [-1724.814] -- 0:01:12
      27500 -- [-1717.106] (-1716.556) (-1731.437) (-1716.704) * (-1717.678) (-1716.786) (-1730.114) [-1721.113] -- 0:01:10
      28000 -- (-1721.555) (-1720.457) [-1724.711] (-1716.957) * (-1718.355) [-1721.709] (-1737.573) (-1724.259) -- 0:01:09
      28500 -- (-1716.601) (-1719.285) [-1725.833] (-1717.653) * (-1717.304) (-1718.415) (-1725.284) [-1724.836] -- 0:01:08
      29000 -- (-1716.453) (-1724.402) [-1725.545] (-1717.575) * [-1716.846] (-1718.119) (-1739.431) (-1724.143) -- 0:01:06
      29500 -- (-1718.454) (-1717.661) (-1726.835) [-1715.600] * (-1716.998) (-1718.123) (-1724.168) [-1725.514] -- 0:01:05
      30000 -- (-1716.313) (-1719.276) [-1728.837] (-1716.221) * (-1716.998) (-1718.010) [-1723.489] (-1727.655) -- 0:01:04

      Average standard deviation of split frequencies: 0.056876

      30500 -- (-1716.695) (-1717.316) (-1724.519) [-1716.352] * (-1717.839) (-1718.175) (-1724.081) [-1723.349] -- 0:01:03
      31000 -- (-1715.906) (-1716.725) [-1727.094] (-1716.203) * (-1716.899) (-1717.963) [-1733.990] (-1724.064) -- 0:01:02
      31500 -- (-1718.458) [-1716.181] (-1725.119) (-1716.715) * (-1721.923) (-1720.927) (-1726.935) [-1722.832] -- 0:01:01
      32000 -- (-1719.691) [-1720.436] (-1726.560) (-1725.194) * (-1724.888) (-1719.240) (-1728.894) [-1731.592] -- 0:01:00
      32500 -- (-1717.408) (-1717.354) (-1721.556) [-1718.307] * (-1718.499) (-1719.635) [-1727.552] (-1727.284) -- 0:00:59
      33000 -- [-1716.019] (-1719.503) (-1720.100) (-1715.499) * (-1719.719) (-1721.482) (-1730.705) [-1725.897] -- 0:00:58
      33500 -- [-1717.790] (-1719.316) (-1717.868) (-1716.243) * (-1719.680) [-1718.588] (-1722.791) (-1725.574) -- 0:00:57
      34000 -- (-1718.779) (-1719.044) (-1717.211) [-1716.665] * (-1720.685) (-1719.573) (-1728.599) [-1731.334] -- 0:00:56
      34500 -- (-1715.869) (-1720.458) [-1717.024] (-1715.951) * (-1719.156) (-1719.110) (-1722.648) [-1729.074] -- 0:00:55
      35000 -- [-1722.218] (-1720.494) (-1718.454) (-1715.870) * [-1719.378] (-1715.769) (-1732.980) (-1726.466) -- 0:00:55

      Average standard deviation of split frequencies: 0.053688

      35500 -- (-1723.174) [-1716.444] (-1718.813) (-1717.893) * [-1717.005] (-1715.435) (-1727.323) (-1723.690) -- 0:00:54
      36000 -- (-1722.065) (-1716.476) (-1718.354) [-1716.257] * (-1716.066) (-1717.002) [-1728.252] (-1741.585) -- 0:00:53
      36500 -- (-1719.888) [-1716.579] (-1715.822) (-1716.024) * (-1716.524) (-1718.402) (-1720.540) [-1719.390] -- 0:01:19
      37000 -- (-1717.371) (-1716.031) (-1720.830) [-1715.905] * (-1717.987) [-1716.594] (-1718.461) (-1715.226) -- 0:01:18
      37500 -- (-1715.978) [-1715.989] (-1718.517) (-1716.048) * (-1720.681) (-1718.270) (-1718.362) [-1716.168] -- 0:01:17
      38000 -- (-1716.329) (-1715.338) (-1719.779) [-1716.372] * [-1716.947] (-1716.341) (-1717.480) (-1719.401) -- 0:01:15
      38500 -- (-1715.904) (-1715.097) (-1720.222) [-1717.490] * (-1716.987) [-1717.928] (-1717.078) (-1716.782) -- 0:01:14
      39000 -- (-1715.404) (-1715.028) [-1719.486] (-1718.146) * (-1722.723) (-1718.475) (-1716.512) [-1714.681] -- 0:01:13
      39500 -- (-1715.427) [-1716.843] (-1719.599) (-1721.701) * (-1719.664) [-1717.628] (-1719.089) (-1714.715) -- 0:01:12
      40000 -- (-1714.675) (-1717.127) (-1719.444) [-1716.475] * (-1718.063) (-1717.685) (-1717.560) [-1714.995] -- 0:01:12

      Average standard deviation of split frequencies: 0.045208

      40500 -- [-1715.610] (-1716.247) (-1723.544) (-1714.750) * (-1716.984) (-1717.168) (-1715.351) [-1720.350] -- 0:01:11
      41000 -- (-1715.515) [-1716.836] (-1720.938) (-1718.436) * (-1718.832) (-1716.302) (-1715.495) [-1721.165] -- 0:01:10
      41500 -- [-1717.454] (-1715.046) (-1721.321) (-1715.211) * (-1719.455) [-1716.636] (-1721.095) (-1721.261) -- 0:01:09
      42000 -- [-1716.172] (-1717.249) (-1723.047) (-1716.650) * (-1719.894) (-1716.891) (-1718.068) [-1717.615] -- 0:01:08
      42500 -- [-1716.175] (-1718.153) (-1716.341) (-1717.098) * [-1720.280] (-1717.601) (-1716.989) (-1715.981) -- 0:01:07
      43000 -- (-1716.793) [-1716.537] (-1716.817) (-1718.140) * (-1720.278) (-1715.880) (-1716.619) [-1716.766] -- 0:01:06
      43500 -- (-1715.715) (-1718.906) (-1715.805) [-1717.023] * (-1716.674) (-1715.805) (-1717.560) [-1717.275] -- 0:01:05
      44000 -- (-1715.580) (-1716.044) (-1716.657) [-1715.096] * (-1716.167) [-1715.770] (-1717.312) (-1716.402) -- 0:01:05
      44500 -- (-1715.442) (-1715.626) (-1717.855) [-1715.197] * [-1716.041] (-1716.951) (-1715.112) (-1717.002) -- 0:01:04
      45000 -- [-1716.388] (-1716.444) (-1722.907) (-1717.510) * (-1715.222) [-1717.534] (-1716.273) (-1715.182) -- 0:01:03

      Average standard deviation of split frequencies: 0.036893

      45500 -- (-1716.429) (-1716.153) [-1717.893] (-1715.116) * [-1720.700] (-1716.244) (-1717.416) (-1716.835) -- 0:01:02
      46000 -- (-1721.322) [-1715.680] (-1722.493) (-1719.072) * (-1721.960) [-1716.125] (-1717.049) (-1715.345) -- 0:01:02
      46500 -- [-1717.383] (-1716.368) (-1718.869) (-1717.856) * [-1718.698] (-1716.100) (-1715.493) (-1715.893) -- 0:01:01
      47000 -- (-1716.432) (-1716.136) (-1715.892) [-1717.287] * [-1716.998] (-1716.283) (-1717.140) (-1717.632) -- 0:01:00
      47500 -- (-1716.091) (-1718.870) [-1715.145] (-1715.945) * [-1718.556] (-1716.355) (-1721.100) (-1715.934) -- 0:01:00
      48000 -- (-1718.317) [-1716.802] (-1716.393) (-1716.550) * (-1717.843) (-1716.264) (-1721.563) [-1719.226] -- 0:00:59
      48500 -- (-1721.856) (-1715.797) (-1714.909) [-1720.234] * [-1718.668] (-1717.258) (-1717.898) (-1716.401) -- 0:00:58
      49000 -- (-1717.921) (-1717.309) [-1715.379] (-1718.882) * (-1715.845) [-1716.729] (-1721.330) (-1719.094) -- 0:00:58
      49500 -- (-1717.591) [-1717.163] (-1715.653) (-1724.826) * (-1718.739) (-1716.415) [-1715.126] (-1716.190) -- 0:00:57
      50000 -- [-1719.614] (-1720.559) (-1715.331) (-1720.320) * (-1715.723) (-1717.907) [-1715.138] (-1715.964) -- 0:00:57

      Average standard deviation of split frequencies: 0.043264

      50500 -- (-1719.749) (-1719.350) [-1715.666] (-1718.153) * (-1715.396) [-1719.152] (-1718.704) (-1715.227) -- 0:00:56
      51000 -- (-1718.924) (-1715.235) [-1718.496] (-1715.917) * (-1716.168) (-1715.735) (-1719.160) [-1715.366] -- 0:01:14
      51500 -- (-1717.579) (-1715.170) [-1716.163] (-1725.320) * [-1716.939] (-1715.963) (-1719.525) (-1716.226) -- 0:01:13
      52000 -- (-1715.434) [-1715.301] (-1715.852) (-1716.986) * (-1717.403) (-1720.855) (-1718.420) [-1716.186] -- 0:01:12
      52500 -- [-1717.186] (-1719.794) (-1718.737) (-1719.249) * (-1722.222) (-1718.578) (-1717.218) [-1719.200] -- 0:01:12
      53000 -- (-1717.226) (-1719.331) (-1717.686) [-1716.488] * [-1719.136] (-1715.926) (-1716.423) (-1716.485) -- 0:01:11
      53500 -- [-1718.183] (-1720.044) (-1717.708) (-1718.067) * (-1717.643) (-1716.740) [-1716.748] (-1716.485) -- 0:01:10
      54000 -- (-1717.021) (-1715.615) (-1716.265) [-1717.095] * (-1717.106) (-1717.564) (-1721.035) [-1715.657] -- 0:01:10
      54500 -- (-1716.019) [-1715.895] (-1716.523) (-1720.461) * [-1718.264] (-1719.643) (-1718.086) (-1716.581) -- 0:01:09
      55000 -- (-1715.750) (-1716.921) (-1716.567) [-1715.589] * (-1717.503) (-1723.245) (-1715.592) [-1716.350] -- 0:01:08

      Average standard deviation of split frequencies: 0.046051

      55500 -- [-1715.248] (-1716.552) (-1716.275) (-1716.308) * (-1716.771) (-1720.115) [-1715.839] (-1716.046) -- 0:01:08
      56000 -- (-1719.016) [-1717.431] (-1718.178) (-1716.225) * (-1715.511) (-1715.929) (-1716.999) [-1715.358] -- 0:01:07
      56500 -- (-1717.576) (-1715.082) (-1715.927) [-1718.343] * [-1716.098] (-1716.661) (-1716.540) (-1719.747) -- 0:01:06
      57000 -- (-1718.292) [-1716.841] (-1716.668) (-1719.526) * [-1715.642] (-1716.330) (-1716.117) (-1716.040) -- 0:01:06
      57500 -- [-1717.961] (-1717.005) (-1715.944) (-1720.433) * [-1719.895] (-1717.331) (-1718.674) (-1723.150) -- 0:01:05
      58000 -- (-1719.559) [-1715.852] (-1717.368) (-1716.633) * (-1716.237) [-1716.600] (-1719.735) (-1722.525) -- 0:01:04
      58500 -- (-1719.559) (-1717.505) [-1719.568] (-1715.909) * (-1715.584) (-1716.350) [-1716.650] (-1721.265) -- 0:01:04
      59000 -- [-1718.271] (-1717.934) (-1719.887) (-1716.159) * (-1716.073) [-1714.814] (-1719.054) (-1715.980) -- 0:01:03
      59500 -- [-1715.590] (-1719.073) (-1716.510) (-1719.465) * (-1721.160) (-1714.809) (-1718.061) [-1718.416] -- 0:01:03
      60000 -- [-1715.464] (-1717.684) (-1719.717) (-1715.625) * (-1721.934) (-1716.362) (-1723.344) [-1715.989] -- 0:01:02

      Average standard deviation of split frequencies: 0.033996

      60500 -- (-1716.122) (-1719.439) (-1723.468) [-1716.317] * [-1716.297] (-1715.306) (-1723.760) (-1716.277) -- 0:01:02
      61000 -- (-1716.144) [-1719.565] (-1719.547) (-1716.346) * (-1715.477) [-1715.341] (-1719.734) (-1719.033) -- 0:01:01
      61500 -- [-1717.394] (-1724.663) (-1717.249) (-1715.933) * (-1716.728) (-1716.792) (-1716.931) [-1718.768] -- 0:01:01
      62000 -- (-1715.466) [-1721.650] (-1717.026) (-1715.850) * (-1718.057) (-1714.971) (-1717.269) [-1716.656] -- 0:01:00
      62500 -- (-1717.507) (-1722.035) (-1717.144) [-1716.216] * (-1717.598) [-1715.038] (-1718.084) (-1717.920) -- 0:01:00
      63000 -- (-1716.998) [-1717.826] (-1717.324) (-1716.980) * (-1718.181) [-1715.376] (-1717.815) (-1720.472) -- 0:00:59
      63500 -- (-1720.029) (-1717.753) (-1721.401) [-1716.376] * (-1716.139) (-1716.364) (-1716.655) [-1716.253] -- 0:00:58
      64000 -- (-1717.881) (-1716.562) [-1716.191] (-1715.602) * [-1715.578] (-1716.414) (-1715.524) (-1722.129) -- 0:00:58
      64500 -- (-1718.474) (-1717.248) [-1715.486] (-1715.955) * (-1715.325) (-1715.001) [-1714.971] (-1718.844) -- 0:00:58
      65000 -- (-1719.663) [-1716.198] (-1716.020) (-1716.540) * (-1719.670) (-1718.948) [-1715.254] (-1717.726) -- 0:00:57

      Average standard deviation of split frequencies: 0.030713

      65500 -- (-1719.259) [-1716.154] (-1717.057) (-1717.472) * [-1716.869] (-1718.400) (-1718.044) (-1714.731) -- 0:00:57
      66000 -- (-1719.271) [-1717.308] (-1721.398) (-1715.217) * [-1716.827] (-1720.257) (-1715.846) (-1716.422) -- 0:01:10
      66500 -- (-1716.111) (-1720.223) (-1716.353) [-1715.653] * [-1718.931] (-1716.848) (-1717.962) (-1716.613) -- 0:01:10
      67000 -- (-1718.070) [-1716.915] (-1715.336) (-1715.553) * (-1716.855) (-1717.504) [-1716.242] (-1717.681) -- 0:01:09
      67500 -- (-1718.278) (-1717.722) (-1715.349) [-1715.291] * (-1717.545) (-1716.496) [-1716.565] (-1716.826) -- 0:01:09
      68000 -- (-1717.953) [-1718.263] (-1717.453) (-1715.531) * (-1720.049) [-1716.112] (-1718.179) (-1717.368) -- 0:01:08
      68500 -- [-1716.342] (-1718.024) (-1718.859) (-1721.926) * [-1720.520] (-1714.776) (-1717.272) (-1718.588) -- 0:01:07
      69000 -- (-1716.324) (-1718.035) [-1716.091] (-1716.777) * (-1722.708) (-1715.715) [-1717.535] (-1717.011) -- 0:01:07
      69500 -- [-1716.743] (-1722.451) (-1716.749) (-1715.004) * (-1720.138) (-1716.673) [-1715.776] (-1718.531) -- 0:01:06
      70000 -- [-1715.405] (-1717.699) (-1717.054) (-1717.469) * (-1723.224) (-1717.356) [-1716.977] (-1716.976) -- 0:01:06

      Average standard deviation of split frequencies: 0.029352

      70500 -- (-1715.392) (-1717.285) [-1718.409] (-1717.746) * (-1720.017) [-1715.478] (-1717.589) (-1715.453) -- 0:01:05
      71000 -- (-1717.305) (-1716.584) [-1717.861] (-1718.651) * (-1719.862) [-1721.225] (-1716.509) (-1718.663) -- 0:01:05
      71500 -- (-1717.792) [-1717.643] (-1723.420) (-1718.200) * (-1715.602) (-1716.567) [-1715.884] (-1716.043) -- 0:01:04
      72000 -- [-1718.822] (-1717.819) (-1720.745) (-1717.983) * (-1716.015) [-1717.204] (-1715.411) (-1720.137) -- 0:01:04
      72500 -- (-1716.293) (-1720.569) [-1719.980] (-1719.783) * (-1719.761) (-1717.661) [-1715.411] (-1720.151) -- 0:01:03
      73000 -- [-1716.279] (-1715.852) (-1719.895) (-1720.440) * (-1716.327) [-1720.273] (-1715.411) (-1715.434) -- 0:01:03
      73500 -- (-1716.897) [-1716.910] (-1719.146) (-1718.244) * [-1714.726] (-1723.080) (-1715.746) (-1721.952) -- 0:01:03
      74000 -- [-1716.646] (-1718.233) (-1720.741) (-1721.450) * [-1715.706] (-1722.999) (-1717.313) (-1718.517) -- 0:01:02
      74500 -- (-1716.158) (-1717.094) (-1718.120) [-1717.060] * (-1717.388) [-1717.521] (-1716.030) (-1716.758) -- 0:01:02
      75000 -- [-1716.406] (-1719.905) (-1719.302) (-1718.029) * (-1715.491) (-1717.469) (-1718.923) [-1719.115] -- 0:01:01

