>C1
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
>C2
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
>C3
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
>C4
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
>C5
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
>C6
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=292
C1 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
C2 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
C3 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
C4 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
C5 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
C6 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
**************************************************
C1 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
C2 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
C3 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
C4 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
C5 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
C6 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
**************************************************
C1 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
C2 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
C3 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
C4 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
C5 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
C6 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
**************************************************
C1 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
C2 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
C3 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
C4 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
C5 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
C6 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
**************************************************
C1 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
C2 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
C3 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
C4 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
C5 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
C6 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
**************************************************
C1 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
C2 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
C3 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
C4 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
C5 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
C6 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
******************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 292 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 292 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8760]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8760]--->[8760]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.505 Mb, Max= 30.852 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
C2 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
C3 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
C4 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
C5 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
C6 MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
**************************************************
C1 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
C2 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
C3 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
C4 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
C5 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
C6 PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
**************************************************
C1 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
C2 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
C3 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
C4 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
C5 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
C6 PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
**************************************************
C1 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
C2 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
C3 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
C4 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
C5 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
C6 WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
**************************************************
C1 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
C2 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
C3 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
C4 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
C5 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
C6 GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
**************************************************
C1 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
C2 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
C3 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
C4 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
C5 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
C6 NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
C2 ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
C3 ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
C4 ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
C5 ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
C6 ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
**************************************************
C1 GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
C2 GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
C3 GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
C4 GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
C5 GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
C6 GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
**************************************************
C1 CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
C2 CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
C3 CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
C4 CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
C5 CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
C6 CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
**************************************************
C1 CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
C2 CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
C3 CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
C4 CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
C5 CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
C6 CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
**************************************************
C1 CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
C2 CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
C3 CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
C4 CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
C5 CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
C6 CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
**************************************************
C1 TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
C2 TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
C3 TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
C4 TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
C5 TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
C6 TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
**************************************************
C1 CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
C2 CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
C3 CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
C4 CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
C5 CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
C6 CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
**************************************************
C1 ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
C2 ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
C3 ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
C4 ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
C5 ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
C6 ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
**************************************************
C1 CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
C2 CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
C3 CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
C4 CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
C5 CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
C6 CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
**************************************************
C1 TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
C2 TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
C3 TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
C4 TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
C5 TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
C6 TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
**************************************************
C1 TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
C2 TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
C3 TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
C4 TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
C5 TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
C6 TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
**************************************************
C1 CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
C2 CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
C3 CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
C4 CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
C5 CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
C6 CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
**************************************************
C1 GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
C2 GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
C3 GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
C4 GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
C5 GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
C6 GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