      Average standard deviation of split frequencies: 0.030324

      75500 -- (-1717.577) (-1719.829) [-1715.861] (-1716.614) * (-1717.305) [-1717.068] (-1717.174) (-1718.252) -- 0:01:01
      76000 -- (-1718.024) (-1718.788) (-1717.975) [-1715.366] * (-1720.041) (-1715.623) (-1715.086) [-1717.396] -- 0:01:00
      76500 -- (-1718.222) [-1716.617] (-1717.572) (-1714.937) * (-1717.539) (-1718.389) [-1718.909] (-1719.828) -- 0:01:00
      77000 -- (-1719.104) (-1717.567) (-1716.111) [-1715.036] * (-1718.814) (-1716.715) (-1720.286) [-1716.675] -- 0:00:59
      77500 -- (-1716.102) [-1715.251] (-1716.741) (-1716.125) * (-1718.584) (-1719.238) [-1716.612] (-1715.354) -- 0:00:59
      78000 -- (-1715.741) (-1715.775) [-1715.068] (-1720.413) * (-1721.709) [-1716.670] (-1716.441) (-1715.769) -- 0:00:59
      78500 -- (-1718.552) [-1715.410] (-1714.888) (-1716.034) * (-1717.276) (-1715.422) [-1719.956] (-1717.039) -- 0:00:58
      79000 -- (-1716.269) (-1716.063) (-1715.450) [-1715.229] * (-1717.550) [-1716.295] (-1719.940) (-1717.836) -- 0:00:58
      79500 -- [-1716.335] (-1716.885) (-1715.798) (-1717.243) * (-1720.114) [-1718.163] (-1720.749) (-1720.042) -- 0:00:57
      80000 -- (-1714.830) (-1716.240) (-1715.212) [-1715.207] * [-1717.904] (-1718.949) (-1717.567) (-1720.232) -- 0:01:09

      Average standard deviation of split frequencies: 0.026813

      80500 -- [-1715.977] (-1715.375) (-1715.573) (-1717.240) * (-1717.464) (-1719.598) [-1717.975] (-1717.613) -- 0:01:08
      81000 -- (-1716.023) [-1715.342] (-1715.452) (-1716.328) * (-1716.611) (-1717.030) [-1718.252] (-1716.434) -- 0:01:08
      81500 -- (-1715.470) (-1716.269) (-1715.659) [-1716.513] * (-1716.548) (-1716.722) [-1717.555] (-1718.074) -- 0:01:07
      82000 -- (-1718.706) (-1716.275) [-1720.120] (-1715.540) * (-1715.625) (-1715.400) (-1718.249) [-1718.331] -- 0:01:07
      82500 -- (-1718.147) (-1717.669) (-1718.082) [-1715.853] * [-1717.786] (-1719.793) (-1720.071) (-1717.928) -- 0:01:06
      83000 -- (-1718.843) [-1719.754] (-1718.474) (-1715.872) * (-1717.458) (-1720.871) (-1720.075) [-1717.324] -- 0:01:06
      83500 -- (-1718.644) [-1717.743] (-1720.099) (-1723.301) * (-1716.890) [-1715.588] (-1717.847) (-1717.775) -- 0:01:05
      84000 -- (-1719.087) (-1718.292) (-1716.380) [-1716.703] * (-1721.959) (-1716.677) (-1716.898) [-1716.476] -- 0:01:05
      84500 -- (-1717.239) (-1718.245) [-1717.398] (-1715.950) * (-1717.488) (-1715.733) [-1716.950] (-1720.172) -- 0:01:05
      85000 -- (-1715.729) (-1722.023) [-1716.697] (-1719.329) * (-1717.355) [-1717.968] (-1716.730) (-1716.300) -- 0:01:04

      Average standard deviation of split frequencies: 0.027712

      85500 -- (-1718.167) [-1718.625] (-1716.369) (-1716.242) * (-1715.683) (-1715.977) [-1716.302] (-1716.201) -- 0:01:04
      86000 -- (-1720.721) [-1716.580] (-1717.943) (-1720.015) * (-1715.881) (-1716.565) [-1716.016] (-1716.795) -- 0:01:03
      86500 -- (-1719.778) [-1715.563] (-1717.459) (-1718.265) * (-1716.206) (-1719.314) (-1716.114) [-1716.553] -- 0:01:03
      87000 -- (-1719.779) (-1716.326) [-1714.932] (-1719.874) * [-1717.207] (-1717.161) (-1718.779) (-1716.178) -- 0:01:02
      87500 -- (-1731.725) (-1717.216) (-1717.500) [-1717.944] * [-1717.832] (-1714.803) (-1718.635) (-1716.791) -- 0:01:02
      88000 -- (-1724.413) (-1718.023) [-1716.966] (-1717.945) * [-1717.628] (-1716.333) (-1716.128) (-1719.205) -- 0:01:02
      88500 -- (-1716.228) (-1717.320) [-1719.503] (-1716.086) * [-1717.578] (-1715.405) (-1718.951) (-1719.054) -- 0:01:01
      89000 -- (-1714.860) [-1715.758] (-1715.269) (-1716.209) * (-1718.816) [-1715.397] (-1718.886) (-1718.649) -- 0:01:01
      89500 -- (-1714.781) (-1716.893) (-1715.666) [-1716.602] * (-1718.499) [-1716.846] (-1717.941) (-1717.367) -- 0:01:01
      90000 -- (-1716.963) (-1717.790) (-1715.244) [-1715.854] * (-1718.145) [-1715.468] (-1716.272) (-1718.044) -- 0:01:00

      Average standard deviation of split frequencies: 0.027556

      90500 -- (-1716.302) [-1715.152] (-1718.467) (-1716.643) * (-1718.318) [-1715.245] (-1717.917) (-1719.558) -- 0:01:00
      91000 -- [-1717.868] (-1716.532) (-1715.038) (-1717.845) * (-1721.820) [-1714.810] (-1715.943) (-1716.868) -- 0:00:59
      91500 -- (-1716.970) [-1716.062] (-1720.523) (-1719.307) * (-1726.266) (-1717.586) (-1717.449) [-1717.908] -- 0:00:59
      92000 -- (-1715.970) (-1715.773) [-1715.997] (-1717.801) * (-1718.478) (-1716.159) [-1716.114] (-1719.927) -- 0:00:59
      92500 -- (-1716.897) (-1716.547) (-1715.227) [-1718.694] * [-1716.664] (-1716.159) (-1715.938) (-1717.506) -- 0:00:58
      93000 -- (-1716.435) (-1716.164) [-1715.705] (-1721.265) * (-1717.654) (-1716.149) [-1715.664] (-1722.789) -- 0:00:58
      93500 -- [-1717.620] (-1716.022) (-1718.029) (-1720.367) * (-1716.597) (-1716.606) (-1716.459) [-1718.869] -- 0:00:58
      94000 -- (-1718.050) (-1717.268) [-1719.863] (-1717.077) * (-1717.563) [-1716.507] (-1718.101) (-1719.666) -- 0:00:57
      94500 -- (-1720.996) (-1718.846) (-1719.424) [-1715.501] * [-1715.371] (-1717.764) (-1716.829) (-1718.441) -- 0:00:57
      95000 -- [-1718.254] (-1716.214) (-1717.008) (-1715.625) * [-1716.336] (-1719.200) (-1715.749) (-1717.985) -- 0:00:57

      Average standard deviation of split frequencies: 0.027744

      95500 -- (-1717.897) [-1717.943] (-1716.884) (-1716.712) * [-1716.117] (-1715.259) (-1718.892) (-1722.530) -- 0:01:06
      96000 -- (-1715.586) (-1724.470) (-1716.452) [-1717.922] * [-1716.544] (-1717.201) (-1715.278) (-1719.421) -- 0:01:05
      96500 -- [-1716.843] (-1721.184) (-1716.453) (-1716.526) * (-1716.916) (-1718.321) (-1715.304) [-1719.579] -- 0:01:05
      97000 -- (-1717.711) (-1721.668) [-1716.482] (-1715.344) * (-1718.262) (-1717.613) [-1715.299] (-1720.730) -- 0:01:05
      97500 -- (-1721.839) (-1715.831) [-1716.875] (-1717.035) * (-1716.854) (-1718.342) [-1716.780] (-1722.028) -- 0:01:04
      98000 -- (-1719.077) (-1717.587) (-1716.309) [-1717.129] * (-1716.846) [-1714.959] (-1715.600) (-1728.142) -- 0:01:04
      98500 -- (-1717.054) (-1715.914) (-1716.609) [-1716.887] * (-1722.262) [-1715.948] (-1717.436) (-1723.053) -- 0:01:04
      99000 -- (-1719.194) (-1716.898) [-1715.478] (-1717.073) * (-1718.267) (-1715.966) [-1715.456] (-1720.521) -- 0:01:03
      99500 -- (-1717.081) [-1720.100] (-1716.083) (-1715.649) * (-1717.911) [-1716.286] (-1715.986) (-1715.232) -- 0:01:03
      100000 -- (-1715.480) (-1719.611) (-1717.774) [-1717.207] * (-1717.527) (-1717.889) (-1716.258) [-1715.720] -- 0:01:02

      Average standard deviation of split frequencies: 0.025495

      100500 -- (-1717.525) (-1720.360) (-1717.606) [-1716.814] * (-1718.847) [-1715.197] (-1715.086) (-1715.328) -- 0:01:02
      101000 -- (-1715.983) (-1719.827) (-1716.667) [-1716.431] * (-1718.232) [-1715.303] (-1715.118) (-1715.215) -- 0:01:02
      101500 -- (-1715.895) [-1719.300] (-1716.260) (-1716.324) * (-1716.167) (-1715.006) (-1715.107) [-1715.232] -- 0:01:01
      102000 -- (-1717.957) (-1721.631) (-1717.609) [-1714.756] * (-1716.359) (-1716.373) [-1716.506] (-1716.699) -- 0:01:01
      102500 -- (-1715.909) (-1720.567) [-1715.737] (-1716.633) * (-1715.894) (-1716.194) (-1716.591) [-1715.518] -- 0:01:01
      103000 -- (-1715.696) (-1719.004) (-1716.950) [-1715.352] * (-1716.419) (-1715.687) (-1714.859) [-1716.008] -- 0:01:00
      103500 -- (-1715.607) (-1718.412) [-1716.440] (-1717.718) * (-1715.166) (-1715.919) [-1718.650] (-1715.896) -- 0:01:00
      104000 -- (-1718.691) [-1715.598] (-1715.716) (-1717.197) * (-1715.876) (-1716.000) (-1717.446) [-1716.644] -- 0:01:00
      104500 -- (-1718.159) [-1715.840] (-1715.721) (-1718.305) * (-1719.159) (-1716.130) (-1720.390) [-1718.653] -- 0:00:59
      105000 -- (-1718.127) [-1715.591] (-1718.965) (-1717.514) * (-1715.944) [-1715.897] (-1719.884) (-1716.824) -- 0:00:59

      Average standard deviation of split frequencies: 0.026906

      105500 -- [-1715.928] (-1718.655) (-1715.931) (-1720.782) * (-1715.198) (-1715.332) (-1718.499) [-1719.229] -- 0:00:59
      106000 -- (-1719.987) (-1715.827) [-1715.984] (-1720.788) * (-1715.197) (-1714.700) [-1718.094] (-1719.692) -- 0:00:59
      106500 -- (-1715.495) (-1719.637) [-1716.562] (-1717.362) * (-1716.552) (-1718.539) [-1716.167] (-1717.367) -- 0:00:58
      107000 -- (-1715.125) [-1715.534] (-1715.661) (-1715.454) * (-1717.223) (-1715.877) [-1715.402] (-1717.653) -- 0:00:58
      107500 -- (-1715.686) (-1718.142) [-1717.205] (-1716.373) * (-1717.223) [-1715.999] (-1714.709) (-1716.283) -- 0:00:58
      108000 -- (-1716.354) [-1716.943] (-1716.667) (-1717.524) * (-1717.128) (-1716.000) (-1719.335) [-1715.488] -- 0:00:57
      108500 -- (-1719.466) (-1716.626) (-1718.026) [-1717.707] * (-1714.875) (-1717.246) (-1717.609) [-1715.726] -- 0:00:57
      109000 -- (-1723.057) (-1717.394) (-1718.099) [-1717.942] * (-1716.672) (-1716.959) (-1720.333) [-1717.456] -- 0:00:57
      109500 -- (-1716.549) [-1717.694] (-1718.451) (-1718.171) * [-1718.123] (-1719.408) (-1715.843) (-1717.337) -- 0:00:56
      110000 -- (-1716.317) (-1716.652) [-1716.247] (-1717.749) * (-1720.290) (-1716.168) [-1718.688] (-1715.688) -- 0:00:56

      Average standard deviation of split frequencies: 0.024067

      110500 -- (-1717.547) (-1721.182) (-1716.061) [-1716.645] * (-1720.649) (-1716.348) (-1715.972) [-1715.812] -- 0:00:56
      111000 -- (-1715.535) (-1717.020) (-1715.883) [-1716.717] * (-1721.610) (-1716.695) [-1715.335] (-1717.237) -- 0:01:04
      111500 -- (-1715.245) (-1716.443) [-1715.037] (-1717.464) * (-1723.030) (-1716.907) [-1723.051] (-1723.621) -- 0:01:03
      112000 -- (-1715.692) (-1716.467) (-1715.804) [-1716.433] * (-1722.011) (-1716.955) [-1717.996] (-1719.235) -- 0:01:03
      112500 -- (-1716.037) [-1716.603] (-1714.960) (-1719.493) * [-1720.793] (-1718.285) (-1717.768) (-1719.404) -- 0:01:03
      113000 -- [-1715.532] (-1719.939) (-1714.960) (-1721.228) * [-1717.658] (-1718.313) (-1718.609) (-1718.095) -- 0:01:02
      113500 -- (-1716.612) (-1718.385) [-1715.321] (-1722.819) * (-1718.569) (-1718.913) [-1716.967] (-1716.900) -- 0:01:02
      114000 -- (-1715.786) (-1718.942) (-1716.348) [-1720.084] * (-1718.311) [-1718.378] (-1715.807) (-1717.484) -- 0:01:02
      114500 -- (-1716.265) (-1716.386) [-1717.025] (-1720.022) * (-1719.535) [-1717.176] (-1718.270) (-1715.664) -- 0:01:01
      115000 -- (-1715.134) (-1716.635) [-1716.260] (-1716.984) * (-1718.833) (-1721.051) (-1717.372) [-1720.644] -- 0:01:01

      Average standard deviation of split frequencies: 0.028834

      115500 -- (-1714.668) (-1717.850) [-1720.040] (-1716.610) * (-1718.053) (-1716.307) [-1716.165] (-1716.537) -- 0:01:01
      116000 -- (-1715.499) (-1716.278) [-1719.366] (-1716.348) * (-1718.270) [-1717.299] (-1716.164) (-1716.420) -- 0:01:00
      116500 -- (-1715.913) (-1715.613) [-1716.216] (-1718.870) * (-1719.957) [-1715.278] (-1720.976) (-1716.291) -- 0:01:00
      117000 -- (-1716.438) [-1714.987] (-1721.931) (-1715.577) * (-1718.385) (-1718.657) [-1715.923] (-1717.360) -- 0:01:00
      117500 -- [-1716.955] (-1716.164) (-1719.112) (-1716.568) * (-1715.048) [-1717.828] (-1717.154) (-1715.241) -- 0:01:00
      118000 -- (-1716.958) [-1717.638] (-1715.870) (-1721.707) * (-1715.299) (-1717.648) [-1715.692] (-1717.750) -- 0:00:59
      118500 -- (-1714.865) [-1716.028] (-1716.712) (-1719.877) * (-1717.551) [-1716.444] (-1716.064) (-1717.494) -- 0:00:59
      119000 -- (-1715.112) (-1716.276) [-1716.169] (-1727.733) * [-1717.034] (-1717.373) (-1716.232) (-1717.455) -- 0:00:59
      119500 -- (-1715.122) (-1720.063) [-1716.823] (-1716.626) * [-1717.144] (-1716.636) (-1717.259) (-1718.312) -- 0:00:58
      120000 -- (-1715.865) (-1718.768) (-1717.898) [-1716.050] * [-1716.099] (-1719.072) (-1719.108) (-1720.028) -- 0:00:58

      Average standard deviation of split frequencies: 0.024742

      120500 -- [-1715.385] (-1721.478) (-1715.886) (-1720.419) * (-1715.459) (-1716.571) (-1727.728) [-1720.891] -- 0:00:58
      121000 -- (-1715.042) (-1725.631) [-1715.442] (-1715.172) * (-1717.455) (-1716.084) (-1721.888) [-1718.076] -- 0:00:58
      121500 -- [-1717.180] (-1722.332) (-1718.121) (-1715.754) * (-1720.862) [-1719.302] (-1716.335) (-1718.581) -- 0:00:57
      122000 -- [-1717.753] (-1717.162) (-1718.336) (-1716.315) * (-1715.735) [-1717.463] (-1716.618) (-1716.576) -- 0:00:57
      122500 -- (-1716.825) (-1716.194) [-1717.094] (-1717.206) * [-1715.641] (-1717.067) (-1717.534) (-1714.830) -- 0:00:57
      123000 -- (-1717.421) [-1717.552] (-1716.141) (-1717.206) * (-1715.817) (-1718.813) (-1720.405) [-1715.625] -- 0:00:57
      123500 -- (-1715.784) (-1715.948) [-1715.514] (-1715.528) * (-1717.471) [-1718.307] (-1718.817) (-1716.446) -- 0:00:56
      124000 -- (-1715.853) (-1717.100) [-1716.135] (-1715.322) * (-1717.178) (-1718.177) [-1720.455] (-1718.714) -- 0:00:56
      124500 -- [-1717.758] (-1717.625) (-1716.903) (-1718.741) * (-1715.871) (-1717.135) [-1717.464] (-1720.427) -- 0:00:56
      125000 -- [-1717.188] (-1718.182) (-1715.452) (-1715.318) * (-1715.525) (-1716.397) [-1717.782] (-1717.250) -- 0:00:56

      Average standard deviation of split frequencies: 0.025598

      125500 -- (-1718.560) (-1717.087) [-1715.631] (-1716.222) * [-1715.858] (-1716.397) (-1716.962) (-1717.230) -- 0:00:55
      126000 -- [-1715.637] (-1717.765) (-1714.734) (-1721.170) * (-1717.634) (-1715.507) (-1716.101) [-1716.160] -- 0:00:55
      126500 -- [-1716.171] (-1715.946) (-1717.600) (-1721.511) * (-1723.370) (-1718.956) (-1715.015) [-1715.256] -- 0:01:02
      127000 -- [-1716.377] (-1714.782) (-1718.081) (-1716.847) * (-1725.175) (-1717.476) [-1717.792] (-1716.346) -- 0:01:01
      127500 -- (-1715.940) (-1715.928) (-1718.199) [-1715.726] * (-1716.095) (-1719.201) [-1716.182] (-1719.260) -- 0:01:01
      128000 -- (-1715.364) (-1715.523) [-1719.036] (-1716.161) * (-1715.788) (-1718.029) (-1716.090) [-1717.780] -- 0:01:01
      128500 -- [-1716.066] (-1717.989) (-1718.133) (-1715.586) * (-1715.991) (-1718.342) (-1716.181) [-1720.433] -- 0:01:01
      129000 -- (-1716.897) (-1719.274) (-1716.143) [-1715.694] * [-1715.502] (-1716.936) (-1718.920) (-1721.530) -- 0:01:00
      129500 -- [-1716.863] (-1718.643) (-1715.500) (-1716.191) * (-1716.549) (-1715.616) (-1719.388) [-1715.561] -- 0:01:00
      130000 -- (-1716.907) [-1718.829] (-1715.469) (-1716.015) * (-1717.530) (-1716.253) (-1716.581) [-1717.573] -- 0:01:00

      Average standard deviation of split frequencies: 0.026697

      130500 -- [-1716.665] (-1717.952) (-1716.707) (-1717.494) * (-1721.362) (-1715.577) (-1719.072) [-1716.112] -- 0:00:59
      131000 -- [-1716.447] (-1720.007) (-1716.789) (-1718.511) * (-1722.068) (-1715.428) [-1720.558] (-1716.373) -- 0:00:59
      131500 -- (-1716.466) [-1715.842] (-1716.692) (-1718.447) * (-1716.779) (-1715.077) (-1716.866) [-1717.081] -- 0:00:59
      132000 -- (-1716.269) (-1717.855) [-1716.566] (-1717.185) * (-1721.804) (-1715.918) (-1722.161) [-1718.031] -- 0:00:59
      132500 -- (-1714.557) (-1718.748) [-1716.655] (-1716.982) * (-1719.111) (-1714.987) (-1716.949) [-1716.023] -- 0:00:58
      133000 -- (-1717.621) [-1718.335] (-1717.899) (-1715.540) * (-1719.879) (-1715.678) [-1718.513] (-1716.053) -- 0:00:58
      133500 -- (-1719.971) (-1716.344) (-1716.147) [-1716.108] * (-1721.751) (-1715.815) (-1715.501) [-1715.655] -- 0:00:58
      134000 -- (-1715.284) (-1716.870) (-1717.883) [-1716.203] * (-1718.517) [-1716.668] (-1716.662) (-1714.874) -- 0:00:58
      134500 -- (-1715.758) (-1715.951) [-1716.490] (-1715.870) * [-1717.862] (-1715.649) (-1716.890) (-1716.180) -- 0:00:57
      135000 -- (-1715.304) (-1716.025) (-1717.738) [-1715.324] * [-1716.252] (-1715.244) (-1723.115) (-1715.835) -- 0:00:57

      Average standard deviation of split frequencies: 0.027322

      135500 -- [-1716.870] (-1716.949) (-1716.681) (-1717.750) * [-1717.923] (-1715.983) (-1720.165) (-1718.149) -- 0:00:57
      136000 -- (-1715.564) (-1719.717) (-1716.664) [-1716.147] * (-1717.207) [-1716.682] (-1718.144) (-1717.097) -- 0:00:57
      136500 -- (-1715.300) [-1719.640] (-1716.560) (-1715.264) * (-1716.940) [-1716.239] (-1718.065) (-1716.225) -- 0:00:56
      137000 -- [-1715.066] (-1716.758) (-1719.112) (-1715.308) * (-1716.843) (-1717.030) [-1722.500] (-1716.033) -- 0:00:56
      137500 -- (-1718.761) [-1717.613] (-1716.514) (-1715.130) * (-1717.348) (-1718.062) (-1721.691) [-1717.753] -- 0:00:56
      138000 -- (-1715.863) (-1717.615) [-1716.475] (-1717.067) * [-1717.336] (-1717.880) (-1718.622) (-1716.184) -- 0:00:56
      138500 -- (-1715.842) (-1719.776) [-1716.430] (-1716.941) * (-1718.153) (-1722.322) [-1718.511] (-1717.357) -- 0:00:55
      139000 -- (-1716.532) (-1717.558) (-1717.403) [-1715.465] * (-1719.211) (-1719.527) (-1719.732) [-1719.335] -- 0:00:55
      139500 -- (-1717.248) [-1716.835] (-1715.063) (-1717.082) * [-1719.554] (-1715.837) (-1716.308) (-1719.704) -- 0:00:55
      140000 -- (-1716.935) [-1717.637] (-1715.324) (-1715.693) * [-1719.944] (-1719.047) (-1716.249) (-1720.982) -- 0:00:55

      Average standard deviation of split frequencies: 0.027598

      140500 -- (-1717.812) [-1716.611] (-1715.363) (-1715.537) * (-1717.312) (-1719.076) (-1715.661) [-1721.533] -- 0:00:55
      141000 -- [-1721.271] (-1716.616) (-1716.282) (-1717.471) * (-1717.161) [-1714.855] (-1721.634) (-1721.324) -- 0:00:54
      141500 -- (-1717.158) (-1723.745) [-1716.900] (-1716.683) * [-1721.206] (-1719.001) (-1716.543) (-1716.274) -- 0:00:54
      142000 -- (-1715.956) (-1716.669) [-1714.804] (-1715.503) * (-1718.810) [-1719.142] (-1717.835) (-1716.124) -- 0:01:00
      142500 -- (-1716.681) (-1717.243) [-1715.022] (-1717.687) * [-1716.817] (-1719.173) (-1717.974) (-1715.795) -- 0:01:00
      143000 -- (-1714.990) (-1720.637) [-1717.364] (-1718.386) * (-1717.521) (-1720.934) (-1717.475) [-1717.968] -- 0:00:59
      143500 -- [-1714.777] (-1718.635) (-1718.337) (-1717.304) * (-1717.393) (-1715.698) [-1717.667] (-1716.928) -- 0:00:59
      144000 -- [-1714.671] (-1721.423) (-1719.929) (-1717.059) * (-1715.548) [-1716.971] (-1716.927) (-1719.606) -- 0:00:59
      144500 -- (-1715.027) (-1719.358) (-1721.693) [-1715.484] * [-1716.613] (-1718.025) (-1719.204) (-1718.193) -- 0:00:59
      145000 -- (-1714.705) (-1718.214) [-1719.609] (-1715.611) * (-1718.230) (-1718.231) (-1721.413) [-1715.776] -- 0:00:58

      Average standard deviation of split frequencies: 0.026548

      145500 -- (-1719.123) (-1721.753) [-1717.347] (-1715.313) * (-1721.775) (-1718.955) (-1720.458) [-1716.770] -- 0:00:58
      146000 -- (-1717.577) [-1718.154] (-1717.880) (-1716.401) * (-1717.197) [-1717.507] (-1718.370) (-1716.071) -- 0:00:58
      146500 -- (-1715.617) [-1716.323] (-1716.431) (-1715.740) * (-1716.805) [-1718.122] (-1717.971) (-1717.294) -- 0:00:58
      147000 -- (-1715.445) [-1716.966] (-1715.089) (-1715.713) * (-1714.884) [-1719.975] (-1716.444) (-1717.957) -- 0:00:58
      147500 -- (-1716.483) (-1717.753) (-1717.845) [-1716.561] * (-1716.047) (-1719.064) (-1716.532) [-1716.522] -- 0:00:57
      148000 -- (-1715.033) (-1718.313) (-1720.453) [-1720.254] * (-1715.072) (-1718.229) (-1715.819) [-1718.113] -- 0:00:57
      148500 -- [-1715.157] (-1718.847) (-1723.610) (-1717.094) * (-1715.102) [-1722.892] (-1719.108) (-1717.335) -- 0:00:57
      149000 -- (-1719.403) (-1718.490) (-1717.179) [-1717.179] * [-1715.617] (-1715.682) (-1715.482) (-1719.168) -- 0:00:57
      149500 -- (-1715.789) [-1717.722] (-1719.666) (-1717.588) * [-1716.025] (-1714.863) (-1715.962) (-1718.916) -- 0:00:56
      150000 -- [-1716.828] (-1716.044) (-1717.817) (-1717.187) * [-1715.838] (-1714.916) (-1715.273) (-1717.186) -- 0:00:56

      Average standard deviation of split frequencies: 0.026135

      150500 -- [-1718.568] (-1715.617) (-1717.624) (-1716.820) * [-1719.643] (-1715.253) (-1715.686) (-1716.802) -- 0:00:56
      151000 -- [-1718.095] (-1716.849) (-1716.940) (-1718.037) * (-1717.004) (-1715.266) [-1715.174] (-1716.033) -- 0:00:56
      151500 -- [-1718.185] (-1719.094) (-1721.511) (-1717.473) * (-1715.583) (-1717.693) [-1715.328] (-1716.073) -- 0:00:56
      152000 -- [-1717.227] (-1716.478) (-1721.515) (-1720.357) * (-1717.026) (-1718.755) [-1715.103] (-1717.430) -- 0:00:55
      152500 -- [-1716.534] (-1717.884) (-1722.623) (-1717.107) * [-1715.826] (-1717.192) (-1716.267) (-1718.012) -- 0:00:55
      153000 -- [-1716.417] (-1716.920) (-1717.762) (-1716.854) * [-1716.727] (-1722.239) (-1715.603) (-1715.670) -- 0:00:55
      153500 -- (-1715.368) [-1717.237] (-1721.909) (-1716.679) * (-1718.158) [-1717.257] (-1715.225) (-1716.724) -- 0:00:55
      154000 -- (-1715.306) (-1715.238) (-1722.639) [-1719.262] * (-1717.868) (-1717.141) (-1717.184) [-1715.861] -- 0:00:54
      154500 -- (-1716.608) [-1714.842] (-1716.537) (-1715.965) * (-1717.598) (-1716.849) [-1715.237] (-1717.529) -- 0:00:54
      155000 -- (-1716.956) (-1716.375) (-1715.172) [-1715.133] * (-1718.809) [-1716.480] (-1718.294) (-1717.391) -- 0:00:54

      Average standard deviation of split frequencies: 0.026663

      155500 -- (-1718.053) (-1715.163) [-1715.585] (-1716.188) * (-1715.975) (-1716.462) (-1719.659) [-1718.276] -- 0:00:54
      156000 -- (-1716.745) (-1715.962) [-1714.700] (-1715.909) * (-1716.342) (-1718.628) [-1715.651] (-1716.937) -- 0:00:54
      156500 -- [-1716.344] (-1715.261) (-1715.023) (-1715.497) * [-1716.009] (-1718.769) (-1716.413) (-1722.934) -- 0:00:53
      157000 -- (-1720.194) (-1716.126) [-1715.112] (-1716.165) * (-1715.548) (-1719.336) [-1715.598] (-1720.262) -- 0:00:53
      157500 -- (-1721.741) [-1721.171] (-1715.599) (-1716.165) * (-1715.654) (-1720.793) [-1715.362] (-1716.117) -- 0:00:58
      158000 -- (-1720.653) (-1719.296) [-1715.664] (-1715.225) * [-1716.954] (-1724.734) (-1715.453) (-1717.338) -- 0:00:58
      158500 -- [-1717.778] (-1716.744) (-1715.171) (-1716.235) * (-1716.031) (-1716.723) [-1715.452] (-1717.706) -- 0:00:58
      159000 -- (-1718.990) [-1716.050] (-1717.181) (-1714.759) * (-1716.966) (-1716.774) [-1715.760] (-1717.883) -- 0:00:58
      159500 -- (-1717.286) (-1716.032) [-1716.499] (-1718.369) * (-1715.954) (-1716.139) (-1717.771) [-1715.263] -- 0:00:57
      160000 -- (-1715.374) [-1716.691] (-1718.240) (-1717.797) * (-1716.826) (-1716.707) (-1716.500) [-1718.023] -- 0:00:57

      Average standard deviation of split frequencies: 0.025026

      160500 -- [-1715.415] (-1716.880) (-1718.244) (-1717.684) * (-1721.613) (-1718.374) (-1715.145) [-1715.394] -- 0:00:57
      161000 -- (-1715.779) [-1719.258] (-1719.232) (-1717.526) * [-1721.265] (-1718.634) (-1716.109) (-1717.954) -- 0:00:57
      161500 -- [-1715.154] (-1718.581) (-1715.977) (-1716.828) * [-1719.421] (-1718.508) (-1716.887) (-1718.763) -- 0:00:57
      162000 -- [-1715.805] (-1717.272) (-1715.165) (-1715.503) * (-1718.139) [-1719.047] (-1716.092) (-1719.652) -- 0:00:56
      162500 -- (-1715.726) [-1716.654] (-1716.579) (-1715.986) * (-1718.599) (-1717.886) [-1716.164] (-1718.131) -- 0:00:56
      163000 -- (-1715.675) [-1717.646] (-1717.817) (-1720.629) * (-1716.514) (-1717.887) (-1715.837) [-1716.666] -- 0:00:56
      163500 -- (-1716.433) [-1717.039] (-1717.626) (-1715.476) * (-1717.805) (-1718.374) [-1716.533] (-1715.776) -- 0:00:56
      164000 -- (-1717.020) (-1717.910) (-1715.605) [-1714.801] * [-1719.813] (-1718.149) (-1716.707) (-1718.879) -- 0:00:56
      164500 -- (-1718.675) (-1717.352) (-1716.350) [-1714.722] * (-1718.882) (-1716.335) [-1716.286] (-1715.167) -- 0:00:55
      165000 -- [-1719.745] (-1716.710) (-1717.004) (-1717.632) * (-1717.842) (-1715.571) [-1716.306] (-1717.989) -- 0:00:55

      Average standard deviation of split frequencies: 0.024222

      165500 -- [-1716.092] (-1718.923) (-1720.653) (-1718.767) * (-1724.801) (-1715.779) [-1715.838] (-1719.865) -- 0:00:55
      166000 -- (-1714.905) (-1718.799) (-1718.504) [-1719.780] * (-1715.205) [-1719.487] (-1717.673) (-1716.677) -- 0:00:55
      166500 -- (-1717.997) [-1717.889] (-1716.921) (-1718.277) * (-1716.178) (-1721.160) (-1717.558) [-1715.962] -- 0:00:55
      167000 -- [-1715.722] (-1719.609) (-1721.718) (-1720.057) * (-1716.037) (-1721.061) [-1716.582] (-1715.935) -- 0:00:54
      167500 -- (-1723.257) (-1719.607) (-1717.616) [-1716.787] * (-1718.024) [-1718.376] (-1715.572) (-1719.012) -- 0:00:54
      168000 -- (-1721.299) [-1718.309] (-1718.411) (-1716.949) * [-1716.904] (-1718.915) (-1715.940) (-1720.863) -- 0:00:54
      168500 -- [-1720.807] (-1717.057) (-1717.610) (-1716.841) * (-1716.530) (-1719.469) [-1717.776] (-1720.710) -- 0:00:54
      169000 -- (-1720.756) [-1723.385] (-1717.094) (-1717.336) * (-1715.168) (-1718.541) (-1721.453) [-1719.574] -- 0:00:54
      169500 -- [-1717.561] (-1720.824) (-1716.293) (-1718.259) * (-1716.450) (-1718.952) (-1718.951) [-1719.188] -- 0:00:53
      170000 -- [-1717.863] (-1719.409) (-1716.300) (-1718.140) * (-1717.738) (-1718.751) (-1716.712) [-1720.208] -- 0:00:53

      Average standard deviation of split frequencies: 0.020472

      170500 -- (-1718.487) (-1718.359) (-1716.487) [-1718.140] * [-1717.458] (-1719.174) (-1715.661) (-1719.408) -- 0:00:53
      171000 -- (-1721.840) [-1717.045] (-1718.025) (-1715.964) * (-1716.159) (-1719.645) (-1717.029) [-1718.609] -- 0:00:53
      171500 -- (-1717.777) (-1716.389) (-1718.348) [-1715.632] * (-1716.995) [-1718.442] (-1719.516) (-1718.096) -- 0:00:53
      172000 -- [-1716.982] (-1716.222) (-1722.617) (-1715.929) * [-1718.083] (-1716.480) (-1719.255) (-1721.203) -- 0:00:52
      172500 -- [-1716.220] (-1717.067) (-1721.383) (-1716.445) * [-1714.782] (-1716.515) (-1716.234) (-1720.709) -- 0:00:52
      173000 -- [-1717.068] (-1719.357) (-1717.706) (-1717.090) * (-1716.240) (-1715.376) (-1717.608) [-1718.749] -- 0:00:57
      173500 -- (-1717.569) (-1719.033) [-1718.122] (-1717.635) * (-1716.907) (-1716.473) [-1717.496] (-1719.909) -- 0:00:57
      174000 -- (-1715.987) (-1716.793) (-1717.576) [-1716.915] * [-1715.269] (-1719.222) (-1719.043) (-1716.314) -- 0:00:56
      174500 -- [-1718.350] (-1715.145) (-1716.257) (-1717.082) * (-1715.818) (-1716.481) [-1719.324] (-1718.420) -- 0:00:56
      175000 -- [-1715.044] (-1715.622) (-1715.270) (-1715.267) * (-1717.196) (-1719.126) (-1717.640) [-1716.711] -- 0:00:56