**************************************************
C1 CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
C2 CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
C3 CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
C4 CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
C5 CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
C6 CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
**************************************************
C1 CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
C2 CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
C3 CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
C4 CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
C5 CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
C6 CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
**************************************************
C1 AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
C2 AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
C3 AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
C4 AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
C5 AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
C6 AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
**************************************************
C1 ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
C2 ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
C3 ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
C4 ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
C5 ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
C6 ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
**************************************************
C1 GGAAGATCTGCCAGTCCCCTAGCGGC
C2 GGAAGATCTGCCAGTCCCCTAGCGGC
C3 GGAAGATCTGCCAGTCCCCTAGCGGC
C4 GGAAGATCTGCCAGTCCCCTAGCGGC
C5 GGAAGATCTGCCAGTCCCCTAGCGGC
C6 GGAAGATCTGCCAGTCCCCTAGCGGC
**************************
>C1
ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
GGAAGATCTGCCAGTCCCCTAGCGGC
>C2
ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
GGAAGATCTGCCAGTCCCCTAGCGGC
>C3
ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
GGAAGATCTGCCAGTCCCCTAGCGGC
>C4
ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
GGAAGATCTGCCAGTCCCCTAGCGGC
>C5
ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
GGAAGATCTGCCAGTCCCCTAGCGGC
>C6
ATGCCTAATGCATCCGAGCCCGAACGCGGCATCACACTAAACCGCCCCGG
GTTGGCTCCACGCACTTTGGATAAGAACGTCGTGTCCAATCTACCCGAAG
CCAAAGACAACCCGGCCATGACTCACGGCGAAGAGATCGCCGCAGGCTAC
CCACTAGCGCATAGCGACTCGGAAACCGAGGCGATGGTACTAACCAAAAC
CGAGCCAGACCAAGATCCCGGGGCAGACAGACAGCATCACGAGCGCCGCT
TCACCGCACCCGGCTTCGACGCCAGAGCGACCGCCATCATGGCCACTGCA
CCGGATCCCGCGACCGAAGCCATCCACCCTCCCTTAAGCTCGTCCGATCC
ACCAGGACATCTAGGGATTTCCCCAAAAGCTGCTGTACCACAATCGATTC
CACCCGTGCTAGGAACTAAGTTGCGGTCAGCTCGACATTTTCATTGGGGC
TGGGTGGTGGCGCTGCTCATGATGGTGTTGGCGTTAGCGGCGATCGCAAT
TCTCGGCACCGTGCTGCTGACCCGTGGTAAACACGTGAAAGCCTCGCCGG
CAGAACAGGTTCGGCACGCCATCCAGAGCTTTGACGTCGCGGTGCAAACC
GGCAACCTGACGGCGTTGCGCTCTATAACCTGCGGTACCACCCGCGACGG
CTACGTGGAGTACGATGAGTCCTCGTGGGACGAGACGTACCACAGAGTTT
CAGCGGCCAAACAATATCCGGTGATCGCCAGCATCGACCAGGTCGTCGTG
AACGGCCAACACGCCGAAGCAAACATCACCACGTTCATGGCCTACGACCC
ACAGGTCCGCTCGACACGCAGCCTTGACCTGCAGTTCTGCGACGATCAAT
GGAAGATCTGCCAGTCCCCTAGCGGC
>C1
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
>C2
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
>C3
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
>C4
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
>C5
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
>C6
MPNASEPERGITLNRPGLAPRTLDKNVVSNLPEAKDNPAMTHGEEIAAGY
PLAHSDSETEAMVLTKTEPDQDPGADRQHHERRFTAPGFDARATAIMATA
PDPATEAIHPPLSSSDPPGHLGISPKAAVPQSIPPVLGTKLRSARHFHWG
WVVALLMMVLALAAIAILGTVLLTRGKHVKASPAEQVRHAIQSFDVAVQT
GNLTALRSITCGTTRDGYVEYDESSWDETYHRVSAAKQYPVIASIDQVVV
NGQHAEANITTFMAYDPQVRSTRSLDLQFCDDQWKICQSPSG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 876 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579799128
Setting output file names to "/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 65262435
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0014066759
Seed = 2074522738
Swapseed = 1579799128
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1960.530005 -- -24.965149
Chain 2 -- -1960.530005 -- -24.965149
Chain 3 -- -1960.529894 -- -24.965149
Chain 4 -- -1960.529894 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1960.530005 -- -24.965149
Chain 2 -- -1960.530005 -- -24.965149
Chain 3 -- -1960.530005 -- -24.965149
Chain 4 -- -1960.529894 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1960.530] (-1960.530) (-1960.530) (-1960.530) * [-1960.530] (-1960.530) (-1960.530) (-1960.530)
500 -- (-1198.377) [-1204.190] (-1197.065) (-1216.787) * [-1197.238] (-1206.425) (-1207.490) (-1203.419) -- 0:00:00
1000 -- (-1199.961) (-1203.789) [-1194.294] (-1203.788) * (-1197.586) [-1201.678] (-1198.894) (-1204.993) -- 0:00:00
1500 -- (-1199.554) (-1202.681) [-1200.215] (-1200.355) * (-1197.407) [-1197.407] (-1196.993) (-1205.413) -- 0:00:00
2000 -- (-1202.290) (-1198.577) (-1201.997) [-1199.066] * [-1200.351] (-1200.404) (-1209.213) (-1204.294) -- 0:00:00
2500 -- (-1198.317) (-1200.134) [-1198.575] (-1197.086) * (-1201.392) [-1202.121] (-1198.361) (-1201.568) -- 0:00:00
3000 -- (-1199.108) (-1197.445) [-1198.269] (-1200.217) * (-1198.700) (-1198.112) [-1195.758] (-1198.103) -- 0:00:00
3500 -- (-1203.312) (-1201.990) [-1206.135] (-1194.279) * (-1201.480) [-1195.166] (-1205.957) (-1200.119) -- 0:00:00
4000 -- (-1205.432) (-1201.837) (-1197.454) [-1198.767] * (-1200.932) (-1197.143) [-1195.582] (-1199.028) -- 0:00:00
4500 -- (-1198.724) (-1208.133) (-1207.568) [-1197.543] * (-1200.086) [-1205.904] (-1213.746) (-1198.859) -- 0:00:00
5000 -- [-1201.010] (-1204.302) (-1202.431) (-1196.351) * (-1198.326) [-1203.394] (-1205.215) (-1198.829) -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- (-1199.147) [-1201.950] (-1200.580) (-1201.876) * (-1196.639) (-1210.559) (-1197.558) [-1194.748] -- 0:00:00
6000 -- (-1199.379) (-1197.753) [-1197.784] (-1198.391) * (-1202.633) (-1201.385) (-1202.853) [-1206.228] -- 0:00:00
6500 -- (-1203.441) [-1195.849] (-1195.842) (-1197.451) * (-1204.116) (-1195.196) (-1203.204) [-1196.456] -- 0:00:00
7000 -- (-1198.434) (-1204.890) [-1196.634] (-1197.577) * (-1198.234) (-1207.613) [-1206.399] (-1200.589) -- 0:00:00
7500 -- (-1203.911) [-1198.703] (-1201.030) (-1202.299) * (-1197.204) (-1198.885) [-1199.499] (-1205.062) -- 0:00:00
8000 -- (-1197.641) (-1200.386) (-1203.403) [-1197.049] * (-1205.889) (-1198.752) (-1197.870) [-1206.572] -- 0:02:04
8500 -- (-1207.690) [-1199.585] (-1195.450) (-1209.112) * (-1216.159) (-1200.349) [-1197.472] (-1205.889) -- 0:01:56
9000 -- (-1207.111) [-1196.459] (-1199.015) (-1200.259) * (-1200.094) (-1202.138) [-1201.575] (-1203.691) -- 0:01:50
9500 -- (-1194.873) (-1196.070) [-1200.156] (-1209.408) * (-1202.736) (-1199.564) [-1200.189] (-1203.965) -- 0:01:44
10000 -- (-1201.360) (-1208.547) [-1204.957] (-1203.625) * (-1197.925) (-1196.685) [-1196.631] (-1200.037) -- 0:01:39
Average standard deviation of split frequencies: 0.061381
10500 -- (-1197.030) (-1200.558) [-1198.461] (-1204.456) * (-1204.032) (-1202.210) [-1199.414] (-1202.870) -- 0:01:34
11000 -- (-1203.475) (-1202.109) [-1197.697] (-1201.134) * [-1198.095] (-1199.148) (-1202.026) (-1207.728) -- 0:01:29
11500 -- (-1200.577) [-1199.770] (-1209.098) (-1197.597) * [-1199.812] (-1203.915) (-1205.360) (-1197.585) -- 0:01:25
12000 -- (-1204.241) [-1197.425] (-1201.838) (-1207.946) * [-1200.230] (-1208.304) (-1199.532) (-1200.589) -- 0:01:22
12500 -- (-1198.503) (-1197.211) [-1195.928] (-1206.287) * [-1200.598] (-1202.210) (-1200.451) (-1197.835) -- 0:01:19
13000 -- [-1201.226] (-1199.806) (-1202.668) (-1201.262) * (-1200.641) [-1197.628] (-1201.672) (-1209.775) -- 0:01:15
13500 -- (-1201.576) [-1198.409] (-1200.923) (-1203.487) * (-1197.479) (-1207.713) [-1199.493] (-1206.365) -- 0:01:13
14000 -- (-1203.841) [-1195.537] (-1199.949) (-1194.757) * [-1197.821] (-1202.474) (-1202.682) (-1198.303) -- 0:01:10
14500 -- [-1195.956] (-1197.703) (-1201.907) (-1200.381) * (-1199.459) [-1198.234] (-1193.248) (-1208.089) -- 0:01:07
15000 -- [-1200.028] (-1206.946) (-1201.335) (-1202.876) * (-1205.541) (-1202.490) (-1193.826) [-1195.082] -- 0:01:05
Average standard deviation of split frequencies: 0.066961
15500 -- (-1203.449) (-1200.594) [-1199.460] (-1206.757) * [-1196.415] (-1201.805) (-1190.021) (-1199.276) -- 0:01:03
16000 -- (-1199.859) (-1203.557) (-1202.921) [-1195.890] * (-1201.401) (-1198.896) [-1190.677] (-1196.723) -- 0:01:01
16500 -- (-1196.525) (-1201.243) [-1198.371] (-1196.197) * (-1208.291) (-1202.316) [-1190.102] (-1196.420) -- 0:00:59
17000 -- (-1194.941) (-1214.492) [-1200.206] (-1202.973) * (-1204.601) [-1207.042] (-1190.295) (-1210.478) -- 0:00:57
17500 -- (-1200.655) (-1204.871) (-1203.467) [-1197.254] * [-1199.211] (-1197.059) (-1189.817) (-1203.578) -- 0:00:56
18000 -- [-1202.062] (-1198.798) (-1201.871) (-1200.044) * (-1198.230) (-1192.288) [-1191.440] (-1201.966) -- 0:00:54
18500 -- (-1207.312) [-1199.933] (-1197.966) (-1201.519) * (-1199.154) [-1192.327] (-1190.785) (-1201.763) -- 0:00:53
19000 -- (-1194.097) [-1195.429] (-1208.102) (-1198.718) * (-1201.391) (-1190.964) (-1191.584) [-1196.257] -- 0:00:51
19500 -- (-1201.311) (-1199.706) (-1195.130) [-1201.412] * [-1193.838] (-1191.980) (-1190.916) (-1201.060) -- 0:00:50
20000 -- (-1198.220) [-1204.102] (-1206.102) (-1202.726) * (-1202.312) [-1189.879] (-1190.876) (-1208.859) -- 0:00:49
Average standard deviation of split frequencies: 0.063361
20500 -- (-1202.635) (-1201.692) [-1201.671] (-1201.304) * [-1195.438] (-1191.979) (-1190.290) (-1199.670) -- 0:00:47
21000 -- (-1204.936) [-1203.364] (-1197.399) (-1203.608) * [-1200.137] (-1192.799) (-1191.381) (-1196.757) -- 0:00:46
21500 -- (-1197.923) [-1203.383] (-1198.904) (-1204.672) * (-1197.743) (-1192.621) [-1191.775] (-1197.846) -- 0:00:45
22000 -- (-1199.552) (-1202.944) [-1199.246] (-1206.545) * [-1201.884] (-1193.492) (-1191.850) (-1206.405) -- 0:00:44
22500 -- (-1202.865) (-1201.483) (-1206.930) [-1201.703] * (-1192.984) (-1192.945) [-1189.895] (-1193.837) -- 0:00:43
23000 -- (-1202.660) [-1199.451] (-1203.445) (-1200.028) * (-1203.210) (-1190.647) [-1192.758] (-1190.765) -- 0:00:42
23500 -- (-1201.574) [-1198.062] (-1197.389) (-1206.514) * (-1201.535) (-1194.225) (-1192.828) [-1191.905] -- 0:01:23
24000 -- (-1198.368) [-1198.199] (-1196.211) (-1203.471) * (-1200.248) (-1190.178) (-1194.537) [-1190.912] -- 0:01:21