      Average standard deviation of split frequencies: 0.021279

      175500 -- (-1715.015) (-1716.598) [-1715.438] (-1715.362) * (-1721.423) (-1719.164) [-1717.191] (-1718.499) -- 0:00:56
      176000 -- (-1718.518) (-1716.506) [-1714.839] (-1715.192) * (-1716.828) (-1719.973) [-1716.242] (-1716.998) -- 0:00:56
      176500 -- (-1722.301) [-1716.339] (-1715.735) (-1715.165) * (-1715.841) (-1718.586) [-1716.941] (-1717.289) -- 0:00:55
      177000 -- [-1718.802] (-1716.305) (-1717.191) (-1715.708) * (-1722.201) (-1721.388) [-1715.578] (-1718.744) -- 0:00:55
      177500 -- (-1716.135) (-1717.041) [-1716.667] (-1715.576) * (-1716.408) (-1724.124) (-1715.682) [-1718.583] -- 0:00:55
      178000 -- (-1716.244) (-1717.302) [-1715.945] (-1715.588) * (-1716.981) (-1719.671) [-1716.219] (-1719.551) -- 0:00:55
      178500 -- [-1718.869] (-1717.579) (-1716.752) (-1718.847) * (-1716.340) (-1716.482) (-1717.261) [-1718.535] -- 0:00:55
      179000 -- (-1717.624) (-1717.062) (-1718.696) [-1715.721] * (-1715.901) (-1715.749) (-1716.698) [-1715.673] -- 0:00:55
      179500 -- [-1715.023] (-1716.360) (-1717.712) (-1717.053) * (-1715.560) (-1716.970) [-1715.860] (-1716.605) -- 0:00:54
      180000 -- (-1715.022) [-1714.995] (-1717.877) (-1718.514) * (-1715.821) [-1718.244] (-1718.699) (-1717.054) -- 0:00:54

      Average standard deviation of split frequencies: 0.021641

      180500 -- (-1714.980) [-1719.110] (-1716.086) (-1715.936) * (-1717.078) (-1721.175) (-1717.670) [-1715.115] -- 0:00:54
      181000 -- [-1714.982] (-1715.084) (-1718.741) (-1716.120) * (-1719.070) [-1716.448] (-1715.252) (-1717.715) -- 0:00:54
      181500 -- [-1715.380] (-1716.474) (-1720.901) (-1716.249) * (-1719.209) [-1719.439] (-1715.528) (-1716.050) -- 0:00:54
      182000 -- (-1714.782) (-1717.396) [-1716.125] (-1714.976) * [-1724.745] (-1722.310) (-1717.344) (-1716.154) -- 0:00:53
      182500 -- (-1718.264) (-1719.047) (-1716.205) [-1715.014] * (-1724.044) (-1720.322) [-1717.171] (-1716.952) -- 0:00:53
      183000 -- [-1719.031] (-1717.307) (-1715.293) (-1716.821) * (-1716.927) (-1717.002) [-1715.796] (-1718.735) -- 0:00:53
      183500 -- (-1717.250) (-1718.829) [-1715.893] (-1717.965) * [-1716.259] (-1716.509) (-1717.115) (-1714.782) -- 0:00:53
      184000 -- [-1717.661] (-1720.720) (-1716.738) (-1718.190) * (-1718.806) (-1717.063) [-1717.918] (-1718.335) -- 0:00:53
      184500 -- (-1717.924) (-1723.420) (-1716.463) [-1718.196] * (-1716.469) (-1716.874) [-1718.992] (-1718.976) -- 0:00:53
      185000 -- [-1715.729] (-1716.301) (-1716.948) (-1719.174) * [-1716.974] (-1715.750) (-1716.756) (-1718.976) -- 0:00:52

      Average standard deviation of split frequencies: 0.020698

      185500 -- (-1716.082) [-1716.475] (-1718.104) (-1717.424) * (-1718.974) (-1716.015) [-1715.314] (-1716.909) -- 0:00:52
      186000 -- (-1717.584) (-1716.862) [-1715.434] (-1717.548) * [-1716.251] (-1717.054) (-1717.831) (-1718.365) -- 0:00:52
      186500 -- (-1717.934) [-1717.050] (-1717.570) (-1716.242) * (-1714.920) [-1716.312] (-1717.500) (-1717.154) -- 0:00:52
      187000 -- [-1717.800] (-1718.219) (-1715.489) (-1717.350) * (-1715.002) [-1716.380] (-1715.268) (-1717.280) -- 0:00:52
      187500 -- (-1716.620) (-1717.536) [-1716.799] (-1721.509) * (-1715.048) [-1716.332] (-1715.517) (-1717.506) -- 0:00:52
      188000 -- [-1717.302] (-1717.834) (-1717.040) (-1718.533) * [-1715.069] (-1717.201) (-1715.991) (-1716.396) -- 0:00:51
      188500 -- (-1717.786) (-1718.631) (-1717.049) [-1716.876] * (-1717.346) [-1718.527] (-1718.082) (-1716.158) -- 0:00:55
      189000 -- (-1717.938) (-1716.252) (-1719.379) [-1719.679] * (-1716.460) (-1718.005) [-1715.655] (-1714.702) -- 0:00:55
      189500 -- [-1717.716] (-1715.773) (-1721.632) (-1716.339) * (-1714.805) (-1717.339) [-1715.039] (-1715.871) -- 0:00:55
      190000 -- (-1718.895) [-1715.222] (-1719.133) (-1716.103) * (-1714.732) [-1716.809] (-1716.147) (-1716.271) -- 0:00:55

      Average standard deviation of split frequencies: 0.017719

      190500 -- (-1717.709) [-1715.276] (-1718.556) (-1718.411) * [-1715.308] (-1716.809) (-1716.962) (-1716.184) -- 0:00:55
      191000 -- (-1717.836) [-1716.195] (-1719.202) (-1717.478) * (-1716.662) (-1718.581) (-1715.271) [-1716.091] -- 0:00:55
      191500 -- (-1716.125) [-1716.186] (-1718.183) (-1719.849) * [-1715.151] (-1723.208) (-1715.233) (-1720.236) -- 0:00:54
      192000 -- [-1717.452] (-1716.731) (-1719.064) (-1722.388) * (-1716.343) (-1717.291) [-1715.978] (-1714.832) -- 0:00:54
      192500 -- [-1716.645] (-1717.083) (-1715.804) (-1720.969) * (-1716.391) [-1717.690] (-1717.844) (-1717.523) -- 0:00:54
      193000 -- (-1716.594) [-1715.852] (-1717.793) (-1717.958) * (-1716.014) (-1719.234) (-1717.425) [-1715.799] -- 0:00:54
      193500 -- (-1718.079) [-1715.469] (-1718.665) (-1717.775) * (-1715.235) [-1719.191] (-1716.460) (-1715.072) -- 0:00:54
      194000 -- (-1716.525) (-1717.820) (-1716.479) [-1717.096] * (-1716.053) (-1716.687) [-1716.435] (-1715.072) -- 0:00:54
      194500 -- (-1717.425) (-1717.992) (-1716.563) [-1717.167] * (-1716.634) (-1717.620) (-1717.764) [-1716.140] -- 0:00:53
      195000 -- (-1716.373) (-1715.467) [-1717.347] (-1716.938) * (-1716.972) (-1716.864) (-1718.983) [-1716.036] -- 0:00:53

      Average standard deviation of split frequencies: 0.016962

      195500 -- (-1715.698) (-1714.937) [-1717.510] (-1718.579) * [-1714.713] (-1719.890) (-1718.219) (-1717.389) -- 0:00:53
      196000 -- [-1715.734] (-1714.937) (-1720.447) (-1717.804) * (-1714.740) [-1716.817] (-1717.825) (-1720.438) -- 0:00:53
      196500 -- [-1716.529] (-1716.247) (-1717.156) (-1718.505) * (-1714.608) [-1716.336] (-1716.324) (-1721.434) -- 0:00:53
      197000 -- (-1719.524) (-1716.859) (-1722.804) [-1719.532] * [-1714.924] (-1717.267) (-1717.319) (-1716.031) -- 0:00:52
      197500 -- [-1718.082] (-1717.571) (-1718.928) (-1721.753) * (-1715.251) (-1715.873) [-1717.569] (-1714.815) -- 0:00:52
      198000 -- (-1719.846) (-1716.886) (-1717.233) [-1716.758] * (-1718.194) (-1715.506) [-1717.725] (-1717.301) -- 0:00:52
      198500 -- (-1716.234) (-1717.493) (-1718.357) [-1717.392] * (-1716.658) [-1717.219] (-1717.928) (-1715.296) -- 0:00:52
      199000 -- (-1716.948) (-1715.814) (-1717.485) [-1715.707] * (-1716.877) (-1717.474) (-1720.608) [-1715.540] -- 0:00:52
      199500 -- [-1719.559] (-1716.648) (-1716.820) (-1716.725) * (-1716.536) (-1720.315) [-1717.575] (-1715.906) -- 0:00:52
      200000 -- (-1716.294) [-1715.491] (-1716.812) (-1718.396) * (-1717.796) (-1718.741) [-1717.425] (-1715.916) -- 0:00:51

      Average standard deviation of split frequencies: 0.016583

      200500 -- [-1715.933] (-1716.365) (-1717.826) (-1716.475) * (-1714.866) (-1718.979) (-1717.494) [-1717.573] -- 0:00:51
      201000 -- (-1715.483) (-1717.438) (-1717.804) [-1720.216] * (-1722.865) [-1722.918] (-1717.507) (-1717.590) -- 0:00:51
      201500 -- (-1715.822) [-1723.070] (-1716.924) (-1717.080) * (-1721.225) (-1721.405) (-1719.376) [-1715.397] -- 0:00:51
      202000 -- (-1714.979) (-1723.424) (-1716.949) [-1715.973] * (-1717.597) (-1719.604) [-1718.125] (-1715.793) -- 0:00:51
      202500 -- (-1715.584) (-1720.219) [-1716.031] (-1716.018) * [-1717.227] (-1717.957) (-1720.111) (-1715.571) -- 0:00:51
      203000 -- (-1716.309) (-1717.540) [-1717.943] (-1716.064) * [-1716.202] (-1719.529) (-1720.355) (-1715.876) -- 0:00:51
      203500 -- (-1715.170) (-1716.012) (-1718.423) [-1720.504] * (-1715.498) (-1718.999) (-1719.506) [-1715.648] -- 0:00:50
      204000 -- [-1715.170] (-1715.726) (-1717.295) (-1718.182) * (-1715.136) (-1717.903) [-1716.564] (-1715.648) -- 0:00:54
      204500 -- [-1716.913] (-1716.959) (-1718.053) (-1715.610) * (-1714.854) (-1717.246) (-1716.700) [-1717.400] -- 0:00:54
      205000 -- (-1717.333) (-1716.560) [-1719.265] (-1716.069) * (-1715.535) [-1717.042] (-1717.192) (-1715.162) -- 0:00:54

      Average standard deviation of split frequencies: 0.015884

      205500 -- (-1718.394) [-1716.861] (-1719.863) (-1716.274) * (-1714.850) (-1717.294) [-1718.692] (-1716.806) -- 0:00:54
      206000 -- (-1715.600) (-1717.213) (-1718.748) [-1716.978] * [-1716.583] (-1717.231) (-1719.241) (-1716.736) -- 0:00:53
      206500 -- (-1718.261) (-1725.077) (-1717.243) [-1716.856] * (-1718.409) [-1716.263] (-1716.269) (-1718.663) -- 0:00:53
      207000 -- (-1715.878) (-1719.603) [-1718.205] (-1716.449) * (-1715.871) (-1715.295) [-1717.134] (-1717.608) -- 0:00:53
      207500 -- [-1719.315] (-1717.350) (-1716.861) (-1716.878) * (-1715.811) (-1720.194) [-1715.986] (-1716.495) -- 0:00:53
      208000 -- (-1719.243) (-1718.011) (-1714.901) [-1717.325] * [-1715.811] (-1716.690) (-1719.345) (-1716.499) -- 0:00:53
      208500 -- (-1716.836) (-1719.238) (-1721.102) [-1718.012] * (-1715.577) (-1715.430) (-1722.612) [-1716.174] -- 0:00:53
      209000 -- [-1717.173] (-1718.131) (-1718.952) (-1717.825) * [-1715.178] (-1720.584) (-1716.591) (-1715.927) -- 0:00:52
      209500 -- [-1718.462] (-1716.918) (-1718.807) (-1715.615) * (-1716.355) (-1718.450) (-1716.284) [-1724.845] -- 0:00:52
      210000 -- (-1716.728) [-1715.266] (-1716.808) (-1718.278) * (-1717.917) (-1717.104) [-1717.746] (-1724.754) -- 0:00:52

      Average standard deviation of split frequencies: 0.016454

      210500 -- (-1715.899) [-1715.700] (-1717.420) (-1716.804) * (-1717.693) (-1716.198) [-1717.160] (-1722.748) -- 0:00:52
      211000 -- (-1716.108) [-1716.288] (-1717.396) (-1715.642) * (-1715.888) (-1717.710) (-1718.144) [-1715.789] -- 0:00:52
      211500 -- (-1717.031) (-1716.298) (-1720.207) [-1717.532] * (-1717.823) (-1719.588) (-1718.617) [-1719.303] -- 0:00:52
      212000 -- (-1719.854) [-1719.341] (-1717.010) (-1715.108) * (-1716.864) (-1720.198) [-1716.650] (-1723.215) -- 0:00:52
      212500 -- (-1720.695) (-1718.345) [-1718.983] (-1715.915) * (-1716.091) (-1718.348) (-1718.295) [-1717.896] -- 0:00:51
      213000 -- (-1718.495) (-1716.817) (-1720.304) [-1716.099] * (-1715.888) [-1719.068] (-1718.264) (-1719.078) -- 0:00:51
      213500 -- (-1719.187) [-1717.022] (-1715.847) (-1716.920) * (-1716.518) (-1723.995) [-1716.207] (-1717.961) -- 0:00:51
      214000 -- (-1716.321) [-1716.116] (-1716.901) (-1718.375) * [-1715.351] (-1719.221) (-1715.594) (-1715.819) -- 0:00:51
      214500 -- (-1716.043) (-1716.546) [-1716.814] (-1718.504) * (-1716.786) (-1715.581) [-1717.221] (-1716.458) -- 0:00:51
      215000 -- (-1715.634) [-1717.633] (-1717.713) (-1716.107) * (-1716.003) (-1718.581) (-1720.050) [-1719.330] -- 0:00:51

      Average standard deviation of split frequencies: 0.014892

      215500 -- (-1715.244) (-1719.264) (-1718.785) [-1716.231] * (-1715.931) (-1719.618) [-1717.685] (-1720.525) -- 0:00:50
      216000 -- (-1715.377) [-1719.090] (-1720.418) (-1718.038) * (-1715.962) (-1719.504) [-1718.168] (-1721.776) -- 0:00:50
      216500 -- (-1717.091) (-1715.229) (-1716.676) [-1718.095] * [-1717.337] (-1716.677) (-1716.223) (-1721.925) -- 0:00:50
      217000 -- (-1714.941) (-1715.390) [-1715.472] (-1721.930) * (-1720.910) [-1716.261] (-1715.304) (-1722.667) -- 0:00:50
      217500 -- [-1716.984] (-1715.380) (-1718.612) (-1720.748) * (-1719.062) [-1715.754] (-1717.400) (-1717.059) -- 0:00:50
      218000 -- (-1720.725) (-1715.872) (-1716.771) [-1719.469] * (-1715.541) (-1717.418) (-1715.844) [-1715.233] -- 0:00:50
      218500 -- (-1716.090) (-1718.785) (-1716.752) [-1718.280] * (-1718.471) [-1716.683] (-1718.529) (-1716.959) -- 0:00:50
      219000 -- (-1715.791) [-1716.125] (-1717.080) (-1716.433) * (-1719.320) (-1721.868) (-1715.963) [-1716.663] -- 0:00:49
      219500 -- (-1719.033) (-1715.336) [-1715.495] (-1715.328) * (-1717.068) (-1719.946) (-1715.962) [-1715.354] -- 0:00:49
      220000 -- [-1718.729] (-1717.309) (-1716.337) (-1719.559) * (-1719.360) [-1720.583] (-1715.891) (-1718.931) -- 0:00:53

      Average standard deviation of split frequencies: 0.014828

      220500 -- (-1717.242) (-1717.200) [-1714.847] (-1719.307) * [-1716.844] (-1717.314) (-1715.795) (-1718.954) -- 0:00:53
      221000 -- (-1718.844) (-1715.506) [-1719.849] (-1717.202) * (-1716.760) [-1719.044] (-1716.188) (-1717.102) -- 0:00:52
      221500 -- (-1718.172) (-1716.581) (-1717.752) [-1714.794] * (-1716.181) (-1719.376) [-1715.327] (-1718.283) -- 0:00:52
      222000 -- (-1714.701) (-1716.659) (-1717.842) [-1717.542] * (-1715.083) (-1719.343) [-1715.073] (-1721.568) -- 0:00:52
      222500 -- (-1716.704) [-1718.478] (-1716.189) (-1719.195) * [-1716.653] (-1720.663) (-1715.886) (-1715.988) -- 0:00:52
      223000 -- (-1716.094) [-1717.956] (-1717.808) (-1719.435) * (-1718.189) (-1718.504) [-1715.312] (-1716.030) -- 0:00:52
      223500 -- (-1716.094) (-1716.405) (-1715.997) [-1716.393] * [-1718.584] (-1716.541) (-1720.681) (-1719.939) -- 0:00:52
      224000 -- (-1716.307) (-1717.319) [-1716.442] (-1718.137) * (-1720.226) (-1717.216) [-1716.205] (-1719.088) -- 0:00:51
      224500 -- (-1719.543) [-1716.086] (-1715.889) (-1717.907) * (-1719.530) (-1717.366) [-1715.157] (-1719.844) -- 0:00:51
      225000 -- (-1715.099) (-1717.672) [-1715.176] (-1717.956) * (-1717.790) (-1716.816) (-1715.646) [-1716.201] -- 0:00:51