24500 -- (-1206.397) (-1195.948) [-1195.102] (-1196.141) * (-1206.007) (-1190.254) (-1189.988) [-1191.174] -- 0:01:19
25000 -- (-1198.264) [-1202.738] (-1199.295) (-1202.742) * [-1193.802] (-1189.784) (-1190.411) (-1190.140) -- 0:01:18
Average standard deviation of split frequencies: 0.044896
25500 -- (-1198.206) [-1203.642] (-1205.434) (-1204.054) * [-1201.538] (-1190.067) (-1192.009) (-1195.379) -- 0:01:16
26000 -- [-1204.164] (-1201.811) (-1194.972) (-1208.310) * (-1199.453) [-1190.460] (-1190.653) (-1196.199) -- 0:01:14
26500 -- [-1201.613] (-1203.779) (-1205.464) (-1204.152) * (-1200.377) [-1190.331] (-1191.337) (-1191.730) -- 0:01:13
27000 -- (-1202.504) [-1199.184] (-1197.082) (-1192.433) * [-1196.532] (-1190.250) (-1191.069) (-1195.057) -- 0:01:12
27500 -- (-1209.371) (-1204.104) (-1203.336) [-1189.254] * [-1200.104] (-1193.858) (-1189.570) (-1193.126) -- 0:01:10
28000 -- [-1203.855] (-1200.608) (-1205.422) (-1189.885) * (-1200.042) (-1192.051) [-1190.487] (-1192.141) -- 0:01:09
28500 -- (-1205.972) (-1204.218) (-1204.259) [-1189.496] * (-1198.785) [-1191.238] (-1192.632) (-1190.867) -- 0:01:08
29000 -- (-1212.356) (-1200.500) (-1203.028) [-1189.282] * (-1201.963) (-1191.215) (-1189.618) [-1190.655] -- 0:01:06
29500 -- [-1190.997] (-1203.512) (-1198.244) (-1191.898) * (-1199.565) [-1190.061] (-1189.618) (-1191.832) -- 0:01:05
30000 -- (-1191.847) (-1197.844) (-1202.422) [-1193.430] * (-1204.687) (-1189.704) [-1193.194] (-1192.213) -- 0:01:04
Average standard deviation of split frequencies: 0.048421
30500 -- (-1191.584) [-1201.800] (-1206.495) (-1193.853) * (-1202.947) (-1189.867) [-1189.979] (-1190.490) -- 0:01:03
31000 -- (-1196.106) (-1200.334) [-1198.485] (-1195.476) * (-1209.268) (-1192.496) [-1189.460] (-1190.722) -- 0:01:02
31500 -- (-1192.582) [-1201.280] (-1195.041) (-1199.005) * (-1196.556) [-1189.424] (-1191.219) (-1195.003) -- 0:01:01
32000 -- (-1192.426) [-1204.973] (-1206.036) (-1197.552) * (-1215.968) (-1190.929) [-1189.512] (-1192.233) -- 0:01:00
32500 -- [-1190.606] (-1212.257) (-1210.703) (-1197.882) * (-1199.310) (-1190.006) [-1189.576] (-1190.746) -- 0:00:59
33000 -- (-1191.741) (-1205.631) [-1205.705] (-1192.261) * (-1205.142) (-1192.965) (-1192.719) [-1191.869] -- 0:00:58
33500 -- [-1190.345] (-1203.240) (-1202.692) (-1190.674) * [-1202.105] (-1197.478) (-1193.620) (-1191.138) -- 0:00:57
34000 -- (-1190.800) (-1207.944) (-1192.793) [-1190.249] * [-1200.981] (-1189.971) (-1196.477) (-1191.591) -- 0:00:56
34500 -- (-1191.655) (-1198.130) (-1199.840) [-1192.229] * (-1192.757) [-1192.434] (-1192.986) (-1192.205) -- 0:00:55
35000 -- (-1191.003) (-1202.292) (-1201.111) [-1190.288] * (-1192.832) (-1191.745) (-1193.603) [-1190.848] -- 0:00:55
Average standard deviation of split frequencies: 0.050311
35500 -- [-1191.063] (-1199.209) (-1208.763) (-1190.393) * (-1191.434) [-1190.807] (-1192.473) (-1191.083) -- 0:00:54
36000 -- (-1190.910) (-1197.212) (-1197.922) [-1191.565] * (-1190.362) [-1190.238] (-1191.476) (-1190.768) -- 0:00:53
36500 -- [-1190.471] (-1198.187) (-1201.449) (-1190.132) * (-1193.177) (-1189.818) (-1194.050) [-1191.709] -- 0:00:52
37000 -- (-1190.410) [-1197.214] (-1201.628) (-1189.727) * (-1194.391) [-1192.715] (-1196.426) (-1191.369) -- 0:00:52
37500 -- (-1190.401) [-1203.470] (-1202.481) (-1191.289) * [-1190.905] (-1192.879) (-1199.040) (-1192.908) -- 0:00:51
38000 -- (-1189.245) [-1197.240] (-1202.678) (-1193.442) * (-1194.207) [-1192.529] (-1191.161) (-1194.226) -- 0:00:50
38500 -- [-1191.402] (-1199.546) (-1198.555) (-1190.584) * (-1192.413) (-1191.535) (-1190.649) [-1196.488] -- 0:00:49
39000 -- (-1195.454) (-1205.188) [-1197.323] (-1191.224) * [-1191.312] (-1193.101) (-1192.006) (-1190.202) -- 0:00:49
39500 -- (-1192.988) (-1197.090) (-1199.349) [-1190.228] * (-1189.549) [-1189.404] (-1194.509) (-1195.462) -- 0:01:12
40000 -- [-1190.163] (-1198.965) (-1207.301) (-1191.155) * (-1193.136) [-1190.707] (-1193.218) (-1190.487) -- 0:01:12
Average standard deviation of split frequencies: 0.045788
40500 -- (-1192.537) (-1200.947) (-1199.799) [-1190.373] * (-1192.464) (-1190.794) (-1191.969) [-1190.332] -- 0:01:11
41000 -- (-1192.784) (-1196.929) (-1206.363) [-1189.564] * [-1191.218] (-1193.233) (-1193.656) (-1193.407) -- 0:01:10
41500 -- [-1192.223] (-1203.402) (-1211.828) (-1195.518) * (-1190.674) (-1190.460) [-1194.639] (-1191.936) -- 0:01:09
42000 -- (-1190.443) [-1199.486] (-1202.657) (-1190.444) * (-1190.656) (-1190.601) (-1192.547) [-1191.298] -- 0:01:08
42500 -- (-1192.263) (-1208.217) [-1203.077] (-1192.055) * (-1190.885) (-1189.814) (-1194.085) [-1192.724] -- 0:01:07
43000 -- (-1192.243) [-1198.071] (-1202.699) (-1193.177) * (-1190.832) (-1191.039) (-1192.138) [-1192.052] -- 0:01:06
43500 -- (-1191.985) (-1207.764) (-1212.546) [-1191.342] * [-1193.042] (-1189.731) (-1192.636) (-1193.515) -- 0:01:05
44000 -- (-1191.585) [-1197.528] (-1199.968) (-1191.090) * (-1191.876) [-1190.004] (-1192.235) (-1191.843) -- 0:01:05
44500 -- (-1192.676) (-1201.470) (-1214.502) [-1190.877] * (-1195.193) (-1190.315) (-1190.898) [-1191.651] -- 0:01:04
45000 -- [-1191.981] (-1194.447) (-1193.238) (-1189.246) * (-1193.536) [-1190.550] (-1194.365) (-1197.495) -- 0:01:03
Average standard deviation of split frequencies: 0.039594
45500 -- [-1194.105] (-1205.495) (-1193.771) (-1190.434) * (-1193.731) (-1191.266) [-1190.916] (-1192.620) -- 0:01:02
46000 -- (-1190.911) [-1192.248] (-1194.079) (-1191.404) * (-1195.352) (-1193.800) (-1191.875) [-1192.587] -- 0:01:02
46500 -- (-1189.907) (-1191.223) (-1193.250) [-1192.277] * (-1193.445) (-1192.043) [-1191.714] (-1192.309) -- 0:01:01
47000 -- (-1191.030) [-1190.943] (-1193.655) (-1192.104) * (-1190.504) (-1191.491) [-1192.160] (-1192.907) -- 0:01:00
47500 -- (-1192.225) (-1190.346) (-1191.486) [-1191.716] * (-1192.927) (-1193.009) (-1191.560) [-1192.009] -- 0:01:00
48000 -- (-1192.082) [-1190.350] (-1193.505) (-1191.533) * (-1194.201) (-1193.635) [-1191.649] (-1189.392) -- 0:00:59
48500 -- (-1192.749) [-1189.266] (-1191.308) (-1189.725) * [-1189.684] (-1193.365) (-1191.013) (-1192.368) -- 0:00:58
49000 -- (-1190.913) (-1191.760) (-1191.995) [-1189.394] * [-1192.184] (-1194.533) (-1192.574) (-1191.345) -- 0:00:58
49500 -- [-1189.368] (-1190.565) (-1192.164) (-1200.255) * [-1190.693] (-1195.118) (-1190.460) (-1192.246) -- 0:00:57
50000 -- [-1191.456] (-1193.767) (-1191.887) (-1192.784) * (-1190.881) (-1192.734) (-1189.817) [-1191.562] -- 0:00:57
Average standard deviation of split frequencies: 0.033672
50500 -- [-1191.529] (-1194.824) (-1190.272) (-1193.077) * (-1191.591) (-1193.211) (-1194.842) [-1190.114] -- 0:00:56
51000 -- [-1191.508] (-1192.891) (-1190.754) (-1191.483) * (-1191.415) (-1190.209) [-1189.745] (-1192.268) -- 0:00:55
51500 -- (-1192.267) (-1197.487) [-1194.837] (-1191.881) * [-1190.075] (-1192.446) (-1190.715) (-1190.220) -- 0:00:55
52000 -- (-1191.574) (-1199.937) (-1192.213) [-1190.992] * [-1189.724] (-1191.565) (-1189.451) (-1189.615) -- 0:00:54
52500 -- [-1191.770] (-1194.475) (-1190.626) (-1190.641) * [-1190.163] (-1190.086) (-1199.278) (-1191.466) -- 0:00:54
53000 -- (-1192.151) [-1189.488] (-1189.759) (-1192.221) * [-1191.256] (-1190.384) (-1192.118) (-1190.895) -- 0:00:53
53500 -- (-1193.238) (-1190.709) [-1190.031] (-1190.387) * [-1190.263] (-1194.951) (-1193.114) (-1193.162) -- 0:00:53
54000 -- (-1191.900) (-1192.171) (-1190.138) [-1190.558] * (-1191.439) (-1195.307) (-1193.150) [-1189.966] -- 0:00:52
54500 -- (-1190.868) (-1197.387) [-1189.758] (-1190.318) * [-1191.532] (-1199.252) (-1193.418) (-1189.568) -- 0:00:52
55000 -- (-1190.758) [-1191.449] (-1190.726) (-1190.342) * (-1192.179) (-1192.091) (-1192.363) [-1193.533] -- 0:00:51
Average standard deviation of split frequencies: 0.031267
55500 -- (-1190.526) (-1195.271) [-1191.230] (-1191.097) * [-1190.252] (-1190.561) (-1194.669) (-1193.458) -- 0:01:08
56000 -- (-1193.084) (-1192.573) (-1190.869) [-1191.427] * [-1189.871] (-1191.617) (-1197.524) (-1190.050) -- 0:01:07
56500 -- (-1190.607) [-1194.296] (-1192.173) (-1191.626) * (-1190.299) (-1189.322) [-1191.624] (-1191.735) -- 0:01:06
57000 -- (-1191.067) [-1193.470] (-1194.455) (-1192.601) * (-1191.290) [-1189.409] (-1190.680) (-1191.688) -- 0:01:06
57500 -- (-1193.911) (-1191.235) [-1191.246] (-1192.908) * (-1190.615) [-1190.827] (-1191.579) (-1190.767) -- 0:01:05
58000 -- (-1189.742) (-1190.015) (-1193.317) [-1191.278] * (-1191.824) (-1193.175) (-1194.188) [-1190.048] -- 0:01:04
58500 -- (-1189.579) [-1191.125] (-1193.755) (-1194.654) * [-1192.231] (-1194.462) (-1193.489) (-1190.052) -- 0:01:04
59000 -- (-1190.393) [-1191.522] (-1192.595) (-1191.486) * (-1192.791) [-1192.591] (-1190.366) (-1191.097) -- 0:01:03
59500 -- [-1190.696] (-1193.436) (-1191.520) (-1196.489) * [-1191.442] (-1191.605) (-1189.583) (-1192.565) -- 0:01:03
60000 -- (-1193.016) (-1192.725) (-1196.574) [-1191.159] * (-1189.916) [-1191.781] (-1190.230) (-1193.909) -- 0:01:02
Average standard deviation of split frequencies: 0.030342
60500 -- (-1192.820) (-1193.635) (-1193.963) [-1189.904] * [-1191.158] (-1192.448) (-1190.875) (-1192.243) -- 0:01:02
61000 -- (-1192.543) (-1191.316) [-1194.568] (-1190.151) * [-1191.045] (-1191.587) (-1194.224) (-1191.993) -- 0:01:01
61500 -- [-1191.733] (-1190.650) (-1199.885) (-1190.311) * (-1194.750) (-1189.074) [-1191.237] (-1192.717) -- 0:01:01
62000 -- (-1194.378) (-1190.296) [-1189.741] (-1190.872) * (-1193.801) [-1190.462] (-1189.900) (-1192.263) -- 0:01:00
62500 -- (-1194.879) [-1190.656] (-1190.350) (-1190.088) * [-1189.593] (-1190.557) (-1191.874) (-1194.346) -- 0:01:00
63000 -- (-1192.817) (-1190.404) (-1192.234) [-1190.758] * [-1189.646] (-1191.432) (-1192.380) (-1194.194) -- 0:00:59
63500 -- (-1192.750) (-1192.184) [-1191.120] (-1194.289) * [-1189.377] (-1197.479) (-1191.574) (-1195.039) -- 0:00:58
64000 -- [-1192.903] (-1192.462) (-1191.600) (-1190.801) * (-1190.095) (-1196.735) [-1189.369] (-1191.028) -- 0:00:58
64500 -- [-1193.339] (-1192.014) (-1192.195) (-1192.088) * (-1190.286) [-1191.908] (-1193.037) (-1195.657) -- 0:00:58
65000 -- (-1192.743) (-1193.556) (-1191.273) [-1191.353] * [-1190.144] (-1190.729) (-1190.517) (-1190.651) -- 0:00:57
Average standard deviation of split frequencies: 0.028259
65500 -- (-1192.646) [-1192.365] (-1190.859) (-1192.468) * [-1191.528] (-1194.313) (-1193.851) (-1190.260) -- 0:00:57