      Average standard deviation of split frequencies: 0.014253

      225500 -- (-1716.106) (-1717.638) [-1716.212] (-1717.973) * (-1716.207) (-1717.354) (-1718.017) [-1715.903] -- 0:00:51
      226000 -- (-1716.209) (-1715.778) [-1714.833] (-1719.539) * (-1717.055) (-1717.663) [-1716.472] (-1721.900) -- 0:00:51
      226500 -- (-1720.150) (-1716.599) (-1715.007) [-1715.437] * (-1717.103) (-1716.682) (-1718.164) [-1716.991] -- 0:00:51
      227000 -- (-1719.441) (-1717.622) (-1715.247) [-1717.534] * [-1719.421] (-1715.293) (-1720.447) (-1717.179) -- 0:00:51
      227500 -- [-1719.455] (-1715.468) (-1717.375) (-1718.413) * (-1722.338) (-1715.308) (-1717.818) [-1716.256] -- 0:00:50
      228000 -- (-1716.265) (-1716.461) (-1721.523) [-1717.103] * (-1717.908) [-1716.682] (-1721.838) (-1715.967) -- 0:00:50
      228500 -- (-1716.957) (-1717.066) [-1715.580] (-1720.992) * (-1715.341) (-1716.141) [-1717.313] (-1716.144) -- 0:00:50
      229000 -- (-1716.516) [-1717.010] (-1715.234) (-1717.443) * [-1715.851] (-1717.087) (-1717.771) (-1717.565) -- 0:00:50
      229500 -- (-1717.142) (-1715.645) [-1714.853] (-1717.769) * (-1721.065) [-1715.555] (-1716.190) (-1718.878) -- 0:00:50
      230000 -- [-1717.802] (-1718.760) (-1716.983) (-1717.620) * (-1723.921) (-1715.626) (-1717.390) [-1718.653] -- 0:00:50

      Average standard deviation of split frequencies: 0.013397

      230500 -- [-1717.420] (-1716.554) (-1715.713) (-1715.544) * (-1718.048) (-1716.020) [-1715.484] (-1721.945) -- 0:00:50
      231000 -- (-1718.274) [-1716.862] (-1715.556) (-1717.960) * (-1717.370) (-1718.486) [-1719.045] (-1717.335) -- 0:00:49
      231500 -- (-1719.377) [-1715.966] (-1718.804) (-1715.330) * [-1717.896] (-1715.226) (-1718.571) (-1717.449) -- 0:00:49
      232000 -- (-1717.510) (-1720.201) [-1716.999] (-1719.564) * (-1718.780) [-1715.392] (-1718.662) (-1716.896) -- 0:00:49
      232500 -- [-1717.510] (-1718.013) (-1717.592) (-1720.740) * [-1719.691] (-1715.915) (-1718.504) (-1715.524) -- 0:00:49
      233000 -- (-1719.423) [-1720.791] (-1720.358) (-1720.731) * (-1719.273) (-1715.680) (-1717.236) [-1716.609] -- 0:00:49
      233500 -- (-1718.019) (-1718.501) [-1717.149] (-1718.735) * [-1721.408] (-1719.125) (-1720.745) (-1717.389) -- 0:00:49
      234000 -- (-1715.387) (-1722.404) [-1715.147] (-1720.225) * (-1720.562) [-1716.577] (-1717.979) (-1717.126) -- 0:00:49
      234500 -- (-1716.186) (-1717.165) [-1717.774] (-1718.539) * (-1721.942) [-1715.288] (-1716.563) (-1719.330) -- 0:00:48
      235000 -- [-1715.238] (-1715.414) (-1716.741) (-1717.004) * [-1717.726] (-1719.459) (-1715.992) (-1717.157) -- 0:00:48

      Average standard deviation of split frequencies: 0.013982

      235500 -- (-1716.085) (-1715.386) [-1716.023] (-1717.832) * (-1717.071) [-1719.745] (-1716.503) (-1720.819) -- 0:00:51
      236000 -- (-1716.349) [-1717.187] (-1716.053) (-1717.300) * (-1720.538) (-1717.400) [-1716.832] (-1722.116) -- 0:00:51
      236500 -- (-1718.301) (-1715.604) [-1716.704] (-1721.438) * (-1720.112) [-1717.897] (-1716.878) (-1715.631) -- 0:00:51
      237000 -- (-1715.973) (-1715.588) (-1720.334) [-1719.565] * (-1717.603) (-1718.974) (-1715.198) [-1714.925] -- 0:00:51
      237500 -- [-1715.564] (-1717.399) (-1718.349) (-1715.139) * (-1718.175) (-1716.238) [-1715.635] (-1717.430) -- 0:00:51
      238000 -- (-1716.378) (-1716.645) [-1717.921] (-1716.466) * (-1720.909) (-1716.821) [-1715.587] (-1718.615) -- 0:00:51
      238500 -- (-1717.232) (-1716.652) [-1715.055] (-1719.055) * (-1719.649) [-1715.300] (-1715.291) (-1720.962) -- 0:00:51
      239000 -- (-1717.296) (-1718.310) [-1715.186] (-1719.351) * (-1718.098) (-1715.105) (-1718.976) [-1719.331] -- 0:00:50
      239500 -- (-1717.683) [-1717.504] (-1715.996) (-1720.381) * (-1720.510) [-1715.807] (-1717.337) (-1719.029) -- 0:00:50
      240000 -- (-1715.257) (-1717.189) (-1717.636) [-1716.701] * [-1718.274] (-1716.362) (-1716.618) (-1720.900) -- 0:00:50

      Average standard deviation of split frequencies: 0.012854

      240500 -- [-1715.384] (-1717.506) (-1717.721) (-1716.385) * (-1720.162) (-1716.253) (-1716.856) [-1719.690] -- 0:00:50
      241000 -- [-1715.090] (-1715.845) (-1719.224) (-1724.359) * [-1718.165] (-1718.611) (-1715.351) (-1716.967) -- 0:00:50
      241500 -- (-1714.915) (-1717.794) [-1717.030] (-1722.526) * (-1716.987) [-1721.628] (-1716.827) (-1716.838) -- 0:00:50
      242000 -- [-1718.714] (-1718.532) (-1717.079) (-1719.505) * (-1718.772) (-1718.847) [-1716.976] (-1716.511) -- 0:00:50
      242500 -- (-1717.789) (-1717.253) (-1717.474) [-1717.676] * [-1717.783] (-1720.610) (-1718.675) (-1717.245) -- 0:00:49
      243000 -- (-1716.384) (-1717.250) [-1714.989] (-1717.938) * (-1719.470) [-1718.525] (-1719.723) (-1716.658) -- 0:00:49
      243500 -- (-1725.143) (-1718.004) [-1715.139] (-1716.420) * (-1717.781) (-1719.238) [-1717.445] (-1717.583) -- 0:00:49
      244000 -- [-1719.685] (-1716.774) (-1718.322) (-1719.150) * (-1716.794) (-1724.550) [-1716.157] (-1715.341) -- 0:00:49
      244500 -- (-1717.741) (-1717.930) (-1716.734) [-1716.746] * (-1715.733) [-1716.399] (-1717.532) (-1715.027) -- 0:00:49
      245000 -- (-1721.004) (-1717.837) (-1719.431) [-1716.421] * (-1715.915) [-1716.286] (-1719.448) (-1714.880) -- 0:00:49

      Average standard deviation of split frequencies: 0.012399

      245500 -- (-1721.875) (-1715.488) (-1720.813) [-1716.720] * (-1717.136) (-1717.196) (-1715.681) [-1714.875] -- 0:00:49
      246000 -- (-1720.098) [-1716.189] (-1719.653) (-1717.999) * (-1717.589) (-1716.757) (-1715.145) [-1717.880] -- 0:00:49
      246500 -- [-1716.804] (-1720.119) (-1718.221) (-1717.877) * (-1715.620) (-1717.528) [-1715.166] (-1717.840) -- 0:00:48
      247000 -- (-1720.430) [-1718.984] (-1717.190) (-1716.983) * (-1715.697) (-1718.891) [-1715.213] (-1715.567) -- 0:00:48
      247500 -- (-1718.021) (-1718.000) (-1717.538) [-1715.702] * [-1715.854] (-1717.137) (-1715.111) (-1717.112) -- 0:00:48
      248000 -- (-1718.423) [-1716.538] (-1716.212) (-1715.822) * (-1715.518) (-1716.855) [-1716.069] (-1716.845) -- 0:00:48
      248500 -- (-1716.930) [-1715.098] (-1717.751) (-1715.756) * [-1715.826] (-1718.311) (-1726.266) (-1718.253) -- 0:00:48
      249000 -- [-1716.161] (-1715.094) (-1716.865) (-1717.584) * (-1716.338) [-1717.497] (-1726.229) (-1717.190) -- 0:00:48
      249500 -- [-1716.545] (-1716.700) (-1716.244) (-1715.808) * (-1717.037) [-1715.350] (-1718.618) (-1715.523) -- 0:00:48
      250000 -- [-1716.169] (-1716.729) (-1715.994) (-1715.815) * (-1717.488) (-1715.938) [-1716.559] (-1716.780) -- 0:00:48

      Average standard deviation of split frequencies: 0.012106

      250500 -- (-1719.048) (-1717.859) [-1715.370] (-1716.021) * (-1718.340) (-1716.133) [-1716.512] (-1717.571) -- 0:00:47
      251000 -- (-1719.904) (-1718.474) [-1715.811] (-1716.049) * (-1716.698) [-1719.917] (-1718.362) (-1723.318) -- 0:00:50
      251500 -- (-1719.053) [-1717.741] (-1716.688) (-1716.245) * (-1715.917) (-1715.001) (-1717.967) [-1723.484] -- 0:00:50
      252000 -- [-1717.909] (-1717.765) (-1715.444) (-1717.303) * (-1717.643) [-1715.869] (-1717.177) (-1717.605) -- 0:00:50
      252500 -- (-1718.465) (-1716.085) (-1715.786) [-1716.278] * (-1718.709) (-1715.093) [-1717.230] (-1716.474) -- 0:00:50
      253000 -- [-1718.358] (-1722.255) (-1716.176) (-1716.576) * (-1715.915) (-1715.517) [-1715.216] (-1718.125) -- 0:00:50
      253500 -- (-1716.193) (-1715.906) [-1717.808] (-1716.420) * [-1716.736] (-1722.176) (-1716.414) (-1716.217) -- 0:00:50
      254000 -- (-1718.267) (-1719.275) [-1718.364] (-1715.668) * (-1720.481) [-1715.346] (-1716.432) (-1716.356) -- 0:00:49
      254500 -- (-1716.459) (-1716.178) (-1717.737) [-1715.609] * (-1719.101) (-1720.236) (-1716.236) [-1716.086] -- 0:00:49
      255000 -- [-1715.914] (-1716.863) (-1720.967) (-1716.272) * (-1718.097) [-1716.785] (-1715.810) (-1716.941) -- 0:00:49

      Average standard deviation of split frequencies: 0.012276

      255500 -- [-1715.472] (-1715.102) (-1720.430) (-1715.689) * (-1717.375) (-1714.835) (-1715.275) [-1715.874] -- 0:00:49
      256000 -- [-1715.535] (-1715.256) (-1715.763) (-1715.697) * [-1718.644] (-1717.985) (-1717.652) (-1715.195) -- 0:00:49
      256500 -- (-1716.813) (-1716.113) (-1716.397) [-1715.663] * (-1716.182) [-1718.418] (-1716.937) (-1717.687) -- 0:00:49
      257000 -- (-1716.497) (-1716.041) [-1717.130] (-1717.754) * [-1715.766] (-1717.108) (-1719.737) (-1715.347) -- 0:00:49
      257500 -- (-1716.908) (-1718.926) (-1718.171) [-1714.901] * (-1715.313) (-1717.527) (-1722.855) [-1715.980] -- 0:00:49
      258000 -- (-1719.042) (-1722.091) [-1716.925] (-1718.038) * (-1715.400) (-1717.859) (-1717.967) [-1715.772] -- 0:00:48
      258500 -- [-1717.176] (-1720.013) (-1717.988) (-1718.687) * (-1714.821) (-1718.718) (-1716.698) [-1716.705] -- 0:00:48
      259000 -- [-1718.822] (-1722.935) (-1717.131) (-1722.022) * [-1715.027] (-1717.348) (-1715.414) (-1716.477) -- 0:00:48
      259500 -- (-1720.444) (-1721.551) [-1716.449] (-1721.374) * (-1715.583) (-1717.388) [-1716.192] (-1714.830) -- 0:00:48
      260000 -- (-1717.756) [-1717.901] (-1718.176) (-1716.937) * (-1715.590) (-1718.413) (-1716.802) [-1715.129] -- 0:00:48

      Average standard deviation of split frequencies: 0.012433

      260500 -- [-1716.798] (-1721.153) (-1716.602) (-1717.382) * (-1716.008) (-1718.826) (-1716.343) [-1715.593] -- 0:00:48
      261000 -- (-1716.111) (-1718.125) (-1721.068) [-1717.499] * [-1715.286] (-1718.242) (-1719.315) (-1719.438) -- 0:00:48
      261500 -- [-1716.619] (-1720.796) (-1719.002) (-1716.997) * (-1715.333) (-1715.350) [-1715.223] (-1715.800) -- 0:00:48
      262000 -- (-1717.550) (-1715.660) (-1717.275) [-1715.690] * (-1717.995) (-1715.934) (-1715.658) [-1717.457] -- 0:00:47
      262500 -- [-1717.781] (-1715.359) (-1721.428) (-1715.646) * (-1717.408) [-1716.238] (-1716.747) (-1717.017) -- 0:00:47
      263000 -- (-1717.765) [-1716.022] (-1717.837) (-1719.300) * (-1717.839) (-1716.237) (-1717.159) [-1715.991] -- 0:00:47
      263500 -- [-1716.001] (-1720.337) (-1719.706) (-1719.588) * (-1716.446) (-1715.975) (-1721.085) [-1716.607] -- 0:00:47
      264000 -- (-1719.577) (-1716.806) (-1719.832) [-1716.921] * (-1716.639) (-1715.506) (-1716.145) [-1718.687] -- 0:00:47
      264500 -- (-1716.116) (-1715.658) (-1716.933) [-1716.966] * (-1715.871) [-1716.432] (-1719.848) (-1723.663) -- 0:00:47
      265000 -- (-1715.493) [-1715.870] (-1716.081) (-1716.663) * (-1715.370) [-1719.885] (-1717.446) (-1723.913) -- 0:00:47

      Average standard deviation of split frequencies: 0.011676

      265500 -- (-1715.943) (-1715.875) (-1716.062) [-1716.827] * (-1716.229) [-1721.835] (-1715.784) (-1715.923) -- 0:00:47
      266000 -- (-1714.787) (-1715.810) [-1718.353] (-1716.541) * (-1714.778) [-1716.976] (-1715.163) (-1718.546) -- 0:00:46
      266500 -- (-1717.410) (-1717.419) (-1717.940) [-1718.431] * [-1715.567] (-1718.466) (-1717.094) (-1719.077) -- 0:00:49
      267000 -- (-1721.761) [-1715.121] (-1722.720) (-1717.540) * (-1714.560) (-1722.705) [-1716.517] (-1719.023) -- 0:00:49
      267500 -- (-1719.971) (-1717.587) [-1719.945] (-1716.210) * [-1714.751] (-1721.631) (-1717.306) (-1717.012) -- 0:00:49
      268000 -- [-1716.880] (-1716.065) (-1717.139) (-1716.238) * [-1716.345] (-1716.729) (-1718.836) (-1718.435) -- 0:00:49
      268500 -- (-1716.880) (-1716.346) [-1716.424] (-1717.347) * (-1716.183) (-1719.526) (-1719.236) [-1717.796] -- 0:00:49
      269000 -- (-1716.580) (-1716.044) (-1715.976) [-1716.879] * (-1716.802) (-1717.931) (-1721.159) [-1717.183] -- 0:00:48
      269500 -- (-1717.306) [-1715.962] (-1716.720) (-1717.308) * [-1717.795] (-1717.782) (-1716.598) (-1718.082) -- 0:00:48
      270000 -- (-1715.794) (-1715.444) (-1715.413) [-1716.872] * (-1716.371) (-1715.748) (-1715.793) [-1717.677] -- 0:00:48

      Average standard deviation of split frequencies: 0.012736

      270500 -- (-1715.580) (-1716.802) (-1716.108) [-1716.471] * (-1719.034) (-1718.556) [-1718.145] (-1718.692) -- 0:00:48
      271000 -- (-1715.284) (-1715.422) [-1715.748] (-1719.551) * [-1716.240] (-1716.998) (-1719.684) (-1716.157) -- 0:00:48
      271500 -- (-1715.294) [-1720.091] (-1717.309) (-1717.988) * [-1718.170] (-1716.678) (-1715.802) (-1716.632) -- 0:00:48
      272000 -- [-1717.187] (-1717.680) (-1715.852) (-1719.527) * (-1719.064) [-1716.820] (-1715.728) (-1717.195) -- 0:00:48
      272500 -- (-1717.844) (-1718.285) [-1716.031] (-1718.174) * (-1722.341) [-1716.625] (-1715.605) (-1715.651) -- 0:00:48
      273000 -- [-1718.001] (-1715.574) (-1720.413) (-1717.191) * (-1717.133) (-1718.444) [-1716.083] (-1715.371) -- 0:00:47
      273500 -- (-1717.815) (-1715.556) (-1715.195) [-1717.797] * (-1717.218) [-1718.714] (-1718.708) (-1714.973) -- 0:00:47
      274000 -- [-1717.268] (-1716.063) (-1716.454) (-1718.516) * [-1716.657] (-1715.476) (-1720.193) (-1715.027) -- 0:00:47
      274500 -- (-1715.452) (-1717.244) (-1718.876) [-1717.505] * (-1719.640) [-1715.679] (-1719.412) (-1715.269) -- 0:00:47
      275000 -- [-1717.308] (-1720.409) (-1719.024) (-1717.250) * (-1716.578) [-1717.003] (-1715.798) (-1716.382) -- 0:00:47