66000 -- (-1191.956) (-1190.714) [-1190.452] (-1193.462) * [-1191.297] (-1191.044) (-1197.034) (-1191.499) -- 0:00:56
66500 -- (-1190.879) [-1190.466] (-1190.634) (-1189.932) * (-1191.414) [-1190.203] (-1197.552) (-1192.079) -- 0:00:56
67000 -- (-1189.893) [-1192.316] (-1190.091) (-1189.960) * (-1193.101) (-1194.812) [-1196.299] (-1191.299) -- 0:00:55
67500 -- (-1191.300) (-1191.916) [-1189.293] (-1189.610) * (-1191.641) [-1190.142] (-1195.724) (-1191.701) -- 0:00:55
68000 -- (-1190.415) (-1196.149) [-1193.881] (-1190.808) * (-1193.715) [-1190.186] (-1196.183) (-1196.181) -- 0:00:54
68500 -- (-1190.607) (-1194.624) (-1190.347) [-1190.357] * (-1198.310) [-1189.700] (-1191.867) (-1193.069) -- 0:00:54
69000 -- [-1190.316] (-1194.319) (-1190.941) (-1192.964) * (-1194.361) [-1189.688] (-1192.636) (-1193.263) -- 0:00:53
69500 -- (-1191.004) (-1190.775) (-1189.324) [-1191.811] * (-1193.264) [-1192.525] (-1191.993) (-1196.722) -- 0:00:53
70000 -- (-1191.418) [-1195.238] (-1190.062) (-1190.304) * (-1192.842) (-1191.903) (-1190.111) [-1194.545] -- 0:00:53
Average standard deviation of split frequencies: 0.031034
70500 -- (-1192.523) [-1193.051] (-1191.388) (-1191.068) * (-1192.491) (-1191.560) [-1191.375] (-1190.959) -- 0:00:52
71000 -- (-1191.924) [-1190.086] (-1195.854) (-1191.225) * [-1190.661] (-1193.241) (-1191.444) (-1191.612) -- 0:00:52
71500 -- (-1191.931) [-1190.355] (-1192.651) (-1189.387) * [-1189.312] (-1191.313) (-1193.753) (-1191.274) -- 0:01:04
72000 -- (-1191.962) (-1190.544) [-1191.429] (-1190.622) * (-1189.175) (-1190.918) [-1190.643] (-1189.368) -- 0:01:04
72500 -- (-1190.252) [-1192.900] (-1190.267) (-1189.864) * [-1191.067] (-1194.583) (-1189.522) (-1193.893) -- 0:01:03
73000 -- (-1190.205) [-1192.672] (-1191.795) (-1193.817) * (-1189.144) (-1190.905) (-1192.936) [-1194.389] -- 0:01:03
73500 -- (-1193.872) [-1190.378] (-1196.150) (-1199.562) * (-1188.997) (-1192.393) [-1190.874] (-1193.686) -- 0:01:03
74000 -- (-1191.169) [-1190.572] (-1191.580) (-1195.718) * (-1190.101) (-1192.356) [-1192.917] (-1193.828) -- 0:01:02
74500 -- (-1191.762) (-1191.647) (-1191.389) [-1192.976] * (-1193.415) (-1192.166) [-1195.774] (-1192.386) -- 0:01:02
75000 -- [-1189.703] (-1193.891) (-1191.250) (-1191.833) * (-1191.184) (-1191.233) [-1191.578] (-1193.145) -- 0:01:01
Average standard deviation of split frequencies: 0.027508
75500 -- [-1192.219] (-1195.830) (-1191.165) (-1190.553) * (-1195.773) (-1190.006) [-1192.996] (-1192.315) -- 0:01:01
76000 -- (-1190.932) (-1192.160) (-1189.982) [-1191.709] * (-1191.192) (-1192.035) [-1190.568] (-1191.233) -- 0:01:00
76500 -- [-1190.552] (-1191.264) (-1190.653) (-1191.022) * (-1190.343) (-1190.115) (-1195.479) [-1192.824] -- 0:01:00
77000 -- [-1191.201] (-1191.438) (-1190.626) (-1192.056) * (-1193.319) (-1191.217) [-1194.123] (-1191.084) -- 0:00:59
77500 -- (-1193.112) [-1190.255] (-1190.168) (-1195.236) * (-1190.104) (-1191.730) [-1194.150] (-1189.934) -- 0:00:59
78000 -- (-1191.547) (-1190.536) (-1193.232) [-1193.925] * (-1192.685) (-1190.558) [-1190.985] (-1191.515) -- 0:00:59
78500 -- (-1191.412) (-1189.155) (-1189.261) [-1194.211] * [-1192.914] (-1191.576) (-1192.010) (-1197.514) -- 0:00:58
79000 -- (-1192.372) (-1189.139) (-1192.876) [-1199.331] * (-1192.070) (-1191.203) [-1189.652] (-1191.777) -- 0:00:58
79500 -- [-1191.272] (-1193.796) (-1195.200) (-1194.763) * (-1193.281) (-1190.490) [-1191.243] (-1190.500) -- 0:00:57
80000 -- (-1191.278) (-1190.166) [-1191.063] (-1194.761) * (-1193.157) (-1190.554) (-1190.604) [-1192.766] -- 0:00:57
Average standard deviation of split frequencies: 0.027271
80500 -- (-1193.691) (-1192.223) (-1190.854) [-1190.403] * [-1192.846] (-1189.326) (-1193.556) (-1192.710) -- 0:00:57
81000 -- (-1192.702) (-1194.980) [-1190.227] (-1197.481) * (-1194.085) [-1190.283] (-1190.531) (-1192.856) -- 0:00:56
81500 -- (-1192.998) [-1194.510] (-1198.843) (-1191.918) * [-1191.311] (-1190.569) (-1193.211) (-1190.710) -- 0:00:56
82000 -- (-1193.633) (-1193.321) (-1195.868) [-1193.530] * (-1191.112) [-1190.569] (-1192.716) (-1189.446) -- 0:00:55
82500 -- (-1192.740) (-1192.596) (-1190.015) [-1193.308] * [-1192.289] (-1192.946) (-1191.822) (-1199.735) -- 0:00:55
83000 -- [-1193.582] (-1192.469) (-1191.372) (-1192.295) * [-1190.466] (-1195.132) (-1191.995) (-1195.266) -- 0:00:55
83500 -- [-1190.969] (-1191.615) (-1193.210) (-1193.340) * [-1190.980] (-1191.020) (-1190.538) (-1190.792) -- 0:00:54
84000 -- (-1190.992) (-1190.640) (-1191.245) [-1194.409] * (-1190.168) (-1190.806) (-1189.604) [-1190.874] -- 0:00:54
84500 -- [-1189.866] (-1193.432) (-1190.768) (-1192.920) * (-1190.571) (-1190.391) (-1191.797) [-1190.121] -- 0:00:54
85000 -- (-1192.343) (-1190.717) [-1191.257] (-1189.516) * (-1194.243) (-1192.531) (-1192.595) [-1192.780] -- 0:00:53
Average standard deviation of split frequencies: 0.025912
85500 -- [-1191.724] (-1191.542) (-1193.442) (-1191.031) * [-1192.780] (-1189.737) (-1189.892) (-1193.141) -- 0:00:53
86000 -- [-1189.124] (-1195.897) (-1194.057) (-1189.324) * [-1192.787] (-1189.290) (-1189.826) (-1192.177) -- 0:00:53
86500 -- [-1189.436] (-1191.539) (-1195.709) (-1190.830) * (-1193.140) [-1189.379] (-1191.833) (-1190.416) -- 0:00:52
87000 -- (-1189.168) (-1189.371) (-1191.599) [-1194.831] * (-1190.455) (-1189.655) [-1191.268] (-1191.560) -- 0:00:52
87500 -- [-1190.971] (-1189.371) (-1194.604) (-1189.751) * (-1191.326) (-1190.144) (-1194.064) [-1191.288] -- 0:00:52
88000 -- (-1189.318) [-1195.720] (-1193.006) (-1189.791) * (-1190.854) [-1190.132] (-1190.777) (-1189.784) -- 0:01:02
88500 -- (-1189.736) (-1192.664) [-1192.289] (-1189.659) * (-1190.907) (-1193.165) (-1195.067) [-1189.708] -- 0:01:01
89000 -- (-1189.445) (-1192.128) [-1192.716] (-1191.772) * [-1193.297] (-1191.641) (-1191.276) (-1192.752) -- 0:01:01
89500 -- [-1189.446] (-1191.696) (-1192.659) (-1195.216) * (-1190.597) (-1191.451) (-1189.958) [-1189.760] -- 0:01:01
90000 -- (-1189.446) (-1194.319) (-1197.133) [-1193.786] * (-1190.294) (-1192.826) (-1192.284) [-1190.631] -- 0:01:00
Average standard deviation of split frequencies: 0.017240
90500 -- (-1190.390) (-1192.838) [-1190.324] (-1192.960) * [-1189.763] (-1190.971) (-1192.476) (-1195.738) -- 0:01:00
91000 -- (-1190.567) [-1189.836] (-1190.257) (-1189.713) * (-1189.740) (-1191.501) [-1193.611] (-1190.092) -- 0:00:59
91500 -- (-1189.971) [-1189.701] (-1190.314) (-1193.968) * (-1191.932) (-1194.445) [-1190.484] (-1192.159) -- 0:00:59
92000 -- (-1191.415) (-1191.471) [-1189.934] (-1191.139) * (-1189.529) [-1193.295] (-1191.622) (-1190.418) -- 0:00:59
92500 -- (-1191.728) (-1189.736) [-1189.515] (-1190.332) * [-1189.554] (-1190.472) (-1202.082) (-1191.278) -- 0:00:58
93000 -- (-1191.985) (-1194.319) [-1191.800] (-1189.271) * (-1190.973) (-1191.136) [-1193.010] (-1190.806) -- 0:00:58
93500 -- (-1189.531) (-1193.868) [-1192.507] (-1192.530) * (-1192.426) [-1191.227] (-1196.650) (-1190.225) -- 0:00:58
94000 -- (-1191.042) (-1190.196) [-1192.968] (-1189.400) * [-1194.411] (-1193.777) (-1189.471) (-1190.262) -- 0:00:57
94500 -- [-1193.059] (-1190.109) (-1190.674) (-1192.577) * (-1194.536) [-1192.627] (-1190.852) (-1191.595) -- 0:00:57
95000 -- (-1190.321) (-1191.065) [-1190.447] (-1193.972) * (-1195.962) (-1192.082) (-1189.451) [-1195.525] -- 0:00:57
Average standard deviation of split frequencies: 0.018091
95500 -- [-1191.380] (-1193.600) (-1191.768) (-1193.811) * (-1192.552) (-1191.896) (-1189.503) [-1191.516] -- 0:00:56
96000 -- [-1193.488] (-1191.628) (-1189.793) (-1191.613) * (-1191.673) (-1190.436) (-1194.636) [-1189.593] -- 0:00:56
96500 -- (-1191.616) (-1190.555) [-1189.571] (-1193.242) * [-1190.217] (-1189.893) (-1195.069) (-1190.560) -- 0:00:56
97000 -- (-1194.467) (-1195.078) (-1190.598) [-1191.918] * (-1190.528) (-1190.540) [-1191.336] (-1189.864) -- 0:00:55
97500 -- (-1191.548) (-1191.715) (-1191.179) [-1192.098] * (-1192.653) (-1189.955) (-1192.989) [-1190.283] -- 0:00:55
98000 -- [-1190.041] (-1190.825) (-1194.315) (-1190.205) * [-1191.739] (-1191.071) (-1190.345) (-1191.074) -- 0:00:55
98500 -- [-1190.362] (-1194.016) (-1191.014) (-1194.524) * (-1191.032) [-1191.027] (-1189.869) (-1190.173) -- 0:00:54
99000 -- (-1190.769) [-1194.526] (-1189.771) (-1192.456) * (-1192.369) [-1190.890] (-1190.362) (-1190.156) -- 0:00:54
99500 -- [-1190.336] (-1191.965) (-1192.005) (-1192.505) * (-1192.120) (-1190.866) [-1190.362] (-1189.338) -- 0:00:54
100000 -- (-1190.946) (-1192.170) (-1189.901) [-1191.567] * (-1189.863) (-1191.046) (-1189.980) [-1189.593] -- 0:00:54
Average standard deviation of split frequencies: 0.017629
100500 -- (-1195.769) [-1194.945] (-1194.144) (-1191.774) * (-1191.224) [-1190.405] (-1190.270) (-1190.382) -- 0:00:53
101000 -- (-1191.574) [-1194.110] (-1190.048) (-1191.748) * [-1194.596] (-1191.561) (-1191.240) (-1191.188) -- 0:00:53
101500 -- (-1189.416) (-1190.970) [-1190.205] (-1190.073) * [-1191.248] (-1193.308) (-1190.208) (-1189.846) -- 0:00:53
102000 -- (-1192.602) [-1192.008] (-1190.701) (-1189.765) * (-1189.808) (-1191.932) (-1190.509) [-1189.840] -- 0:00:52
102500 -- [-1190.072] (-1193.173) (-1190.800) (-1190.483) * (-1190.310) (-1191.838) [-1189.882] (-1190.487) -- 0:00:52
103000 -- [-1189.876] (-1190.092) (-1192.256) (-1190.746) * [-1189.747] (-1189.984) (-1193.097) (-1191.798) -- 0:00:52
103500 -- (-1190.533) (-1191.286) (-1191.083) [-1189.758] * (-1191.254) (-1192.369) [-1192.808] (-1196.545) -- 0:00:51
104000 -- [-1192.539] (-1193.024) (-1190.504) (-1189.241) * (-1194.337) (-1191.523) [-1193.478] (-1196.174) -- 0:00:51
104500 -- (-1190.760) (-1190.487) [-1190.016] (-1191.218) * (-1191.080) (-1190.544) (-1191.538) [-1192.058] -- 0:00:59
105000 -- (-1189.716) (-1191.944) [-1191.025] (-1190.986) * (-1191.407) (-1191.839) [-1190.776] (-1193.543) -- 0:00:59
Average standard deviation of split frequencies: 0.017577
105500 -- (-1189.786) [-1192.909] (-1195.026) (-1191.808) * (-1190.617) [-1196.215] (-1190.566) (-1195.924) -- 0:00:59
106000 -- [-1189.664] (-1191.918) (-1190.588) (-1190.142) * [-1190.638] (-1192.675) (-1190.151) (-1192.808) -- 0:00:59
106500 -- (-1190.518) (-1191.426) [-1191.142] (-1189.778) * (-1191.368) (-1193.266) [-1190.060] (-1194.361) -- 0:00:58
107000 -- (-1191.648) [-1192.934] (-1190.534) (-1189.349) * (-1190.090) [-1192.341] (-1192.379) (-1192.646) -- 0:00:58
107500 -- (-1191.575) (-1192.026) [-1190.340] (-1189.297) * (-1190.252) (-1192.498) (-1190.857) [-1190.998] -- 0:00:58
108000 -- (-1194.058) [-1192.508] (-1191.028) (-1189.288) * (-1190.499) (-1190.908) [-1192.365] (-1190.454) -- 0:00:57
108500 -- (-1191.049) (-1190.464) [-1192.034] (-1189.366) * (-1194.271) (-1190.621) [-1190.571] (-1193.584) -- 0:00:57
109000 -- [-1190.205] (-1189.610) (-1191.369) (-1191.199) * [-1192.121] (-1190.480) (-1190.348) (-1190.537) -- 0:00:57
109500 -- (-1195.027) (-1190.929) [-1191.458] (-1191.132) * (-1193.083) (-1189.654) (-1190.907) [-1192.851] -- 0:00:56
110000 -- (-1192.679) (-1191.367) [-1190.886] (-1191.160) * [-1193.110] (-1190.143) (-1191.304) (-1190.422) -- 0:00:56
Average standard deviation of split frequencies: 0.018743
110500 -- (-1190.571) (-1191.334) (-1193.170) [-1193.061] * [-1190.654] (-1189.321) (-1191.305) (-1189.973) -- 0:00:56
111000 -- (-1193.561) [-1195.170] (-1193.222) (-1189.439) * [-1190.361] (-1189.350) (-1194.324) (-1189.507) -- 0:00:56
111500 -- (-1193.362) (-1193.048) (-1192.033) [-1189.447] * (-1191.098) [-1190.370] (-1189.228) (-1191.888) -- 0:00:55
112000 -- (-1193.257) (-1193.374) (-1192.077) [-1189.344] * [-1189.581] (-1190.215) (-1192.410) (-1194.190) -- 0:00:55
112500 -- (-1192.524) [-1190.464] (-1192.212) (-1191.567) * [-1191.691] (-1193.372) (-1192.390) (-1190.513) -- 0:00:55
113000 -- (-1192.459) (-1193.036) (-1195.224) [-1189.926] * [-1190.360] (-1192.154) (-1191.054) (-1190.632) -- 0:00:54
113500 -- (-1192.012) (-1190.782) (-1192.871) [-1190.516] * (-1190.417) [-1191.078] (-1193.009) (-1194.146) -- 0:00:54
114000 -- (-1190.232) (-1192.777) (-1193.709) [-1190.232] * (-1189.482) (-1191.618) [-1191.097] (-1191.547) -- 0:00:54
114500 -- [-1194.090] (-1194.560) (-1189.095) (-1191.273) * (-1189.504) [-1193.088] (-1195.935) (-1193.842) -- 0:00:54
115000 -- [-1189.865] (-1191.239) (-1192.859) (-1197.579) * (-1189.483) [-1193.877] (-1196.730) (-1193.116) -- 0:00:53
Average standard deviation of split frequencies: 0.017966
115500 -- (-1191.632) (-1190.553) [-1192.802] (-1194.743) * (-1193.900) (-1190.844) (-1193.799) [-1189.767] -- 0:00:53
116000 -- [-1190.990] (-1193.211) (-1190.801) (-1192.327) * [-1195.203] (-1192.373) (-1192.973) (-1191.880) -- 0:00:53
116500 -- [-1190.829] (-1192.627) (-1190.881) (-1194.409) * [-1190.569] (-1195.419) (-1189.457) (-1199.297) -- 0:00:53
117000 -- (-1193.495) [-1191.868] (-1192.744) (-1193.018) * [-1189.750] (-1191.485) (-1189.203) (-1191.541) -- 0:00:52
117500 -- (-1190.383) (-1192.187) [-1190.266] (-1191.010) * [-1189.356] (-1192.513) (-1190.040) (-1193.665) -- 0:00:52
118000 -- (-1190.651) (-1194.768) [-1190.942] (-1189.574) * (-1190.111) [-1194.487] (-1189.862) (-1190.647) -- 0:00:52
118500 -- (-1190.756) [-1190.161] (-1190.937) (-1193.085) * [-1189.605] (-1194.280) (-1190.392) (-1192.965) -- 0:00:52
119000 -- (-1191.854) (-1193.651) [-1192.300] (-1190.708) * (-1191.352) (-1192.873) (-1194.342) [-1192.875] -- 0:00:51
119500 -- (-1190.842) [-1190.681] (-1196.361) (-1190.595) * (-1194.147) (-1191.796) (-1191.522) [-1193.447] -- 0:00:51
120000 -- [-1191.054] (-1190.105) (-1190.269) (-1192.635) * (-1191.549) [-1191.691] (-1190.680) (-1192.128) -- 0:00:51
Average standard deviation of split frequencies: 0.016213
120500 -- [-1190.567] (-1190.319) (-1189.139) (-1191.208) * [-1191.338] (-1190.077) (-1190.222) (-1190.157) -- 0:00:58
121000 -- [-1192.542] (-1199.765) (-1189.760) (-1192.824) * (-1191.851) [-1190.065] (-1193.141) (-1189.534) -- 0:00:58
121500 -- (-1189.921) (-1196.850) [-1193.627] (-1190.554) * (-1192.018) (-1190.941) (-1191.180) [-1189.666] -- 0:00:57
122000 -- (-1190.922) (-1191.337) [-1191.437] (-1191.784) * (-1191.102) (-1190.534) [-1190.613] (-1193.905) -- 0:00:57
122500 -- [-1191.423] (-1190.501) (-1191.417) (-1192.453) * [-1195.450] (-1189.254) (-1196.627) (-1191.101) -- 0:00:57
123000 -- [-1190.775] (-1191.268) (-1190.883) (-1194.307) * (-1191.324) (-1189.130) [-1190.309] (-1195.155) -- 0:00:57
123500 -- (-1190.693) (-1191.440) [-1191.531] (-1204.616) * (-1192.335) (-1189.887) (-1191.134) [-1189.991] -- 0:00:56
124000 -- (-1191.353) [-1193.345] (-1189.719) (-1193.737) * (-1191.176) (-1192.050) [-1190.311] (-1190.283) -- 0:00:56
124500 -- (-1190.929) (-1191.798) (-1190.869) [-1191.472] * (-1192.263) [-1191.274] (-1192.061) (-1190.995) -- 0:00:56
125000 -- [-1192.448] (-1192.466) (-1191.698) (-1192.663) * (-1193.651) (-1191.405) (-1191.612) [-1190.243] -- 0:00:56
Average standard deviation of split frequencies: 0.015678
125500 -- (-1191.431) (-1190.553) [-1190.534] (-1189.683) * (-1189.897) (-1191.932) [-1191.873] (-1191.845) -- 0:00:55
126000 -- [-1190.576] (-1191.855) (-1190.452) (-1189.681) * [-1191.928] (-1189.957) (-1190.516) (-1194.839) -- 0:00:55
126500 -- (-1192.217) (-1191.802) [-1190.579] (-1190.672) * [-1190.584] (-1191.085) (-1192.605) (-1191.861) -- 0:00:55
127000 -- (-1192.025) (-1190.834) [-1192.151] (-1192.521) * [-1189.879] (-1191.890) (-1193.038) (-1192.829) -- 0:00:54
127500 -- (-1192.542) [-1193.304] (-1191.344) (-1192.137) * [-1189.255] (-1196.044) (-1193.934) (-1190.782) -- 0:00:54
128000 -- (-1192.513) (-1190.823) (-1190.828) [-1192.179] * (-1191.349) (-1195.268) (-1194.131) [-1192.347] -- 0:00:54
128500 -- (-1189.755) (-1192.619) (-1191.022) [-1190.602] * (-1191.797) [-1192.319] (-1194.562) (-1197.433) -- 0:00:54
129000 -- (-1189.751) [-1191.002] (-1190.999) (-1191.663) * (-1191.784) (-1196.313) (-1189.420) [-1190.830] -- 0:00:54
129500 -- (-1192.778) (-1191.786) [-1190.590] (-1191.139) * [-1191.078] (-1194.371) (-1192.288) (-1198.315) -- 0:00:53
130000 -- (-1189.777) (-1190.034) [-1190.366] (-1190.229) * (-1191.480) (-1189.851) [-1191.664] (-1193.050) -- 0:00:53
Average standard deviation of split frequencies: 0.015152
130500 -- (-1193.233) (-1191.132) (-1191.934) [-1191.906] * (-1190.671) (-1192.010) [-1191.909] (-1190.169) -- 0:00:53
131000 -- [-1196.017] (-1190.545) (-1189.546) (-1191.458) * [-1191.388] (-1191.433) (-1191.688) (-1189.613) -- 0:00:53
131500 -- [-1190.441] (-1189.942) (-1190.600) (-1190.540) * (-1193.558) (-1193.345) (-1191.453) [-1190.093] -- 0:00:52
132000 -- (-1189.967) (-1192.643) [-1191.860] (-1191.463) * [-1196.838] (-1192.390) (-1191.715) (-1189.740) -- 0:00:52
132500 -- [-1191.091] (-1191.025) (-1189.761) (-1191.070) * (-1192.083) (-1197.647) (-1191.065) [-1190.490] -- 0:00:52
133000 -- (-1192.456) [-1192.208] (-1193.385) (-1191.006) * (-1194.401) [-1192.361] (-1190.738) (-1190.773) -- 0:00:52
133500 -- [-1192.095] (-1190.428) (-1191.813) (-1193.256) * (-1189.881) (-1189.611) (-1197.470) [-1189.205] -- 0:00:51
134000 -- (-1191.240) [-1192.717] (-1193.069) (-1192.065) * (-1189.531) (-1190.727) (-1191.813) [-1196.755] -- 0:00:51
134500 -- (-1191.240) [-1190.349] (-1192.490) (-1196.231) * (-1190.489) (-1191.150) (-1192.973) [-1196.478] -- 0:00:51
135000 -- [-1189.692] (-1189.657) (-1195.028) (-1191.327) * [-1189.903] (-1194.564) (-1190.564) (-1193.453) -- 0:00:51
Average standard deviation of split frequencies: 0.018486
135500 -- [-1190.929] (-1189.887) (-1190.206) (-1189.923) * [-1189.841] (-1191.995) (-1190.485) (-1189.973) -- 0:00:51
136000 -- (-1190.743) [-1191.006] (-1191.768) (-1191.097) * (-1192.018) (-1191.496) (-1191.394) [-1191.430] -- 0:00:50
136500 -- (-1190.444) (-1190.783) [-1189.745] (-1192.065) * (-1192.823) [-1190.575] (-1192.382) (-1190.066) -- 0:00:56
137000 -- (-1190.095) (-1192.790) (-1190.089) [-1191.233] * (-1197.755) [-1190.928] (-1192.461) (-1192.967) -- 0:00:56
137500 -- (-1191.567) [-1191.852] (-1189.689) (-1191.344) * (-1194.965) [-1190.690] (-1191.982) (-1192.279) -- 0:00:56
138000 -- (-1191.224) (-1190.003) (-1189.471) [-1190.589] * (-1196.635) (-1190.552) (-1193.567) [-1192.027] -- 0:00:56
138500 -- (-1193.560) [-1192.146] (-1197.809) (-1191.813) * [-1194.059] (-1189.638) (-1194.472) (-1192.357) -- 0:00:55
139000 -- [-1190.319] (-1193.024) (-1195.289) (-1191.077) * [-1192.835] (-1192.528) (-1192.785) (-1194.700) -- 0:00:55
139500 -- (-1191.187) (-1193.372) [-1193.991] (-1191.918) * (-1193.938) [-1191.349] (-1192.867) (-1195.577) -- 0:00:55
140000 -- (-1189.291) (-1190.023) [-1193.804] (-1191.797) * (-1197.753) [-1191.928] (-1192.790) (-1193.096) -- 0:00:55
Average standard deviation of split frequencies: 0.019269
140500 -- (-1189.282) (-1193.381) [-1191.341] (-1190.058) * (-1195.231) (-1190.911) [-1192.459] (-1190.506) -- 0:00:55
141000 -- (-1190.843) [-1196.651] (-1193.694) (-1190.653) * (-1192.661) (-1191.334) (-1191.703) [-1190.780] -- 0:00:54
141500 -- [-1189.872] (-1190.546) (-1196.284) (-1191.071) * [-1190.816] (-1194.882) (-1192.110) (-1189.831) -- 0:00:54
142000 -- [-1191.606] (-1189.769) (-1193.642) (-1191.314) * (-1194.111) (-1197.345) [-1193.429] (-1190.034) -- 0:00:54
142500 -- [-1190.332] (-1190.090) (-1193.855) (-1192.045) * (-1192.384) (-1194.160) (-1192.068) [-1190.665] -- 0:00:54
143000 -- (-1190.504) (-1192.683) [-1192.407] (-1191.340) * (-1191.910) [-1191.627] (-1191.071) (-1190.101) -- 0:00:53
143500 -- [-1190.965] (-1194.268) (-1192.750) (-1191.336) * (-1190.783) (-1191.768) (-1189.767) [-1190.011] -- 0:00:53
144000 -- (-1192.499) [-1190.082] (-1191.996) (-1190.806) * (-1191.208) (-1190.524) [-1192.379] (-1190.792) -- 0:00:53
144500 -- (-1192.290) [-1193.863] (-1191.493) (-1192.207) * (-1190.267) (-1190.846) (-1191.451) [-1189.171] -- 0:00:53
145000 -- (-1192.144) (-1192.836) [-1191.982] (-1196.454) * (-1190.181) (-1194.307) [-1192.375] (-1191.209) -- 0:00:53
Average standard deviation of split frequencies: 0.019065
145500 -- (-1192.767) (-1193.156) [-1190.719] (-1196.023) * (-1191.207) (-1192.089) [-1193.973] (-1192.715) -- 0:00:52
146000 -- [-1190.062] (-1196.143) (-1192.639) (-1195.197) * [-1191.382] (-1189.919) (-1190.846) (-1191.789) -- 0:00:52
146500 -- (-1191.993) [-1191.143] (-1191.683) (-1190.144) * (-1190.073) [-1191.264] (-1192.341) (-1189.812) -- 0:00:52
147000 -- (-1194.224) (-1190.429) [-1191.056] (-1189.870) * (-1194.863) (-1192.194) [-1191.016] (-1193.140) -- 0:00:52
147500 -- (-1190.892) (-1192.126) (-1189.692) [-1193.873] * (-1192.413) (-1193.628) [-1191.622] (-1194.047) -- 0:00:52
148000 -- (-1191.012) (-1190.875) [-1189.641] (-1195.172) * [-1192.852] (-1192.327) (-1191.359) (-1191.305) -- 0:00:51
148500 -- (-1190.610) (-1190.122) (-1190.942) [-1189.804] * [-1190.958] (-1190.257) (-1191.154) (-1194.825) -- 0:00:51
149000 -- (-1191.890) [-1190.770] (-1191.054) (-1190.560) * (-1193.586) [-1190.889] (-1193.223) (-1191.877) -- 0:00:51