      Average standard deviation of split frequencies: 0.013237

      275500 -- (-1717.313) (-1718.132) (-1717.166) [-1715.723] * (-1716.685) (-1716.260) [-1717.737] (-1715.645) -- 0:00:47
      276000 -- [-1717.577] (-1718.855) (-1716.004) (-1715.983) * (-1718.787) (-1716.236) (-1717.793) [-1715.323] -- 0:00:47
      276500 -- (-1719.317) (-1716.421) (-1715.962) [-1716.379] * [-1716.102] (-1716.669) (-1715.283) (-1715.493) -- 0:00:47
      277000 -- [-1715.448] (-1715.539) (-1718.430) (-1715.556) * [-1716.531] (-1717.006) (-1714.799) (-1715.739) -- 0:00:46
      277500 -- (-1716.821) (-1715.946) [-1717.009] (-1718.009) * (-1719.714) (-1715.854) (-1714.937) [-1715.399] -- 0:00:46
      278000 -- [-1716.167] (-1716.571) (-1716.147) (-1720.840) * (-1716.113) (-1715.568) [-1715.258] (-1715.361) -- 0:00:46
      278500 -- (-1717.396) (-1718.403) (-1718.703) [-1717.642] * (-1716.098) (-1718.682) [-1715.705] (-1717.004) -- 0:00:46
      279000 -- (-1719.767) (-1716.965) (-1717.867) [-1715.076] * (-1717.226) (-1715.437) (-1715.674) [-1716.045] -- 0:00:46
      279500 -- (-1720.730) (-1717.014) [-1716.221] (-1716.165) * (-1720.191) (-1718.729) [-1718.099] (-1715.896) -- 0:00:46
      280000 -- (-1718.881) (-1718.482) (-1715.671) [-1715.273] * (-1717.955) (-1717.106) [-1715.393] (-1716.228) -- 0:00:46

      Average standard deviation of split frequencies: 0.014444

      280500 -- (-1718.322) [-1715.829] (-1716.633) (-1715.814) * (-1716.444) [-1716.833] (-1719.811) (-1716.181) -- 0:00:46
      281000 -- (-1729.211) (-1718.559) (-1716.508) [-1719.681] * [-1715.431] (-1716.513) (-1716.926) (-1716.997) -- 0:00:46
      281500 -- [-1720.834] (-1720.146) (-1716.432) (-1718.113) * (-1716.908) (-1715.987) (-1715.226) [-1716.062] -- 0:00:45
      282000 -- (-1718.547) [-1716.796] (-1719.678) (-1716.527) * (-1718.071) [-1717.673] (-1715.250) (-1717.917) -- 0:00:48
      282500 -- (-1718.217) (-1718.050) (-1716.819) [-1714.705] * (-1716.719) [-1715.903] (-1715.084) (-1718.156) -- 0:00:48
      283000 -- (-1716.613) (-1717.080) [-1715.538] (-1718.174) * [-1715.686] (-1717.033) (-1715.169) (-1717.581) -- 0:00:48
      283500 -- (-1715.261) [-1715.648] (-1718.709) (-1718.289) * [-1715.392] (-1718.007) (-1716.084) (-1723.064) -- 0:00:48
      284000 -- [-1716.821] (-1716.844) (-1715.864) (-1718.421) * (-1715.351) [-1715.484] (-1717.716) (-1715.000) -- 0:00:47
      284500 -- (-1720.443) (-1715.887) [-1717.524] (-1715.460) * [-1715.765] (-1718.638) (-1719.359) (-1716.646) -- 0:00:47
      285000 -- (-1722.816) (-1716.961) (-1716.211) [-1716.895] * [-1716.599] (-1719.466) (-1717.500) (-1716.277) -- 0:00:47

      Average standard deviation of split frequencies: 0.013392

      285500 -- (-1717.548) (-1715.425) [-1717.469] (-1715.799) * (-1715.499) (-1717.016) (-1721.778) [-1714.759] -- 0:00:47
      286000 -- (-1715.350) (-1715.426) [-1717.543] (-1718.134) * (-1717.646) (-1722.986) [-1717.117] (-1715.374) -- 0:00:47
      286500 -- (-1716.281) (-1716.367) (-1719.376) [-1723.742] * (-1714.907) (-1717.645) [-1715.789] (-1716.530) -- 0:00:47
      287000 -- (-1716.058) (-1717.869) (-1716.102) [-1717.197] * (-1718.765) [-1716.955] (-1715.010) (-1715.588) -- 0:00:47
      287500 -- (-1715.953) (-1715.380) (-1715.830) [-1715.339] * (-1718.882) (-1718.411) (-1715.616) [-1715.588] -- 0:00:47
      288000 -- (-1720.280) (-1715.241) (-1716.011) [-1715.206] * (-1717.317) (-1718.924) (-1717.733) [-1715.534] -- 0:00:46
      288500 -- (-1715.195) (-1716.557) (-1718.248) [-1715.087] * (-1716.531) [-1715.806] (-1716.402) (-1717.279) -- 0:00:46
      289000 -- (-1716.176) (-1717.652) [-1717.680] (-1714.996) * (-1716.889) [-1715.456] (-1715.418) (-1718.871) -- 0:00:46
      289500 -- [-1715.963] (-1718.179) (-1720.223) (-1715.341) * (-1717.101) (-1717.879) (-1718.478) [-1718.436] -- 0:00:46
      290000 -- (-1720.378) [-1717.146] (-1719.551) (-1718.230) * (-1723.553) (-1718.623) (-1716.243) [-1718.521] -- 0:00:46

      Average standard deviation of split frequencies: 0.013583

      290500 -- (-1715.303) (-1716.293) [-1716.058] (-1718.550) * [-1720.526] (-1718.353) (-1716.122) (-1719.996) -- 0:00:46
      291000 -- [-1716.408] (-1715.825) (-1718.784) (-1717.616) * (-1717.492) (-1718.276) (-1718.380) [-1718.020] -- 0:00:46
      291500 -- (-1715.025) (-1719.452) [-1717.425] (-1719.672) * (-1718.372) [-1718.323] (-1719.717) (-1717.981) -- 0:00:46
      292000 -- [-1715.435] (-1716.594) (-1716.317) (-1719.225) * (-1721.034) (-1716.586) [-1719.437] (-1718.063) -- 0:00:46
      292500 -- [-1715.364] (-1718.223) (-1717.664) (-1718.008) * (-1718.836) (-1716.586) [-1718.287] (-1720.641) -- 0:00:45
      293000 -- (-1716.291) (-1718.929) [-1717.173] (-1716.140) * [-1720.069] (-1716.579) (-1718.940) (-1715.967) -- 0:00:45
      293500 -- [-1715.876] (-1723.365) (-1719.259) (-1717.581) * [-1717.577] (-1715.625) (-1719.083) (-1717.343) -- 0:00:45
      294000 -- (-1715.313) (-1717.100) [-1716.879] (-1717.737) * [-1716.244] (-1715.006) (-1718.708) (-1720.027) -- 0:00:45
      294500 -- (-1716.434) [-1717.133] (-1717.467) (-1715.792) * (-1716.932) (-1716.164) [-1715.628] (-1721.778) -- 0:00:45
      295000 -- [-1715.795] (-1717.285) (-1714.959) (-1720.583) * (-1716.769) (-1718.975) (-1715.780) [-1727.558] -- 0:00:45

      Average standard deviation of split frequencies: 0.012542

      295500 -- (-1721.072) (-1715.641) [-1714.794] (-1716.807) * [-1716.225] (-1718.326) (-1717.355) (-1717.758) -- 0:00:45
      296000 -- (-1724.674) (-1716.258) (-1716.018) [-1719.527] * [-1719.359] (-1716.770) (-1716.550) (-1717.274) -- 0:00:45
      296500 -- [-1719.300] (-1719.776) (-1716.575) (-1720.310) * [-1717.735] (-1715.158) (-1718.796) (-1717.936) -- 0:00:45
      297000 -- (-1716.243) (-1716.446) [-1715.369] (-1715.533) * [-1718.028] (-1716.517) (-1716.950) (-1718.982) -- 0:00:44
      297500 -- (-1716.681) (-1718.565) [-1716.054] (-1716.109) * (-1716.705) [-1716.034] (-1718.368) (-1719.121) -- 0:00:47
      298000 -- [-1716.155] (-1717.195) (-1716.646) (-1715.619) * (-1716.891) (-1717.223) (-1715.940) [-1721.544] -- 0:00:47
      298500 -- (-1716.922) (-1716.409) (-1715.204) [-1716.024] * (-1716.242) (-1717.223) [-1717.251] (-1719.302) -- 0:00:47
      299000 -- (-1720.089) (-1717.904) (-1715.204) [-1718.632] * (-1715.937) (-1715.645) (-1715.110) [-1716.159] -- 0:00:46
      299500 -- (-1716.329) [-1715.871] (-1716.315) (-1717.207) * (-1717.002) [-1716.505] (-1715.351) (-1717.097) -- 0:00:46
      300000 -- (-1718.973) [-1716.453] (-1715.224) (-1715.759) * [-1717.002] (-1715.993) (-1721.582) (-1718.014) -- 0:00:46

      Average standard deviation of split frequencies: 0.012334

      300500 -- (-1717.116) (-1717.553) (-1717.448) [-1721.175] * (-1716.766) (-1715.062) [-1715.024] (-1716.966) -- 0:00:46
      301000 -- (-1715.654) (-1716.953) [-1716.684] (-1716.841) * [-1716.904] (-1716.137) (-1715.784) (-1718.507) -- 0:00:46
      301500 -- (-1715.501) (-1716.328) (-1716.245) [-1717.416] * [-1716.966] (-1717.586) (-1715.231) (-1717.949) -- 0:00:46
      302000 -- [-1718.912] (-1715.399) (-1717.559) (-1716.002) * (-1715.907) (-1715.606) (-1715.501) [-1715.881] -- 0:00:46
      302500 -- (-1715.980) (-1714.871) (-1716.187) [-1715.710] * [-1716.496] (-1718.668) (-1718.484) (-1715.182) -- 0:00:46
      303000 -- (-1717.954) [-1719.293] (-1715.141) (-1715.788) * (-1718.858) (-1716.330) (-1718.351) [-1715.546] -- 0:00:46
      303500 -- (-1715.567) (-1719.621) (-1716.184) [-1717.879] * [-1724.983] (-1718.317) (-1716.780) (-1715.871) -- 0:00:45
      304000 -- (-1715.815) (-1719.621) [-1715.483] (-1719.080) * (-1724.447) [-1717.541] (-1719.597) (-1716.011) -- 0:00:45
      304500 -- (-1719.772) (-1715.439) (-1720.129) [-1716.552] * (-1720.297) [-1719.592] (-1719.772) (-1717.585) -- 0:00:45
      305000 -- (-1718.528) [-1714.936] (-1716.184) (-1720.438) * (-1720.591) [-1717.668] (-1720.804) (-1715.646) -- 0:00:45

      Average standard deviation of split frequencies: 0.011843

      305500 -- (-1719.653) (-1715.274) [-1715.490] (-1717.705) * (-1719.426) (-1718.626) (-1725.721) [-1717.546] -- 0:00:45
      306000 -- (-1718.034) [-1715.210] (-1715.949) (-1717.858) * (-1718.481) (-1720.656) (-1717.587) [-1715.391] -- 0:00:45
      306500 -- (-1716.382) (-1715.186) [-1716.631] (-1716.426) * (-1720.247) (-1715.815) (-1716.998) [-1715.962] -- 0:00:45
      307000 -- [-1720.856] (-1716.496) (-1716.635) (-1719.931) * (-1717.019) (-1717.532) (-1716.194) [-1718.948] -- 0:00:45
      307500 -- (-1717.735) (-1716.622) (-1716.984) [-1717.159] * (-1717.498) (-1718.194) (-1714.923) [-1719.622] -- 0:00:45
      308000 -- (-1716.181) [-1718.761] (-1715.471) (-1717.858) * (-1716.497) (-1717.686) [-1715.349] (-1718.453) -- 0:00:44
      308500 -- (-1718.961) [-1718.639] (-1715.235) (-1716.815) * (-1717.683) [-1716.003] (-1718.831) (-1717.980) -- 0:00:44
      309000 -- [-1720.422] (-1716.272) (-1715.218) (-1721.887) * [-1717.953] (-1716.083) (-1715.924) (-1720.006) -- 0:00:44
      309500 -- [-1715.270] (-1717.777) (-1715.191) (-1721.878) * (-1716.219) [-1716.250] (-1716.210) (-1720.503) -- 0:00:44
      310000 -- (-1715.334) (-1716.371) [-1720.860] (-1719.325) * (-1716.940) [-1720.407] (-1717.052) (-1716.186) -- 0:00:44

      Average standard deviation of split frequencies: 0.012234

      310500 -- [-1716.265] (-1716.911) (-1723.499) (-1717.001) * (-1716.952) (-1719.696) [-1718.206] (-1717.295) -- 0:00:44
      311000 -- (-1717.371) [-1718.677] (-1718.796) (-1714.914) * [-1720.848] (-1723.327) (-1720.803) (-1718.577) -- 0:00:44
      311500 -- (-1715.790) (-1718.627) [-1717.545] (-1715.309) * [-1716.040] (-1718.262) (-1715.988) (-1717.010) -- 0:00:44
      312000 -- (-1715.703) [-1718.289] (-1716.535) (-1714.943) * (-1714.979) (-1718.515) (-1717.272) [-1715.498] -- 0:00:44
      312500 -- [-1715.537] (-1717.150) (-1718.349) (-1716.564) * [-1716.607] (-1716.966) (-1717.763) (-1715.071) -- 0:00:44
      313000 -- (-1717.515) (-1715.548) (-1721.193) [-1716.131] * (-1718.807) (-1721.440) [-1720.666] (-1715.905) -- 0:00:43
      313500 -- (-1715.919) [-1716.108] (-1720.449) (-1717.994) * (-1719.051) (-1721.534) (-1718.307) [-1715.439] -- 0:00:45
      314000 -- (-1716.717) (-1717.536) [-1715.262] (-1717.293) * (-1722.507) (-1717.543) (-1717.335) [-1715.135] -- 0:00:45
      314500 -- (-1716.577) (-1717.948) [-1716.619] (-1722.516) * (-1716.702) (-1717.674) (-1716.811) [-1715.649] -- 0:00:45
      315000 -- (-1717.468) (-1717.900) (-1717.152) [-1717.301] * (-1715.487) (-1716.846) [-1717.973] (-1716.747) -- 0:00:45

      Average standard deviation of split frequencies: 0.011536

      315500 -- (-1717.482) (-1717.586) [-1718.952] (-1718.546) * (-1716.094) (-1716.357) (-1719.160) [-1718.197] -- 0:00:45
      316000 -- (-1719.482) (-1720.220) [-1718.336] (-1720.439) * (-1717.787) [-1715.771] (-1717.487) (-1717.392) -- 0:00:45
      316500 -- (-1717.362) [-1715.339] (-1723.539) (-1718.745) * (-1719.032) [-1716.967] (-1717.401) (-1716.200) -- 0:00:45
      317000 -- (-1716.641) (-1715.802) (-1717.222) [-1718.893] * [-1716.052] (-1718.526) (-1718.241) (-1715.788) -- 0:00:45
      317500 -- [-1717.318] (-1715.280) (-1717.535) (-1725.560) * [-1715.350] (-1721.047) (-1716.315) (-1723.577) -- 0:00:45
      318000 -- [-1717.019] (-1716.954) (-1718.075) (-1717.764) * (-1715.000) (-1718.726) (-1719.294) [-1717.239] -- 0:00:45
      318500 -- [-1716.971] (-1717.798) (-1720.429) (-1718.162) * (-1717.265) (-1718.889) (-1716.203) [-1715.359] -- 0:00:44
      319000 -- (-1717.766) (-1718.050) (-1718.514) [-1719.133] * (-1717.161) [-1718.564] (-1716.920) (-1718.078) -- 0:00:44
      319500 -- (-1716.918) (-1715.820) [-1718.961] (-1720.231) * (-1716.480) [-1716.139] (-1716.838) (-1715.999) -- 0:00:44
      320000 -- (-1715.517) [-1716.016] (-1715.004) (-1717.106) * (-1719.394) [-1717.165] (-1719.119) (-1715.413) -- 0:00:44

      Average standard deviation of split frequencies: 0.011485

      320500 -- (-1719.954) (-1720.850) (-1715.493) [-1717.077] * (-1716.291) [-1716.013] (-1719.897) (-1717.065) -- 0:00:44
      321000 -- (-1720.330) [-1717.560] (-1717.205) (-1717.197) * (-1715.418) (-1716.941) [-1719.401] (-1717.462) -- 0:00:44
      321500 -- (-1717.545) (-1716.510) (-1718.603) [-1715.833] * (-1715.200) (-1717.074) [-1715.670] (-1717.974) -- 0:00:44
      322000 -- (-1718.864) (-1717.709) (-1717.731) [-1715.832] * [-1715.701] (-1717.500) (-1719.096) (-1716.644) -- 0:00:44
      322500 -- (-1717.628) [-1716.199] (-1717.254) (-1716.918) * (-1715.646) (-1718.052) (-1716.544) [-1716.507] -- 0:00:44
      323000 -- [-1716.253] (-1718.605) (-1718.508) (-1717.089) * [-1716.181] (-1720.165) (-1716.043) (-1715.490) -- 0:00:44
      323500 -- (-1715.994) (-1718.303) [-1718.115] (-1716.445) * [-1715.868] (-1716.733) (-1716.816) (-1716.148) -- 0:00:43
      324000 -- (-1721.212) (-1715.573) [-1720.622] (-1716.186) * (-1719.320) (-1718.325) [-1715.394] (-1715.916) -- 0:00:43
      324500 -- (-1717.821) (-1716.321) (-1722.975) [-1718.551] * (-1716.861) (-1718.232) [-1715.723] (-1716.692) -- 0:00:43
      325000 -- [-1716.031] (-1716.879) (-1715.806) (-1715.723) * (-1716.354) (-1721.880) (-1718.441) [-1715.228] -- 0:00:43