149500 -- (-1192.406) [-1190.337] (-1196.730) (-1192.424) * (-1190.742) (-1194.655) (-1190.240) [-1189.668] -- 0:00:51
150000 -- (-1191.421) [-1190.643] (-1189.804) (-1191.653) * (-1190.184) (-1191.484) [-1190.291] (-1189.543) -- 0:00:51
Average standard deviation of split frequencies: 0.017581
150500 -- (-1190.696) (-1192.221) [-1192.219] (-1190.409) * (-1191.428) (-1191.756) (-1190.380) [-1189.236] -- 0:00:50
151000 -- (-1189.850) (-1192.784) (-1191.377) [-1189.744] * [-1193.345] (-1190.642) (-1191.754) (-1192.847) -- 0:00:50
151500 -- (-1189.210) (-1189.918) [-1189.893] (-1189.440) * (-1192.020) [-1190.056] (-1192.391) (-1190.343) -- 0:00:50
152000 -- [-1189.547] (-1190.440) (-1191.280) (-1193.462) * (-1190.535) [-1191.194] (-1190.635) (-1190.344) -- 0:00:50
152500 -- (-1190.442) (-1192.780) (-1189.305) [-1191.450] * (-1193.837) (-1190.835) (-1191.154) [-1192.032] -- 0:00:50
153000 -- [-1191.132] (-1192.135) (-1189.262) (-1191.971) * (-1192.420) (-1191.470) [-1196.327] (-1190.194) -- 0:00:55
153500 -- (-1190.557) [-1191.495] (-1189.735) (-1191.096) * (-1193.498) (-1193.160) [-1190.277] (-1194.190) -- 0:00:55
154000 -- [-1195.394] (-1190.102) (-1192.267) (-1190.377) * (-1195.708) [-1193.299] (-1189.109) (-1190.385) -- 0:00:54
154500 -- (-1193.726) [-1190.502] (-1193.509) (-1194.544) * [-1194.017] (-1193.197) (-1199.137) (-1190.490) -- 0:00:54
155000 -- [-1191.871] (-1190.695) (-1190.373) (-1192.246) * [-1193.923] (-1192.034) (-1189.536) (-1190.068) -- 0:00:54
Average standard deviation of split frequencies: 0.016404
155500 -- (-1192.459) (-1192.599) [-1189.579] (-1192.247) * (-1195.400) (-1191.850) (-1192.956) [-1191.011] -- 0:00:54
156000 -- (-1190.731) [-1191.141] (-1189.297) (-1194.890) * (-1192.445) (-1193.842) (-1193.987) [-1191.790] -- 0:00:54
156500 -- (-1194.102) (-1192.828) [-1189.723] (-1192.834) * [-1193.841] (-1193.362) (-1191.845) (-1190.784) -- 0:00:53
157000 -- (-1190.635) (-1191.559) (-1189.738) [-1191.942] * [-1191.457] (-1195.890) (-1195.017) (-1190.657) -- 0:00:53
157500 -- [-1189.699] (-1191.736) (-1192.606) (-1193.154) * (-1192.188) (-1192.497) [-1193.043] (-1190.203) -- 0:00:53
158000 -- [-1192.887] (-1196.201) (-1192.087) (-1191.119) * (-1189.503) (-1192.911) (-1193.973) [-1190.939] -- 0:00:53
158500 -- (-1190.955) (-1197.038) [-1191.100] (-1193.960) * [-1191.396] (-1192.721) (-1191.609) (-1191.647) -- 0:00:53
159000 -- (-1190.227) (-1194.189) [-1191.533] (-1190.767) * (-1191.835) (-1190.270) [-1190.170] (-1191.938) -- 0:00:52
159500 -- (-1190.253) (-1195.085) (-1195.695) [-1190.156] * [-1191.884] (-1193.384) (-1189.908) (-1189.388) -- 0:00:52
160000 -- [-1190.079] (-1194.293) (-1196.179) (-1189.711) * (-1193.484) [-1191.281] (-1190.041) (-1189.702) -- 0:00:52
Average standard deviation of split frequencies: 0.015089
160500 -- (-1193.398) (-1190.423) (-1193.068) [-1192.577] * (-1192.402) (-1191.266) (-1189.893) [-1191.682] -- 0:00:52
161000 -- (-1190.925) (-1190.716) [-1191.444] (-1190.305) * [-1191.825] (-1190.309) (-1189.740) (-1189.922) -- 0:00:52
161500 -- (-1189.643) [-1192.216] (-1193.690) (-1190.240) * (-1193.227) (-1190.205) (-1197.984) [-1194.384] -- 0:00:51
162000 -- (-1191.085) [-1191.839] (-1192.596) (-1189.846) * (-1192.538) (-1190.742) (-1190.579) [-1190.456] -- 0:00:51
162500 -- [-1191.134] (-1193.154) (-1195.786) (-1190.988) * (-1193.025) (-1191.158) (-1189.903) [-1193.371] -- 0:00:51
163000 -- (-1192.085) (-1195.481) [-1194.369] (-1190.924) * (-1194.660) (-1192.707) [-1191.546] (-1194.164) -- 0:00:51
163500 -- (-1191.716) [-1196.310] (-1192.057) (-1189.249) * (-1195.079) (-1193.819) [-1191.746] (-1194.804) -- 0:00:51
164000 -- (-1191.728) (-1191.933) (-1193.936) [-1189.244] * (-1189.882) (-1192.195) [-1191.348] (-1192.975) -- 0:00:50
164500 -- [-1189.741] (-1193.843) (-1192.128) (-1190.308) * (-1190.955) (-1192.371) (-1197.186) [-1192.904] -- 0:00:50
165000 -- (-1192.083) [-1191.700] (-1190.055) (-1190.308) * (-1190.720) (-1191.569) (-1195.096) [-1192.011] -- 0:00:50
Average standard deviation of split frequencies: 0.015146
165500 -- (-1191.685) [-1190.715] (-1189.900) (-1190.145) * (-1189.603) (-1190.738) (-1195.505) [-1190.104] -- 0:00:50
166000 -- [-1191.059] (-1191.301) (-1191.035) (-1190.773) * (-1191.130) [-1190.227] (-1194.653) (-1190.046) -- 0:00:50
166500 -- [-1192.805] (-1190.937) (-1190.265) (-1190.585) * [-1191.589] (-1194.104) (-1191.552) (-1191.736) -- 0:00:50
167000 -- [-1190.823] (-1190.134) (-1189.639) (-1189.839) * (-1192.622) [-1195.973] (-1191.829) (-1189.645) -- 0:00:49
167500 -- (-1191.541) [-1189.724] (-1190.932) (-1192.857) * [-1194.085] (-1198.238) (-1191.297) (-1189.695) -- 0:00:49
168000 -- [-1189.238] (-1189.978) (-1189.754) (-1194.193) * (-1193.160) [-1189.624] (-1191.512) (-1189.685) -- 0:00:49
168500 -- (-1192.453) (-1193.029) [-1191.305] (-1190.172) * [-1192.554] (-1190.020) (-1192.313) (-1190.311) -- 0:00:49
169000 -- (-1189.798) (-1193.387) [-1190.330] (-1191.818) * (-1191.984) (-1189.690) [-1191.690] (-1189.339) -- 0:00:54
169500 -- (-1192.499) (-1191.228) (-1193.374) [-1191.656] * (-1193.402) [-1189.474] (-1193.682) (-1193.329) -- 0:00:53
170000 -- (-1189.809) (-1190.217) [-1191.460] (-1191.937) * [-1192.009] (-1189.458) (-1194.758) (-1191.380) -- 0:00:53
Average standard deviation of split frequencies: 0.014994
170500 -- (-1189.934) (-1190.866) (-1189.790) [-1193.410] * (-1191.441) (-1191.205) [-1192.392] (-1189.831) -- 0:00:53
171000 -- (-1189.888) (-1189.408) [-1191.971] (-1194.511) * [-1191.488] (-1191.234) (-1191.572) (-1189.800) -- 0:00:53
171500 -- (-1189.783) (-1190.218) [-1191.921] (-1195.098) * (-1190.669) (-1191.145) (-1191.477) [-1190.945] -- 0:00:53
172000 -- [-1190.734] (-1189.638) (-1192.948) (-1192.142) * (-1190.094) (-1190.749) (-1191.532) [-1194.425] -- 0:00:52
172500 -- (-1191.991) [-1191.458] (-1190.984) (-1192.955) * (-1190.725) [-1189.840] (-1194.905) (-1189.939) -- 0:00:52
173000 -- (-1191.082) (-1193.292) [-1191.481] (-1189.699) * (-1191.372) [-1189.662] (-1191.575) (-1192.301) -- 0:00:52
173500 -- (-1191.400) (-1190.539) [-1191.087] (-1189.094) * (-1195.364) (-1192.384) (-1190.380) [-1190.397] -- 0:00:52
174000 -- (-1189.723) (-1192.019) (-1195.192) [-1189.769] * (-1194.614) [-1190.655] (-1192.107) (-1193.619) -- 0:00:52
174500 -- (-1189.087) (-1192.921) (-1192.090) [-1190.860] * (-1192.433) [-1190.414] (-1190.295) (-1192.386) -- 0:00:52
175000 -- (-1189.464) (-1191.188) (-1189.352) [-1190.465] * (-1191.694) (-1189.856) (-1191.593) [-1190.132] -- 0:00:51
Average standard deviation of split frequencies: 0.013794
175500 -- (-1189.283) (-1191.188) (-1191.622) [-1189.940] * (-1196.223) [-1191.170] (-1190.672) (-1190.779) -- 0:00:51
176000 -- (-1190.209) (-1191.450) (-1192.839) [-1189.942] * (-1193.313) [-1195.318] (-1191.699) (-1190.222) -- 0:00:51
176500 -- (-1196.021) (-1191.882) [-1190.102] (-1190.878) * (-1191.924) [-1191.234] (-1190.153) (-1194.265) -- 0:00:51
177000 -- (-1193.641) (-1196.118) (-1190.456) [-1190.045] * [-1192.348] (-1192.178) (-1191.262) (-1192.640) -- 0:00:51
177500 -- (-1195.230) (-1190.747) [-1189.897] (-1190.483) * (-1191.808) [-1193.015] (-1189.316) (-1189.636) -- 0:00:50
178000 -- (-1192.107) (-1190.706) (-1189.897) [-1189.694] * [-1189.958] (-1194.520) (-1189.275) (-1189.659) -- 0:00:50
178500 -- (-1195.920) (-1190.943) [-1189.584] (-1189.397) * (-1190.966) (-1190.645) [-1189.439] (-1191.610) -- 0:00:50
179000 -- [-1192.854] (-1194.985) (-1189.711) (-1189.374) * (-1189.454) [-1191.138] (-1191.824) (-1191.831) -- 0:00:50
179500 -- (-1190.199) (-1196.556) [-1191.740] (-1190.994) * (-1190.900) [-1191.744] (-1191.091) (-1190.693) -- 0:00:50
180000 -- (-1190.061) [-1193.776] (-1193.861) (-1190.460) * (-1190.628) [-1190.445] (-1191.163) (-1189.896) -- 0:00:50
Average standard deviation of split frequencies: 0.012674
180500 -- (-1191.109) (-1188.956) [-1192.307] (-1189.652) * [-1193.292] (-1191.887) (-1190.476) (-1190.425) -- 0:00:49
181000 -- [-1189.707] (-1188.973) (-1192.398) (-1189.873) * (-1191.463) (-1194.475) [-1191.381] (-1190.268) -- 0:00:49
181500 -- (-1191.152) (-1190.431) (-1193.358) [-1190.705] * (-1190.490) (-1192.378) (-1190.850) [-1191.169] -- 0:00:49
182000 -- (-1190.862) [-1192.586] (-1192.820) (-1190.083) * (-1192.854) (-1191.329) [-1190.979] (-1195.787) -- 0:00:49
182500 -- (-1190.007) (-1189.542) [-1190.129] (-1189.443) * (-1189.708) [-1190.931] (-1189.427) (-1191.340) -- 0:00:49
183000 -- (-1194.206) (-1189.980) [-1190.967] (-1189.946) * (-1192.123) (-1190.924) (-1189.364) [-1191.477] -- 0:00:49
183500 -- (-1192.246) (-1190.157) [-1191.356] (-1191.114) * (-1191.460) (-1193.867) (-1189.649) [-1190.704] -- 0:00:48
184000 -- [-1189.964] (-1193.306) (-1191.214) (-1191.467) * (-1192.312) (-1192.924) (-1189.635) [-1190.305] -- 0:00:48
184500 -- (-1190.185) (-1190.102) [-1194.235] (-1193.347) * (-1191.205) (-1190.857) (-1192.350) [-1191.238] -- 0:00:48
185000 -- (-1190.991) [-1195.088] (-1190.645) (-1191.122) * [-1191.125] (-1190.762) (-1191.645) (-1191.511) -- 0:00:48
Average standard deviation of split frequencies: 0.013686
185500 -- (-1190.634) [-1195.180] (-1190.862) (-1190.059) * [-1191.271] (-1192.200) (-1191.501) (-1191.489) -- 0:00:52
186000 -- (-1189.724) (-1191.532) [-1190.795] (-1191.003) * (-1192.147) (-1189.490) [-1192.116] (-1189.120) -- 0:00:52
186500 -- [-1190.171] (-1190.507) (-1189.312) (-1191.276) * [-1190.647] (-1189.515) (-1193.448) (-1191.785) -- 0:00:52
187000 -- (-1190.947) [-1192.988] (-1189.976) (-1191.348) * (-1193.521) (-1192.254) [-1192.343] (-1189.419) -- 0:00:52
187500 -- (-1196.560) (-1190.706) [-1189.436] (-1190.550) * (-1191.429) (-1194.859) [-1191.492] (-1189.835) -- 0:00:52
188000 -- (-1190.731) (-1194.104) [-1190.114] (-1190.636) * (-1191.617) (-1199.215) (-1191.058) [-1192.058] -- 0:00:51
188500 -- (-1192.564) (-1194.746) [-1190.913] (-1190.540) * (-1191.925) (-1193.910) (-1192.480) [-1191.670] -- 0:00:51
189000 -- (-1190.157) (-1196.535) (-1189.524) [-1190.047] * (-1191.660) [-1191.548] (-1189.212) (-1191.263) -- 0:00:51
189500 -- (-1192.680) (-1190.898) (-1192.949) [-1189.531] * (-1194.276) (-1190.546) [-1191.424] (-1191.483) -- 0:00:51
190000 -- (-1192.148) [-1191.768] (-1191.875) (-1191.312) * (-1192.012) (-1193.536) (-1192.940) [-1189.586] -- 0:00:51
Average standard deviation of split frequencies: 0.014464
190500 -- (-1191.548) [-1193.606] (-1190.711) (-1191.603) * (-1191.933) (-1192.891) (-1190.556) [-1189.710] -- 0:00:50
191000 -- (-1191.771) (-1195.800) (-1190.018) [-1191.435] * [-1190.395] (-1191.190) (-1191.899) (-1191.640) -- 0:00:50
191500 -- [-1194.106] (-1196.005) (-1192.250) (-1193.719) * (-1192.053) (-1190.560) (-1191.622) [-1197.600] -- 0:00:50
192000 -- (-1197.532) (-1192.931) (-1192.663) [-1192.241] * (-1193.772) (-1194.097) [-1195.824] (-1192.063) -- 0:00:50
192500 -- (-1192.199) [-1193.846] (-1189.891) (-1193.177) * [-1192.697] (-1193.481) (-1194.378) (-1191.099) -- 0:00:50
193000 -- [-1191.364] (-1191.833) (-1191.948) (-1192.311) * (-1193.136) (-1194.415) [-1193.942] (-1193.842) -- 0:00:50
193500 -- (-1191.016) [-1194.326] (-1190.813) (-1193.694) * (-1192.446) (-1190.557) (-1193.778) [-1193.497] -- 0:00:50
194000 -- (-1194.379) (-1192.785) [-1190.465] (-1193.074) * (-1190.091) (-1191.138) (-1193.418) [-1193.264] -- 0:00:49
194500 -- (-1195.954) [-1193.229] (-1190.136) (-1191.920) * (-1194.638) (-1192.056) (-1195.025) [-1191.621] -- 0:00:49
195000 -- (-1197.153) (-1190.036) [-1191.667] (-1193.411) * (-1197.420) (-1193.081) [-1189.908] (-1193.743) -- 0:00:49
Average standard deviation of split frequencies: 0.015138
195500 -- (-1193.637) (-1190.169) [-1190.866] (-1191.495) * (-1190.766) (-1196.749) [-1190.104] (-1193.337) -- 0:00:49
196000 -- [-1190.550] (-1192.503) (-1190.007) (-1193.574) * [-1190.972] (-1193.288) (-1189.940) (-1190.578) -- 0:00:49
196500 -- (-1190.547) [-1190.247] (-1194.555) (-1193.472) * (-1191.058) (-1191.970) [-1190.175] (-1190.601) -- 0:00:49
197000 -- (-1193.543) [-1191.625] (-1193.206) (-1193.280) * (-1190.841) (-1189.948) [-1190.135] (-1192.048) -- 0:00:48
197500 -- (-1191.817) [-1191.078] (-1197.575) (-1191.992) * [-1191.777] (-1190.822) (-1192.463) (-1189.297) -- 0:00:48
198000 -- [-1192.249] (-1190.876) (-1192.464) (-1191.284) * (-1191.660) [-1189.937] (-1192.783) (-1190.950) -- 0:00:48
198500 -- (-1189.647) [-1191.724] (-1192.403) (-1190.298) * (-1189.295) [-1189.917] (-1191.206) (-1192.165) -- 0:00:48
199000 -- (-1190.272) (-1189.898) (-1197.173) [-1191.124] * (-1189.996) [-1191.262] (-1191.074) (-1196.876) -- 0:00:48
199500 -- (-1190.567) (-1191.485) (-1192.121) [-1190.673] * [-1189.973] (-1190.580) (-1191.029) (-1197.149) -- 0:00:48
200000 -- [-1189.490] (-1194.222) (-1190.484) (-1192.802) * (-1189.291) [-1189.625] (-1193.558) (-1191.121) -- 0:00:48
Average standard deviation of split frequencies: 0.015477
200500 -- (-1189.466) [-1192.986] (-1193.741) (-1193.790) * (-1192.275) (-1191.510) (-1193.653) [-1190.014] -- 0:00:47
201000 -- [-1191.006] (-1191.933) (-1190.630) (-1191.097) * (-1194.511) [-1190.650] (-1190.745) (-1190.344) -- 0:00:47
201500 -- (-1190.521) (-1191.549) (-1192.111) [-1191.679] * (-1192.575) (-1196.238) (-1191.197) [-1191.525] -- 0:00:51
202000 -- (-1191.511) (-1195.413) [-1193.090] (-1189.808) * (-1191.004) [-1190.700] (-1190.997) (-1191.786) -- 0:00:51
202500 -- (-1193.162) (-1196.366) [-1191.765] (-1189.372) * (-1192.633) (-1193.421) [-1192.816] (-1193.223) -- 0:00:51
203000 -- [-1191.030] (-1191.413) (-1192.672) (-1191.059) * [-1191.315] (-1194.688) (-1192.622) (-1191.185) -- 0:00:51
203500 -- (-1189.556) (-1189.692) [-1191.239] (-1189.878) * (-1191.416) (-1190.791) [-1192.723] (-1194.467) -- 0:00:50
204000 -- [-1189.889] (-1189.638) (-1191.754) (-1190.376) * (-1190.605) (-1190.540) (-1189.128) [-1189.183] -- 0:00:50
204500 -- (-1189.759) (-1190.868) [-1194.452] (-1190.975) * (-1193.533) (-1190.617) (-1191.745) [-1189.957] -- 0:00:50
205000 -- [-1189.722] (-1192.760) (-1193.128) (-1191.330) * (-1190.803) (-1191.970) [-1190.417] (-1190.258) -- 0:00:50
Average standard deviation of split frequencies: 0.016500
205500 -- (-1189.723) (-1191.761) (-1194.668) [-1191.294] * [-1189.277] (-1195.571) (-1189.504) (-1190.421) -- 0:00:50
206000 -- [-1189.610] (-1192.567) (-1190.122) (-1191.050) * [-1189.542] (-1192.220) (-1190.741) (-1192.260) -- 0:00:50
206500 -- (-1190.742) [-1192.785] (-1191.151) (-1190.962) * (-1190.184) (-1191.422) [-1190.753] (-1192.206) -- 0:00:49
207000 -- [-1190.818] (-1192.172) (-1190.284) (-1195.198) * (-1189.736) (-1190.557) (-1190.695) [-1191.413] -- 0:00:49
207500 -- (-1189.602) [-1190.499] (-1193.462) (-1194.903) * [-1191.766] (-1189.659) (-1190.494) (-1190.854) -- 0:00:49
208000 -- (-1193.447) [-1190.917] (-1189.677) (-1198.089) * (-1195.853) (-1190.390) [-1191.482] (-1195.958) -- 0:00:49
208500 -- (-1190.542) [-1190.296] (-1190.656) (-1197.603) * (-1191.232) (-1194.210) (-1189.795) [-1193.412] -- 0:00:49
209000 -- (-1190.010) (-1193.793) (-1191.371) [-1190.477] * (-1191.110) (-1191.474) [-1189.904] (-1192.907) -- 0:00:49
209500 -- (-1192.010) (-1197.931) [-1199.372] (-1189.825) * (-1190.606) [-1191.001] (-1190.549) (-1192.178) -- 0:00:49
210000 -- [-1193.262] (-1198.566) (-1190.825) (-1190.158) * (-1190.179) (-1190.112) [-1189.436] (-1190.553) -- 0:00:48
Average standard deviation of split frequencies: 0.016370
210500 -- (-1191.810) [-1191.809] (-1194.608) (-1190.157) * [-1192.538] (-1189.996) (-1189.702) (-1195.495) -- 0:00:48
211000 -- (-1191.257) (-1191.773) (-1196.219) [-1190.281] * (-1191.464) (-1192.860) (-1189.645) [-1190.961] -- 0:00:48
211500 -- [-1189.275] (-1192.775) (-1190.353) (-1193.977) * (-1192.197) [-1193.510] (-1191.036) (-1189.784) -- 0:00:48
212000 -- (-1192.126) [-1192.447] (-1193.503) (-1194.150) * (-1190.416) [-1190.647] (-1191.557) (-1189.754) -- 0:00:48
212500 -- (-1197.312) (-1193.481) [-1190.753] (-1191.113) * (-1189.259) (-1190.521) [-1194.785] (-1190.950) -- 0:00:48
213000 -- [-1194.678] (-1192.571) (-1192.256) (-1190.056) * (-1189.259) (-1192.320) (-1191.279) [-1190.773] -- 0:00:48
213500 -- [-1193.033] (-1200.894) (-1190.236) (-1190.961) * (-1190.810) [-1191.445] (-1189.601) (-1190.041) -- 0:00:47
214000 -- (-1191.230) (-1191.207) (-1193.079) [-1191.861] * [-1192.847] (-1189.328) (-1191.415) (-1189.772) -- 0:00:47
214500 -- (-1192.542) [-1191.369] (-1193.417) (-1192.097) * (-1198.157) [-1189.479] (-1190.526) (-1198.559) -- 0:00:47
215000 -- (-1195.511) (-1190.655) (-1190.206) [-1191.836] * (-1190.436) (-1190.816) (-1190.948) [-1190.008] -- 0:00:47
Average standard deviation of split frequencies: 0.016247
215500 -- (-1197.121) [-1191.553] (-1190.241) (-1197.524) * [-1192.154] (-1192.699) (-1193.427) (-1193.086) -- 0:00:47
216000 -- (-1193.377) (-1191.131) [-1189.528] (-1197.738) * (-1190.001) (-1190.729) [-1196.616] (-1190.633) -- 0:00:47
216500 -- (-1192.690) (-1191.202) [-1190.801] (-1196.306) * (-1190.313) (-1193.772) [-1193.642] (-1194.117) -- 0:00:47
217000 -- (-1191.768) [-1191.511] (-1191.517) (-1192.531) * (-1191.845) (-1190.418) [-1193.127] (-1190.227) -- 0:00:46
217500 -- (-1194.522) (-1195.820) (-1194.283) [-1192.653] * (-1193.951) [-1190.997] (-1191.811) (-1190.491) -- 0:00:50
218000 -- (-1196.091) [-1191.881] (-1190.870) (-1195.957) * (-1192.899) (-1189.595) [-1190.255] (-1190.230) -- 0:00:50
218500 -- (-1195.641) (-1191.726) (-1190.927) [-1191.882] * (-1194.832) (-1189.660) (-1190.810) [-1192.346] -- 0:00:50
219000 -- [-1192.080] (-1192.686) (-1190.206) (-1191.773) * (-1190.071) (-1190.718) (-1193.650) [-1192.097] -- 0:00:49
219500 -- (-1189.830) [-1191.207] (-1190.613) (-1189.626) * (-1189.611) [-1189.915] (-1192.724) (-1192.182) -- 0:00:49
220000 -- (-1189.541) (-1193.611) [-1190.721] (-1189.626) * (-1189.363) (-1190.184) (-1192.159) [-1193.019] -- 0:00:49
Average standard deviation of split frequencies: 0.016022
220500 -- [-1190.494] (-1191.099) (-1191.374) (-1191.269) * [-1189.166] (-1189.719) (-1192.978) (-1190.449) -- 0:00:49
221000 -- (-1190.210) (-1193.713) (-1190.567) [-1190.356] * [-1191.759] (-1190.014) (-1192.685) (-1191.240) -- 0:00:49
221500 -- [-1190.174] (-1192.166) (-1190.494) (-1189.761) * (-1192.990) [-1189.417] (-1191.241) (-1191.353) -- 0:00:49
222000 -- (-1191.819) (-1192.388) (-1190.002) [-1192.091] * (-1195.033) [-1190.357] (-1194.703) (-1189.825) -- 0:00:49
222500 -- (-1191.224) [-1192.442] (-1194.512) (-1191.389) * (-1191.886) (-1191.448) (-1191.943) [-1190.954] -- 0:00:48
223000 -- (-1191.193) (-1201.097) [-1189.776] (-1191.599) * (-1190.551) (-1190.031) (-1191.930) [-1192.097] -- 0:00:48
223500 -- (-1190.112) [-1191.152] (-1193.745) (-1191.048) * (-1194.478) (-1189.954) (-1191.625) [-1189.588] -- 0:00:48
224000 -- [-1190.387] (-1190.329) (-1191.351) (-1189.814) * (-1190.428) [-1190.587] (-1190.660) (-1190.262) -- 0:00:48
224500 -- [-1189.982] (-1190.021) (-1193.073) (-1191.485) * [-1193.116] (-1192.483) (-1197.889) (-1190.230) -- 0:00:48
225000 -- (-1190.076) [-1192.369] (-1191.683) (-1190.430) * (-1193.317) (-1192.988) [-1194.004] (-1191.829) -- 0:00:48
Average standard deviation of split frequencies: 0.016455
225500 -- (-1191.836) (-1191.351) [-1194.284] (-1190.713) * [-1191.073] (-1192.575) (-1193.874) (-1189.916) -- 0:00:48
226000 -- (-1192.533) (-1198.593) [-1193.163] (-1192.218) * (-1191.171) (-1192.773) [-1190.924] (-1191.762) -- 0:00:47
226500 -- [-1191.598] (-1191.009) (-1194.427) (-1191.365) * (-1192.622) (-1193.457) [-1194.226] (-1192.825) -- 0:00:47
227000 -- (-1196.708) (-1191.721) (-1190.983) [-1189.695] * (-1192.114) (-1194.378) (-1194.878) [-1190.839] -- 0:00:47
227500 -- [-1193.242] (-1192.901) (-1191.653) (-1189.892) * [-1190.140] (-1191.851) (-1191.762) (-1191.989) -- 0:00:47
228000 -- (-1191.129) (-1192.103) (-1193.373) [-1192.408] * (-1189.703) (-1192.733) (-1191.795) [-1190.252] -- 0:00:47
228500 -- (-1196.702) [-1189.790] (-1197.782) (-1195.185) * [-1189.853] (-1192.468) (-1192.589) (-1195.579) -- 0:00:47
229000 -- (-1196.876) [-1189.394] (-1193.389) (-1194.910) * (-1192.958) [-1193.387] (-1194.597) (-1191.810) -- 0:00:47
229500 -- (-1190.867) [-1189.746] (-1191.625) (-1190.294) * [-1192.842] (-1191.186) (-1191.031) (-1190.000) -- 0:00:47
230000 -- (-1193.069) [-1190.254] (-1194.042) (-1194.401) * [-1193.187] (-1195.033) (-1190.082) (-1189.861) -- 0:00:46
Average standard deviation of split frequencies: 0.016109
230500 -- [-1191.729] (-1190.265) (-1194.866) (-1193.660) * (-1189.825) (-1195.616) (-1193.300) [-1189.794] -- 0:00:46
231000 -- [-1190.869] (-1194.080) (-1193.967) (-1189.983) * (-1190.257) (-1193.333) [-1191.963] (-1190.252) -- 0:00:46
231500 -- (-1191.779) (-1190.051) [-1191.936] (-1189.842) * (-1190.934) [-1190.762] (-1190.618) (-1190.012) -- 0:00:46
232000 -- [-1192.395] (-1189.971) (-1195.107) (-1189.383) * (-1192.377) [-1192.938] (-1190.802) (-1191.145) -- 0:00:46
232500 -- (-1197.066) (-1189.323) [-1192.221] (-1191.490) * (-1191.351) (-1197.813) (-1193.384) [-1190.853] -- 0:00:46