      Average standard deviation of split frequencies: 0.011749

      325500 -- [-1717.557] (-1717.794) (-1722.280) (-1716.262) * (-1720.164) (-1717.680) (-1715.212) [-1716.546] -- 0:00:43
      326000 -- [-1719.819] (-1716.916) (-1721.641) (-1716.254) * (-1717.985) [-1717.625] (-1715.129) (-1716.580) -- 0:00:43
      326500 -- (-1716.275) [-1716.104] (-1723.591) (-1716.169) * (-1718.661) (-1718.506) [-1715.137] (-1720.789) -- 0:00:43
      327000 -- (-1721.272) (-1716.254) (-1717.639) [-1716.096] * (-1716.521) (-1716.429) (-1717.228) [-1718.123] -- 0:00:43
      327500 -- (-1716.068) [-1715.863] (-1716.528) (-1717.987) * (-1714.598) [-1716.150] (-1721.921) (-1716.605) -- 0:00:43
      328000 -- (-1717.141) (-1716.099) [-1715.153] (-1720.035) * (-1716.639) (-1718.388) (-1717.532) [-1717.339] -- 0:00:43
      328500 -- (-1715.932) [-1718.830] (-1715.112) (-1718.168) * (-1717.497) (-1717.710) (-1719.572) [-1718.048] -- 0:00:42
      329000 -- [-1716.105] (-1715.170) (-1716.507) (-1715.520) * (-1715.598) (-1716.593) [-1716.583] (-1723.172) -- 0:00:44
      329500 -- (-1719.666) (-1715.703) (-1720.958) [-1718.384] * (-1717.623) (-1718.233) (-1717.118) [-1715.494] -- 0:00:44
      330000 -- [-1716.631] (-1718.176) (-1721.971) (-1718.080) * [-1717.622] (-1716.884) (-1716.957) (-1716.740) -- 0:00:44

      Average standard deviation of split frequencies: 0.010959

      330500 -- [-1715.073] (-1716.276) (-1717.386) (-1717.328) * (-1716.147) [-1716.029] (-1716.116) (-1716.209) -- 0:00:44
      331000 -- (-1715.300) (-1717.671) (-1719.832) [-1717.854] * (-1715.353) [-1715.500] (-1717.558) (-1717.335) -- 0:00:44
      331500 -- [-1715.510] (-1716.510) (-1725.216) (-1718.390) * (-1715.956) (-1718.059) [-1719.529] (-1725.711) -- 0:00:44
      332000 -- (-1716.692) (-1721.152) [-1716.338] (-1718.955) * (-1717.133) (-1719.279) [-1716.884] (-1726.941) -- 0:00:44
      332500 -- (-1717.440) (-1717.808) (-1716.305) [-1715.557] * (-1716.291) (-1715.421) (-1716.133) [-1717.119] -- 0:00:44
      333000 -- [-1718.620] (-1718.880) (-1715.106) (-1714.763) * [-1715.409] (-1716.031) (-1716.743) (-1716.609) -- 0:00:44
      333500 -- (-1717.546) (-1719.739) (-1715.365) [-1714.725] * (-1715.361) (-1716.148) [-1715.055] (-1715.794) -- 0:00:43
      334000 -- (-1715.173) (-1720.647) (-1717.963) [-1714.749] * (-1716.288) (-1720.008) [-1715.090] (-1714.990) -- 0:00:43
      334500 -- (-1715.090) (-1718.815) (-1717.503) [-1714.762] * (-1714.978) [-1716.426] (-1715.085) (-1717.207) -- 0:00:43
      335000 -- (-1715.183) [-1717.273] (-1716.321) (-1715.203) * (-1717.208) (-1716.425) [-1717.890] (-1720.401) -- 0:00:43

      Average standard deviation of split frequencies: 0.012276

      335500 -- (-1715.073) (-1717.484) (-1722.326) [-1716.992] * (-1718.137) (-1716.613) (-1719.349) [-1716.282] -- 0:00:43
      336000 -- (-1715.962) (-1716.780) [-1716.084] (-1717.195) * (-1720.077) (-1718.001) [-1715.107] (-1718.147) -- 0:00:43
      336500 -- (-1717.269) (-1717.915) (-1716.240) [-1716.145] * [-1716.466] (-1716.312) (-1715.810) (-1717.210) -- 0:00:43
      337000 -- [-1718.808] (-1718.617) (-1715.430) (-1716.663) * (-1716.763) (-1721.921) [-1715.339] (-1716.701) -- 0:00:43
      337500 -- (-1715.591) [-1717.197] (-1715.585) (-1715.563) * [-1716.979] (-1718.606) (-1717.333) (-1717.187) -- 0:00:43
      338000 -- (-1716.823) (-1714.925) [-1715.502] (-1719.529) * (-1719.121) [-1717.164] (-1716.874) (-1716.874) -- 0:00:43
      338500 -- (-1716.423) (-1718.033) [-1715.453] (-1719.689) * (-1717.913) (-1717.339) (-1716.009) [-1716.949] -- 0:00:42
      339000 -- (-1718.178) (-1718.002) (-1717.255) [-1715.749] * (-1715.922) (-1716.862) [-1716.058] (-1717.316) -- 0:00:42
      339500 -- (-1716.434) [-1717.411] (-1725.904) (-1715.795) * (-1716.637) (-1717.931) [-1716.698] (-1715.472) -- 0:00:42
      340000 -- (-1719.786) [-1715.186] (-1729.765) (-1716.530) * (-1716.971) (-1717.987) (-1715.462) [-1715.489] -- 0:00:42

      Average standard deviation of split frequencies: 0.012022

      340500 -- (-1723.472) (-1715.631) [-1720.735] (-1715.981) * (-1717.299) (-1721.788) [-1716.742] (-1715.798) -- 0:00:42
      341000 -- (-1719.245) (-1717.625) (-1719.000) [-1715.983] * (-1719.369) [-1718.067] (-1717.991) (-1716.120) -- 0:00:42
      341500 -- (-1722.608) (-1715.824) (-1717.327) [-1717.112] * (-1718.555) [-1715.909] (-1718.344) (-1716.349) -- 0:00:42
      342000 -- (-1722.027) [-1715.899] (-1717.049) (-1718.606) * [-1720.918] (-1716.913) (-1717.310) (-1716.619) -- 0:00:42
      342500 -- (-1719.735) (-1716.884) [-1716.915] (-1718.921) * (-1718.573) (-1716.071) (-1724.247) [-1716.606] -- 0:00:42
      343000 -- [-1717.742] (-1715.151) (-1717.506) (-1719.514) * (-1717.642) (-1715.171) (-1721.098) [-1716.449] -- 0:00:42
      343500 -- (-1716.804) (-1717.306) (-1715.451) [-1717.057] * (-1715.218) (-1715.229) [-1715.833] (-1716.076) -- 0:00:42
      344000 -- (-1720.753) (-1715.049) [-1720.129] (-1718.579) * (-1718.428) (-1716.463) [-1717.220] (-1716.092) -- 0:00:41
      344500 -- (-1717.629) (-1718.642) [-1716.032] (-1719.316) * [-1717.738] (-1717.296) (-1720.157) (-1721.346) -- 0:00:41
      345000 -- (-1721.406) (-1719.732) (-1717.112) [-1718.502] * (-1717.001) (-1716.512) (-1717.597) [-1719.940] -- 0:00:43

      Average standard deviation of split frequencies: 0.011921

      345500 -- [-1716.475] (-1719.793) (-1718.232) (-1717.124) * (-1716.277) [-1717.745] (-1716.276) (-1720.050) -- 0:00:43
      346000 -- (-1717.971) [-1715.617] (-1720.913) (-1715.870) * [-1717.029] (-1718.384) (-1716.211) (-1721.881) -- 0:00:43
      346500 -- (-1720.629) (-1716.309) (-1719.944) [-1715.602] * (-1715.990) [-1718.694] (-1719.387) (-1718.756) -- 0:00:43
      347000 -- (-1717.055) (-1716.763) (-1718.899) [-1714.787] * (-1716.342) [-1716.466] (-1719.193) (-1717.979) -- 0:00:43
      347500 -- [-1715.433] (-1717.275) (-1721.067) (-1715.037) * (-1715.459) (-1716.041) (-1716.816) [-1719.978] -- 0:00:43
      348000 -- [-1718.327] (-1721.261) (-1715.074) (-1715.763) * (-1716.099) (-1716.451) (-1716.817) [-1718.405] -- 0:00:43
      348500 -- (-1716.546) (-1717.494) (-1715.883) [-1718.910] * (-1715.987) (-1715.660) (-1715.795) [-1717.643] -- 0:00:42
      349000 -- (-1716.487) (-1715.713) [-1716.912] (-1715.004) * (-1716.557) [-1716.133] (-1715.256) (-1718.635) -- 0:00:42
      349500 -- (-1718.804) (-1715.725) (-1717.087) [-1715.205] * (-1716.156) [-1719.655] (-1719.279) (-1718.684) -- 0:00:42
      350000 -- (-1718.399) (-1717.464) (-1717.163) [-1714.961] * (-1716.156) [-1715.655] (-1716.493) (-1716.388) -- 0:00:42

      Average standard deviation of split frequencies: 0.011466

      350500 -- (-1718.748) [-1719.976] (-1715.807) (-1715.065) * (-1716.609) (-1715.475) [-1717.989] (-1715.364) -- 0:00:42
      351000 -- (-1717.382) [-1716.649] (-1719.006) (-1717.966) * (-1719.169) [-1717.975] (-1719.533) (-1716.838) -- 0:00:42
      351500 -- [-1716.927] (-1715.926) (-1718.567) (-1717.854) * (-1717.500) (-1717.023) (-1716.683) [-1719.330] -- 0:00:42
      352000 -- [-1718.269] (-1715.759) (-1719.434) (-1715.641) * (-1718.089) (-1717.574) [-1721.499] (-1719.715) -- 0:00:42
      352500 -- (-1718.573) (-1716.302) [-1716.527] (-1715.263) * (-1719.963) (-1719.799) (-1721.315) [-1721.269] -- 0:00:42
      353000 -- (-1719.525) (-1716.501) [-1714.957] (-1717.157) * (-1717.787) [-1717.859] (-1723.147) (-1717.568) -- 0:00:42
      353500 -- [-1718.242] (-1716.649) (-1716.726) (-1718.586) * (-1716.540) (-1718.084) [-1717.423] (-1716.583) -- 0:00:42
      354000 -- (-1718.912) [-1716.548] (-1722.936) (-1715.829) * (-1716.950) [-1715.475] (-1719.655) (-1718.910) -- 0:00:41
      354500 -- (-1716.997) [-1718.604] (-1717.951) (-1714.683) * [-1716.382] (-1718.709) (-1716.713) (-1715.690) -- 0:00:41
      355000 -- (-1715.538) (-1716.401) (-1718.830) [-1716.080] * (-1716.121) [-1718.356] (-1720.053) (-1715.690) -- 0:00:41

      Average standard deviation of split frequencies: 0.011684

      355500 -- (-1715.912) (-1715.986) [-1719.518] (-1719.946) * (-1718.829) [-1717.291] (-1717.670) (-1715.847) -- 0:00:41
      356000 -- (-1714.886) [-1716.125] (-1717.459) (-1719.257) * [-1715.123] (-1717.025) (-1717.557) (-1717.655) -- 0:00:41
      356500 -- [-1716.028] (-1716.536) (-1717.521) (-1719.196) * [-1717.105] (-1717.677) (-1717.328) (-1715.117) -- 0:00:41
      357000 -- (-1716.028) (-1715.999) (-1719.698) [-1715.408] * [-1716.814] (-1716.890) (-1718.827) (-1715.388) -- 0:00:41
      357500 -- (-1715.137) (-1719.531) [-1717.920] (-1715.362) * (-1716.705) (-1717.305) (-1715.974) [-1715.009] -- 0:00:41
      358000 -- (-1716.490) (-1720.149) (-1721.058) [-1717.105] * [-1717.393] (-1715.234) (-1718.731) (-1716.611) -- 0:00:41
      358500 -- (-1716.190) [-1717.132] (-1717.223) (-1720.299) * [-1715.510] (-1717.426) (-1719.165) (-1720.729) -- 0:00:41
      359000 -- (-1719.154) (-1717.053) [-1715.713] (-1716.886) * (-1715.265) (-1716.115) (-1716.826) [-1719.900] -- 0:00:41
      359500 -- (-1716.627) (-1717.590) [-1716.068] (-1715.455) * [-1718.699] (-1716.961) (-1718.951) (-1717.522) -- 0:00:40
      360000 -- [-1715.853] (-1717.336) (-1716.697) (-1715.029) * (-1720.434) (-1716.207) (-1715.550) [-1717.245] -- 0:00:40

      Average standard deviation of split frequencies: 0.011763

      360500 -- (-1716.580) (-1716.104) (-1716.366) [-1716.102] * [-1716.685] (-1716.846) (-1716.170) (-1719.285) -- 0:00:42
      361000 -- [-1716.862] (-1716.864) (-1716.441) (-1715.387) * (-1717.564) (-1716.593) (-1716.386) [-1718.654] -- 0:00:42
      361500 -- (-1716.915) (-1715.331) [-1716.124] (-1715.912) * [-1722.496] (-1716.004) (-1715.482) (-1718.587) -- 0:00:42
      362000 -- (-1716.211) [-1715.155] (-1716.144) (-1715.912) * [-1719.889] (-1715.797) (-1715.506) (-1716.485) -- 0:00:42
      362500 -- (-1715.785) (-1717.272) [-1715.542] (-1714.851) * (-1719.405) (-1716.660) [-1718.573] (-1716.016) -- 0:00:42
      363000 -- (-1716.222) (-1721.775) (-1717.160) [-1715.269] * (-1720.401) (-1717.295) [-1716.804] (-1717.624) -- 0:00:42
      363500 -- [-1716.153] (-1719.566) (-1715.710) (-1720.420) * (-1718.769) [-1716.207] (-1716.191) (-1716.442) -- 0:00:42
      364000 -- (-1719.038) (-1721.374) (-1715.684) [-1717.765] * (-1718.111) (-1716.603) [-1716.519] (-1716.196) -- 0:00:41
      364500 -- [-1719.987] (-1715.357) (-1716.296) (-1716.057) * [-1715.954] (-1716.873) (-1719.133) (-1716.226) -- 0:00:41
      365000 -- (-1718.377) [-1716.559] (-1716.693) (-1715.868) * (-1717.453) [-1717.556] (-1716.736) (-1720.597) -- 0:00:41

      Average standard deviation of split frequencies: 0.013287

      365500 -- (-1717.311) [-1716.031] (-1717.343) (-1717.003) * (-1718.024) [-1715.231] (-1716.667) (-1716.456) -- 0:00:41
      366000 -- (-1716.757) [-1718.068] (-1715.817) (-1716.841) * (-1715.655) (-1719.077) (-1716.224) [-1716.083] -- 0:00:41
      366500 -- [-1715.346] (-1717.511) (-1716.020) (-1715.671) * (-1715.208) [-1716.259] (-1716.218) (-1716.741) -- 0:00:41
      367000 -- (-1716.221) (-1716.391) [-1715.355] (-1717.092) * (-1715.217) (-1716.897) [-1718.834] (-1715.877) -- 0:00:41
      367500 -- [-1716.118] (-1717.901) (-1718.338) (-1717.791) * (-1716.749) [-1716.038] (-1716.210) (-1715.141) -- 0:00:41
      368000 -- (-1716.737) [-1718.910] (-1718.106) (-1717.351) * [-1716.648] (-1718.579) (-1716.952) (-1715.714) -- 0:00:41
      368500 -- (-1718.300) (-1716.870) (-1717.720) [-1719.617] * (-1716.459) (-1719.200) [-1716.392] (-1715.022) -- 0:00:41
      369000 -- [-1717.132] (-1718.409) (-1716.774) (-1718.579) * (-1717.213) (-1718.568) (-1716.464) [-1717.168] -- 0:00:41
      369500 -- (-1717.517) [-1717.410] (-1716.063) (-1717.283) * (-1716.456) (-1715.359) [-1715.343] (-1715.716) -- 0:00:40
      370000 -- (-1717.085) (-1719.546) (-1716.481) [-1716.368] * (-1718.581) (-1716.403) [-1718.802] (-1715.293) -- 0:00:40

      Average standard deviation of split frequencies: 0.013923

      370500 -- (-1717.725) (-1718.069) (-1718.580) [-1717.705] * [-1716.694] (-1718.204) (-1716.029) (-1718.729) -- 0:00:40
      371000 -- (-1717.697) (-1717.005) [-1716.535] (-1715.304) * [-1716.460] (-1718.721) (-1716.234) (-1719.817) -- 0:00:40
      371500 -- (-1718.985) (-1716.839) (-1718.230) [-1715.172] * (-1716.314) [-1718.954] (-1722.904) (-1718.984) -- 0:00:40
      372000 -- [-1718.181] (-1715.852) (-1718.694) (-1717.162) * (-1717.371) [-1715.291] (-1719.781) (-1718.742) -- 0:00:40
      372500 -- (-1719.489) (-1715.513) [-1717.870] (-1716.475) * (-1715.764) [-1715.510] (-1720.457) (-1718.511) -- 0:00:40
      373000 -- (-1716.263) [-1717.291] (-1716.213) (-1715.903) * (-1715.590) [-1715.082] (-1719.547) (-1717.108) -- 0:00:40
      373500 -- (-1717.326) (-1715.833) (-1720.608) [-1717.112] * [-1715.602] (-1718.443) (-1718.450) (-1716.280) -- 0:00:40
      374000 -- (-1715.498) (-1716.102) [-1715.434] (-1717.840) * (-1715.556) (-1716.860) (-1719.351) [-1715.350] -- 0:00:40
      374500 -- (-1717.584) (-1716.106) (-1715.442) [-1716.437] * (-1723.188) (-1715.513) [-1718.216] (-1716.472) -- 0:00:40
      375000 -- [-1715.646] (-1716.675) (-1716.629) (-1716.049) * (-1716.183) (-1715.866) [-1720.003] (-1715.826) -- 0:00:40

      Average standard deviation of split frequencies: 0.014000

      375500 -- (-1719.874) (-1718.461) [-1717.272] (-1715.890) * (-1716.101) (-1721.025) [-1715.626] (-1716.816) -- 0:00:39
      376000 -- (-1715.111) [-1716.138] (-1715.761) (-1715.891) * (-1715.213) (-1717.189) [-1716.265] (-1716.595) -- 0:00:39
      376500 -- [-1714.612] (-1721.857) (-1720.012) (-1718.217) * (-1715.696) (-1720.268) [-1717.061] (-1716.108) -- 0:00:41
      377000 -- (-1715.488) (-1715.999) [-1715.826] (-1717.685) * (-1718.754) (-1716.291) [-1717.034] (-1716.108) -- 0:00:41
      377500 -- (-1716.297) [-1715.239] (-1715.872) (-1717.260) * (-1718.037) (-1715.505) [-1716.779] (-1718.778) -- 0:00:41
      378000 -- (-1716.275) (-1715.493) (-1715.772) [-1720.485] * [-1716.629] (-1718.465) (-1715.401) (-1715.984) -- 0:00:41
      378500 -- (-1719.047) (-1716.673) (-1715.928) [-1716.356] * (-1714.954) [-1717.050] (-1716.644) (-1717.865) -- 0:00:41
      379000 -- (-1716.485) (-1716.449) (-1717.474) [-1714.829] * (-1716.005) [-1716.233] (-1717.554) (-1719.469) -- 0:00:40
      379500 -- [-1715.726] (-1717.139) (-1716.831) (-1719.480) * (-1717.315) (-1715.893) (-1718.229) [-1716.963] -- 0:00:40
      380000 -- (-1718.347) (-1718.762) [-1716.989] (-1718.747) * (-1719.678) (-1715.564) (-1716.276) [-1717.009] -- 0:00:40

      Average standard deviation of split frequencies: 0.014350

      380500 -- (-1718.741) (-1720.310) (-1717.998) [-1715.696] * (-1718.048) (-1716.154) [-1718.513] (-1714.983) -- 0:00:40
      381000 -- (-1715.749) (-1717.058) (-1719.000) [-1720.547] * (-1719.486) (-1719.333) (-1717.130) [-1715.857] -- 0:00:40
      381500 -- (-1716.518) (-1717.343) (-1717.798) [-1715.336] * (-1717.091) [-1717.430] (-1716.778) (-1716.923) -- 0:00:40
      382000 -- (-1716.552) (-1716.953) [-1717.217] (-1718.589) * [-1716.588] (-1716.911) (-1718.127) (-1715.591) -- 0:00:40
      382500 -- (-1716.678) (-1716.789) [-1716.874] (-1717.885) * (-1715.919) [-1719.665] (-1718.747) (-1717.188) -- 0:00:40
      383000 -- [-1715.002] (-1716.506) (-1717.082) (-1716.900) * (-1718.424) [-1715.400] (-1721.468) (-1719.368) -- 0:00:40
      383500 -- (-1717.681) (-1716.012) (-1716.441) [-1715.681] * (-1715.342) [-1717.088] (-1721.053) (-1718.280) -- 0:00:40
      384000 -- (-1717.212) (-1718.770) (-1718.066) [-1717.240] * [-1715.149] (-1715.033) (-1715.309) (-1716.246) -- 0:00:40
      384500 -- (-1715.926) [-1719.837] (-1715.527) (-1721.986) * (-1715.669) (-1718.483) [-1714.968] (-1715.376) -- 0:00:40
      385000 -- [-1716.120] (-1717.844) (-1715.749) (-1723.838) * (-1716.308) (-1718.459) (-1715.335) [-1720.497] -- 0:00:39

      Average standard deviation of split frequencies: 0.015086

      385500 -- (-1718.638) [-1718.125] (-1715.780) (-1718.809) * (-1716.732) (-1715.918) (-1715.102) [-1714.945] -- 0:00:39
      386000 -- (-1717.640) (-1717.286) [-1717.655] (-1716.719) * (-1716.857) [-1715.202] (-1715.253) (-1717.510) -- 0:00:39
      386500 -- (-1720.742) (-1715.892) (-1715.150) [-1719.669] * (-1716.569) (-1717.554) [-1715.860] (-1721.954) -- 0:00:39
      387000 -- (-1717.932) (-1716.972) [-1715.473] (-1716.662) * (-1721.483) (-1716.327) (-1715.530) [-1719.522] -- 0:00:39
      387500 -- (-1719.216) [-1715.204] (-1715.785) (-1716.945) * (-1731.618) [-1718.052] (-1715.530) (-1716.726) -- 0:00:39
      388000 -- (-1716.995) (-1716.263) [-1716.429] (-1718.000) * (-1722.747) [-1718.209] (-1715.985) (-1716.644) -- 0:00:39
      388500 -- [-1716.380] (-1719.479) (-1716.908) (-1717.080) * (-1721.606) (-1715.443) [-1717.500] (-1716.356) -- 0:00:39
      389000 -- (-1716.236) (-1716.513) [-1716.401] (-1719.311) * (-1720.147) (-1718.433) (-1717.001) [-1720.251] -- 0:00:39
      389500 -- [-1715.662] (-1719.392) (-1720.559) (-1718.670) * [-1720.772] (-1717.115) (-1718.591) (-1718.822) -- 0:00:39
      390000 -- (-1715.335) (-1719.132) (-1717.950) [-1716.439] * (-1717.840) (-1720.590) [-1717.641] (-1717.014) -- 0:00:39

      Average standard deviation of split frequencies: 0.014480

      390500 -- (-1718.754) [-1718.335] (-1717.681) (-1717.032) * (-1723.277) (-1720.290) (-1717.724) [-1718.463] -- 0:00:39
      391000 -- (-1717.617) (-1721.074) [-1715.992] (-1716.867) * [-1720.310] (-1716.293) (-1715.821) (-1720.220) -- 0:00:38
      391500 -- (-1718.561) (-1717.322) [-1716.227] (-1720.949) * (-1721.804) [-1717.652] (-1718.242) (-1721.961) -- 0:00:38
      392000 -- (-1720.030) [-1716.165] (-1717.246) (-1718.960) * (-1715.856) (-1716.392) (-1716.669) [-1724.456] -- 0:00:40
      392500 -- (-1715.026) [-1716.600] (-1718.749) (-1717.900) * [-1716.124] (-1717.315) (-1716.503) (-1716.951) -- 0:00:40
      393000 -- (-1717.406) [-1714.894] (-1715.869) (-1717.811) * (-1717.707) (-1716.358) (-1716.537) [-1716.285] -- 0:00:40
      393500 -- (-1717.641) [-1715.890] (-1717.944) (-1718.937) * (-1716.313) [-1716.886] (-1718.251) (-1717.884) -- 0:00:40
      394000 -- (-1716.844) [-1717.064] (-1717.125) (-1719.945) * (-1716.222) [-1716.403] (-1719.122) (-1715.969) -- 0:00:39
      394500 -- (-1716.091) (-1717.125) [-1715.530] (-1719.279) * (-1717.042) [-1718.975] (-1720.770) (-1715.406) -- 0:00:39
      395000 -- (-1718.257) (-1716.102) (-1720.154) [-1716.281] * (-1719.349) [-1719.393] (-1715.817) (-1716.780) -- 0:00:39

      Average standard deviation of split frequencies: 0.014355

      395500 -- (-1718.541) (-1718.547) (-1720.595) [-1714.989] * (-1716.497) [-1717.924] (-1715.995) (-1715.662) -- 0:00:39
      396000 -- (-1717.893) (-1717.093) (-1717.206) [-1714.996] * (-1717.542) (-1719.942) [-1718.022] (-1718.974) -- 0:00:39
      396500 -- (-1717.140) (-1717.912) [-1719.825] (-1719.420) * (-1716.848) (-1715.313) [-1718.428] (-1718.134) -- 0:00:39
      397000 -- (-1717.351) (-1719.965) (-1720.616) [-1717.696] * [-1716.111] (-1718.330) (-1717.230) (-1716.962) -- 0:00:39
      397500 -- (-1715.951) (-1715.665) (-1716.859) [-1717.416] * [-1716.654] (-1718.241) (-1716.987) (-1716.278) -- 0:00:39
      398000 -- (-1716.204) (-1716.246) [-1715.545] (-1719.996) * [-1715.894] (-1717.730) (-1716.942) (-1716.543) -- 0:00:39
      398500 -- (-1717.276) (-1717.451) [-1715.542] (-1716.191) * (-1718.956) (-1715.966) [-1715.057] (-1716.874) -- 0:00:39
      399000 -- (-1716.090) (-1717.425) (-1718.349) [-1718.253] * (-1717.054) [-1717.681] (-1716.132) (-1720.604) -- 0:00:39
      399500 -- [-1718.400] (-1716.700) (-1718.279) (-1721.427) * (-1716.843) [-1717.246] (-1715.359) (-1717.718) -- 0:00:39
      400000 -- (-1718.803) [-1717.108] (-1719.138) (-1719.605) * [-1715.794] (-1717.919) (-1716.768) (-1717.185) -- 0:00:39

      Average standard deviation of split frequencies: 0.014326

      400500 -- (-1722.762) (-1716.363) [-1718.713] (-1715.585) * (-1717.464) [-1718.436] (-1718.136) (-1717.111) -- 0:00:38
      401000 -- (-1718.464) [-1714.981] (-1719.601) (-1718.763) * (-1718.568) (-1719.811) (-1720.954) [-1717.581] -- 0:00:38
      401500 -- [-1716.093] (-1716.440) (-1719.024) (-1718.762) * (-1718.004) (-1718.273) [-1716.856] (-1717.519) -- 0:00:38
      402000 -- (-1715.395) (-1715.241) [-1718.003] (-1718.408) * (-1715.853) (-1718.814) (-1719.471) [-1716.581] -- 0:00:38
      402500 -- (-1716.275) (-1717.793) (-1718.643) [-1717.336] * (-1715.310) (-1714.938) [-1719.016] (-1717.055) -- 0:00:38
      403000 -- [-1715.233] (-1717.510) (-1715.624) (-1716.198) * [-1719.108] (-1715.053) (-1715.691) (-1716.161) -- 0:00:38
      403500 -- (-1716.857) (-1717.886) (-1716.806) [-1716.239] * (-1718.920) (-1715.856) [-1715.662] (-1719.243) -- 0:00:38
      404000 -- (-1722.286) (-1721.546) (-1717.777) [-1716.331] * (-1715.026) (-1716.368) (-1717.389) [-1716.445] -- 0:00:38
      404500 -- (-1720.211) (-1718.655) (-1717.230) [-1718.164] * (-1715.005) (-1719.316) (-1716.044) [-1716.105] -- 0:00:38
      405000 -- (-1719.443) (-1717.550) (-1717.388) [-1717.930] * (-1716.023) (-1715.696) [-1715.530] (-1718.418) -- 0:00:38

      Average standard deviation of split frequencies: 0.015417

      405500 -- (-1718.313) (-1718.060) (-1718.938) [-1715.797] * (-1716.049) (-1715.809) [-1715.365] (-1717.544) -- 0:00:38
      406000 -- (-1717.722) (-1718.270) (-1718.132) [-1716.983] * [-1716.014] (-1715.833) (-1718.396) (-1718.633) -- 0:00:38
      406500 -- (-1717.743) [-1719.193] (-1714.869) (-1718.562) * (-1714.762) [-1716.502] (-1716.756) (-1715.199) -- 0:00:37
      407000 -- [-1717.402] (-1719.850) (-1716.768) (-1716.916) * [-1718.315] (-1716.036) (-1715.354) (-1718.157) -- 0:00:37
      407500 -- (-1716.815) (-1717.039) (-1718.335) [-1716.447] * (-1718.213) (-1716.603) [-1717.912] (-1716.883) -- 0:00:39
      408000 -- [-1715.165] (-1717.500) (-1716.348) (-1716.499) * (-1715.601) (-1716.918) (-1716.001) [-1715.666] -- 0:00:39
      408500 -- (-1717.190) (-1717.397) (-1715.411) [-1716.309] * [-1716.250] (-1715.324) (-1715.707) (-1718.094) -- 0:00:39
      409000 -- [-1716.696] (-1715.944) (-1718.008) (-1718.623) * (-1717.725) [-1715.939] (-1715.603) (-1718.345) -- 0:00:39
      409500 -- (-1715.092) [-1716.060] (-1718.607) (-1719.374) * [-1718.029] (-1718.585) (-1716.956) (-1717.125) -- 0:00:38
      410000 -- (-1715.756) (-1718.405) (-1718.283) [-1716.439] * (-1716.745) (-1720.128) (-1717.197) [-1717.524] -- 0:00:38

      Average standard deviation of split frequencies: 0.016573

      410500 -- [-1716.988] (-1717.414) (-1719.265) (-1715.334) * (-1716.213) (-1718.714) (-1718.127) [-1715.777] -- 0:00:38
      411000 -- (-1716.878) (-1717.969) (-1715.580) [-1715.631] * (-1715.637) (-1718.196) (-1721.204) [-1716.450] -- 0:00:38
      411500 -- (-1717.341) (-1719.864) (-1718.353) [-1715.421] * (-1715.844) (-1722.781) (-1716.314) [-1717.776] -- 0:00:38
      412000 -- (-1716.008) (-1716.558) (-1717.552) [-1715.950] * (-1715.690) (-1717.180) (-1714.732) [-1715.916] -- 0:00:38
      412500 -- (-1719.412) [-1716.387] (-1715.939) (-1719.446) * (-1715.731) [-1717.862] (-1716.004) (-1715.765) -- 0:00:38
      413000 -- (-1717.493) (-1715.851) (-1718.654) [-1714.965] * (-1715.731) (-1717.510) [-1719.044] (-1717.341) -- 0:00:38
      413500 -- (-1717.906) (-1716.239) [-1717.479] (-1715.829) * (-1715.614) (-1717.572) (-1714.833) [-1714.965] -- 0:00:38
      414000 -- [-1718.206] (-1715.772) (-1717.620) (-1716.514) * [-1718.058] (-1717.985) (-1714.688) (-1714.934) -- 0:00:38
      414500 -- (-1717.434) (-1716.514) [-1716.918] (-1715.033) * (-1720.839) (-1715.861) (-1715.661) [-1715.584] -- 0:00:38
      415000 -- (-1717.503) [-1716.051] (-1717.142) (-1715.024) * [-1716.137] (-1715.441) (-1719.972) (-1722.093) -- 0:00:38

      Average standard deviation of split frequencies: 0.015015

      415500 -- [-1717.503] (-1715.771) (-1717.449) (-1715.193) * [-1715.432] (-1716.533) (-1717.964) (-1719.628) -- 0:00:37
      416000 -- (-1717.431) (-1715.804) (-1719.430) [-1715.588] * (-1715.436) (-1716.964) (-1721.746) [-1715.893] -- 0:00:37
      416500 -- [-1716.374] (-1717.643) (-1717.046) (-1718.246) * (-1715.714) (-1715.375) (-1720.617) [-1717.934] -- 0:00:37
      417000 -- (-1716.473) (-1715.946) [-1716.649] (-1717.215) * [-1715.668] (-1715.482) (-1717.346) (-1720.735) -- 0:00:37
      417500 -- [-1715.958] (-1715.560) (-1718.949) (-1718.093) * (-1715.587) [-1714.965] (-1717.372) (-1719.178) -- 0:00:37
      418000 -- (-1718.202) (-1715.560) [-1717.832] (-1715.682) * (-1719.383) [-1714.788] (-1720.266) (-1717.893) -- 0:00:37
      418500 -- [-1714.908] (-1715.932) (-1720.883) (-1718.013) * (-1716.292) [-1714.788] (-1717.826) (-1717.030) -- 0:00:37
      419000 -- (-1716.125) (-1718.287) (-1715.735) [-1719.707] * (-1716.799) (-1722.314) [-1716.168] (-1716.119) -- 0:00:37
      419500 -- (-1717.249) (-1717.691) (-1715.120) [-1718.553] * (-1721.111) (-1716.695) [-1716.251] (-1717.689) -- 0:00:37
      420000 -- (-1716.005) (-1717.578) [-1716.614] (-1717.762) * (-1717.801) [-1715.897] (-1716.251) (-1716.130) -- 0:00:37

      Average standard deviation of split frequencies: 0.014148

      420500 -- (-1715.639) [-1718.725] (-1719.427) (-1716.969) * [-1716.594] (-1715.087) (-1720.047) (-1716.953) -- 0:00:37
      421000 -- [-1715.263] (-1717.330) (-1720.064) (-1718.435) * (-1715.993) [-1716.097] (-1715.047) (-1717.403) -- 0:00:37
      421500 -- (-1715.355) (-1716.448) (-1717.132) [-1717.055] * (-1717.651) (-1716.002) [-1715.207] (-1716.775) -- 0:00:37
      422000 -- (-1716.810) (-1717.024) [-1716.401] (-1719.622) * (-1715.120) (-1716.042) [-1715.208] (-1716.108) -- 0:00:36
      422500 -- (-1714.859) (-1719.520) [-1715.347] (-1716.894) * [-1715.754] (-1715.270) (-1716.069) (-1722.666) -- 0:00:36
      423000 -- (-1714.859) (-1716.724) [-1714.823] (-1717.900) * (-1715.971) (-1716.131) (-1717.904) [-1717.240] -- 0:00:38
      423500 -- (-1714.832) (-1716.871) (-1714.704) [-1717.622] * (-1716.663) (-1718.721) [-1718.216] (-1718.509) -- 0:00:38
      424000 -- [-1715.875] (-1715.743) (-1714.760) (-1716.181) * [-1715.877] (-1717.310) (-1718.361) (-1715.938) -- 0:00:38
      424500 -- (-1715.927) (-1716.078) (-1715.951) [-1715.158] * [-1715.854] (-1720.184) (-1717.706) (-1718.049) -- 0:00:37
      425000 -- (-1716.135) [-1716.086] (-1716.071) (-1719.972) * [-1716.468] (-1719.475) (-1716.970) (-1719.832) -- 0:00:37

      Average standard deviation of split frequencies: 0.014316

      425500 -- (