233000 -- [-1190.835] (-1190.823) (-1191.624) (-1191.151) * [-1192.339] (-1199.475) (-1197.286) (-1190.543) -- 0:00:46
233500 -- (-1194.989) (-1190.347) [-1190.567] (-1191.651) * [-1191.515] (-1196.516) (-1192.438) (-1190.113) -- 0:00:45
234000 -- [-1190.405] (-1189.329) (-1191.240) (-1193.485) * (-1190.706) (-1193.187) [-1192.916] (-1192.666) -- 0:00:49
234500 -- (-1191.332) (-1191.779) [-1193.544] (-1193.988) * (-1195.968) (-1194.838) [-1191.136] (-1190.611) -- 0:00:48
235000 -- (-1193.003) (-1192.083) [-1192.236] (-1195.893) * (-1192.162) (-1190.425) [-1199.045] (-1193.250) -- 0:00:48
Average standard deviation of split frequencies: 0.014922
235500 -- [-1192.774] (-1190.846) (-1191.404) (-1195.417) * (-1190.803) (-1190.006) [-1189.384] (-1191.542) -- 0:00:48
236000 -- [-1193.432] (-1189.902) (-1193.684) (-1191.087) * [-1189.883] (-1190.471) (-1191.405) (-1192.874) -- 0:00:48
236500 -- (-1189.998) [-1190.633] (-1194.746) (-1190.445) * (-1194.558) (-1191.271) [-1189.881] (-1192.641) -- 0:00:48
237000 -- (-1192.292) (-1192.294) (-1190.944) [-1189.955] * (-1191.977) (-1194.174) [-1191.024] (-1192.526) -- 0:00:48
237500 -- (-1190.634) (-1194.209) (-1191.017) [-1190.999] * (-1191.569) (-1191.064) (-1189.405) [-1190.295] -- 0:00:48
238000 -- [-1193.236] (-1190.190) (-1190.195) (-1189.977) * (-1191.408) (-1191.479) [-1189.346] (-1191.496) -- 0:00:48
238500 -- (-1195.635) (-1190.869) (-1190.342) [-1192.605] * [-1194.602] (-1192.561) (-1191.839) (-1192.139) -- 0:00:47
239000 -- (-1193.361) (-1191.317) (-1190.023) [-1190.607] * [-1190.740] (-1191.470) (-1192.254) (-1194.971) -- 0:00:47
239500 -- [-1190.864] (-1192.889) (-1190.612) (-1189.519) * (-1192.225) (-1191.042) (-1190.966) [-1190.218] -- 0:00:47
240000 -- (-1189.552) (-1194.941) (-1190.671) [-1191.269] * [-1191.103] (-1191.972) (-1191.448) (-1189.208) -- 0:00:47
Average standard deviation of split frequencies: 0.015785
240500 -- (-1189.607) (-1195.227) [-1190.218] (-1190.574) * [-1193.342] (-1191.190) (-1192.457) (-1196.212) -- 0:00:47
241000 -- (-1190.473) (-1190.472) (-1193.597) [-1190.413] * (-1191.022) (-1190.000) (-1191.215) [-1192.646] -- 0:00:47
241500 -- [-1192.145] (-1189.683) (-1191.145) (-1190.602) * (-1194.839) [-1189.996] (-1191.342) (-1191.928) -- 0:00:47
242000 -- (-1190.506) (-1190.045) [-1190.795] (-1194.374) * [-1190.482] (-1196.759) (-1192.541) (-1191.307) -- 0:00:46
242500 -- (-1193.547) [-1190.898] (-1190.835) (-1194.520) * [-1190.501] (-1191.056) (-1193.439) (-1193.476) -- 0:00:46
243000 -- (-1192.148) (-1191.389) (-1190.818) [-1191.256] * (-1190.229) (-1189.874) [-1191.423] (-1192.112) -- 0:00:46
243500 -- (-1191.422) (-1190.645) (-1193.436) [-1191.100] * (-1190.117) [-1189.773] (-1191.350) (-1192.314) -- 0:00:46
244000 -- (-1192.615) (-1189.681) [-1193.945] (-1190.144) * [-1190.686] (-1190.130) (-1189.900) (-1192.070) -- 0:00:46
244500 -- (-1193.682) (-1191.376) [-1191.277] (-1191.121) * [-1194.298] (-1193.519) (-1190.819) (-1191.168) -- 0:00:46
245000 -- (-1192.873) [-1190.044] (-1191.673) (-1190.301) * [-1191.072] (-1191.026) (-1190.248) (-1190.652) -- 0:00:46
Average standard deviation of split frequencies: 0.014090
245500 -- (-1192.681) (-1189.576) [-1190.785] (-1191.351) * [-1191.363] (-1190.757) (-1190.790) (-1199.775) -- 0:00:46
246000 -- [-1192.990] (-1194.386) (-1194.805) (-1192.454) * (-1190.355) (-1191.778) (-1191.368) [-1190.827] -- 0:00:45
246500 -- (-1191.470) (-1195.884) (-1191.692) [-1192.506] * [-1190.144] (-1191.540) (-1191.025) (-1193.041) -- 0:00:45
247000 -- (-1194.153) (-1191.232) [-1193.581] (-1191.350) * (-1191.562) (-1192.040) [-1192.303] (-1193.937) -- 0:00:45
247500 -- (-1194.429) (-1195.281) [-1190.886] (-1190.973) * (-1193.309) (-1190.634) [-1192.780] (-1193.227) -- 0:00:45
248000 -- (-1195.080) (-1191.268) (-1193.275) [-1190.798] * (-1193.303) (-1192.495) [-1192.734] (-1190.726) -- 0:00:45
248500 -- [-1191.963] (-1191.275) (-1196.864) (-1194.272) * (-1193.458) (-1191.998) [-1191.517] (-1197.519) -- 0:00:45
249000 -- (-1191.375) (-1189.752) [-1191.539] (-1190.049) * (-1193.719) (-1191.944) [-1190.768] (-1190.885) -- 0:00:45
249500 -- (-1192.002) (-1192.276) (-1193.585) [-1193.341] * [-1191.778] (-1190.139) (-1193.799) (-1191.536) -- 0:00:45
250000 -- (-1191.877) [-1189.565] (-1195.504) (-1191.655) * [-1189.957] (-1189.827) (-1194.106) (-1189.922) -- 0:00:48
Average standard deviation of split frequencies: 0.012943
250500 -- (-1194.109) [-1191.805] (-1191.293) (-1193.392) * [-1190.365] (-1189.698) (-1192.683) (-1191.160) -- 0:00:47
251000 -- (-1195.588) (-1191.682) [-1190.890] (-1192.755) * [-1189.980] (-1192.440) (-1191.879) (-1191.937) -- 0:00:47
251500 -- (-1192.259) [-1192.043] (-1191.444) (-1190.000) * [-1191.273] (-1192.446) (-1189.399) (-1192.646) -- 0:00:47
252000 -- (-1191.753) (-1192.574) [-1192.360] (-1190.461) * (-1194.188) (-1190.851) [-1191.699] (-1193.187) -- 0:00:47
252500 -- (-1190.370) (-1192.477) [-1193.804] (-1190.564) * (-1190.772) [-1190.191] (-1193.355) (-1192.982) -- 0:00:47
253000 -- (-1191.153) (-1193.371) (-1193.773) [-1191.414] * (-1191.444) [-1189.853] (-1194.255) (-1193.403) -- 0:00:47
253500 -- (-1192.379) (-1189.480) (-1193.726) [-1191.612] * (-1191.750) [-1189.783] (-1190.527) (-1191.651) -- 0:00:47
254000 -- (-1193.735) (-1189.097) (-1195.822) [-1189.793] * [-1191.996] (-1189.876) (-1194.345) (-1189.638) -- 0:00:46
254500 -- (-1191.916) (-1190.494) [-1197.380] (-1192.314) * [-1190.716] (-1190.130) (-1192.692) (-1189.377) -- 0:00:46
255000 -- [-1189.764] (-1192.055) (-1192.598) (-1191.393) * (-1189.873) (-1192.881) (-1191.321) [-1189.264] -- 0:00:46
Average standard deviation of split frequencies: 0.012673
255500 -- (-1191.454) (-1190.533) (-1193.139) [-1192.279] * (-1189.894) (-1189.058) (-1192.295) [-1190.618] -- 0:00:46
256000 -- (-1195.197) (-1189.325) (-1190.238) [-1191.620] * (-1191.099) [-1189.092] (-1193.834) (-1190.989) -- 0:00:46
256500 -- (-1191.346) (-1193.967) (-1191.097) [-1192.510] * [-1190.332] (-1189.163) (-1196.286) (-1192.390) -- 0:00:46
257000 -- [-1191.988] (-1195.577) (-1196.653) (-1195.417) * [-1190.102] (-1189.163) (-1193.960) (-1195.419) -- 0:00:46
257500 -- [-1191.436] (-1191.222) (-1193.239) (-1193.384) * (-1190.382) [-1190.480] (-1198.775) (-1197.221) -- 0:00:46
258000 -- (-1191.358) [-1191.119] (-1190.441) (-1189.974) * [-1189.316] (-1190.485) (-1195.404) (-1192.237) -- 0:00:46
258500 -- [-1191.722] (-1191.721) (-1191.610) (-1189.472) * (-1191.216) [-1190.773] (-1191.541) (-1191.285) -- 0:00:45
259000 -- (-1189.951) [-1189.714] (-1193.695) (-1189.745) * (-1192.229) [-1190.726] (-1190.503) (-1192.071) -- 0:00:45
259500 -- (-1189.662) (-1189.917) (-1192.222) [-1191.818] * (-1190.751) (-1191.155) [-1190.750] (-1191.106) -- 0:00:45
260000 -- (-1191.472) (-1191.104) [-1192.550] (-1191.092) * (-1192.432) (-1191.219) (-1191.892) [-1191.162] -- 0:00:45
Average standard deviation of split frequencies: 0.012340
260500 -- (-1193.059) (-1190.282) (-1190.564) [-1191.531] * (-1193.320) (-1194.181) (-1192.454) [-1190.977] -- 0:00:45
261000 -- [-1191.611] (-1192.321) (-1190.656) (-1191.486) * [-1189.848] (-1197.618) (-1194.352) (-1191.968) -- 0:00:45
261500 -- (-1189.847) [-1189.154] (-1190.163) (-1190.353) * [-1191.132] (-1191.612) (-1190.695) (-1190.630) -- 0:00:45
262000 -- (-1192.251) (-1190.615) [-1190.164] (-1195.861) * (-1197.751) [-1190.521] (-1191.098) (-1195.349) -- 0:00:45
262500 -- (-1191.902) (-1191.077) (-1192.177) [-1193.501] * (-1194.148) (-1190.522) (-1190.145) [-1189.835] -- 0:00:44
263000 -- (-1195.894) (-1193.112) (-1193.044) [-1192.548] * (-1191.919) [-1190.537] (-1189.781) (-1190.089) -- 0:00:44
263500 -- [-1192.524] (-1190.865) (-1195.713) (-1189.484) * (-1191.591) (-1193.612) [-1189.789] (-1191.983) -- 0:00:44
264000 -- (-1195.516) [-1191.725] (-1191.564) (-1191.204) * (-1191.373) [-1190.648] (-1192.081) (-1190.621) -- 0:00:44
264500 -- (-1194.269) [-1196.539] (-1191.268) (-1191.775) * [-1190.298] (-1190.313) (-1191.282) (-1190.250) -- 0:00:44
265000 -- (-1190.472) (-1191.408) [-1190.289] (-1190.932) * [-1189.173] (-1194.362) (-1192.449) (-1190.544) -- 0:00:44
Average standard deviation of split frequencies: 0.011988
265500 -- (-1191.505) [-1190.504] (-1190.170) (-1191.262) * [-1190.470] (-1190.280) (-1193.721) (-1189.871) -- 0:00:44
266000 -- (-1192.265) (-1190.952) [-1190.616] (-1191.021) * (-1192.757) (-1191.326) [-1190.965] (-1191.162) -- 0:00:46
266500 -- (-1189.933) [-1190.439] (-1191.291) (-1191.601) * [-1190.745] (-1192.547) (-1192.856) (-1191.201) -- 0:00:46
267000 -- (-1189.990) (-1190.890) [-1191.026] (-1191.566) * (-1193.574) (-1192.555) (-1191.455) [-1189.460] -- 0:00:46
267500 -- (-1191.804) (-1190.019) (-1191.656) [-1192.552] * [-1192.340] (-1196.469) (-1191.216) (-1191.306) -- 0:00:46
268000 -- (-1190.126) [-1189.465] (-1190.084) (-1191.811) * [-1191.112] (-1196.338) (-1192.533) (-1193.069) -- 0:00:46
268500 -- (-1190.236) (-1189.531) (-1190.125) [-1192.308] * (-1194.022) (-1189.670) [-1194.156] (-1192.633) -- 0:00:46
269000 -- (-1189.016) [-1189.552] (-1189.925) (-1192.136) * (-1190.081) (-1192.984) [-1191.116] (-1192.446) -- 0:00:46
269500 -- (-1189.472) [-1189.264] (-1192.760) (-1191.758) * (-1194.004) (-1191.161) (-1191.118) [-1192.347] -- 0:00:46
270000 -- (-1191.941) (-1190.470) (-1192.535) [-1190.722] * (-1191.106) (-1190.307) (-1191.110) [-1192.846] -- 0:00:45
Average standard deviation of split frequencies: 0.011030
270500 -- [-1192.260] (-1190.250) (-1192.253) (-1189.125) * (-1191.936) [-1190.624] (-1195.041) (-1193.169) -- 0:00:45
271000 -- (-1192.740) [-1189.805] (-1190.746) (-1190.407) * (-1191.042) (-1189.684) [-1199.726] (-1192.001) -- 0:00:45
271500 -- (-1191.449) (-1192.904) (-1190.548) [-1190.772] * [-1191.526] (-1191.501) (-1195.629) (-1195.178) -- 0:00:45
272000 -- (-1190.090) (-1193.936) (-1191.581) [-1190.788] * (-1191.150) (-1190.123) (-1192.306) [-1191.074] -- 0:00:45
272500 -- (-1189.467) [-1193.837] (-1190.483) (-1191.839) * (-1191.224) [-1189.974] (-1191.032) (-1190.762) -- 0:00:45
273000 -- (-1194.686) (-1195.247) [-1190.386] (-1195.493) * (-1191.819) (-1190.016) (-1191.040) [-1190.005] -- 0:00:45
273500 -- (-1191.295) [-1191.825] (-1193.885) (-1192.950) * (-1189.396) [-1190.343] (-1192.210) (-1193.461) -- 0:00:45
274000 -- (-1193.956) (-1190.326) (-1193.257) [-1191.290] * (-1190.454) [-1190.599] (-1194.652) (-1194.633) -- 0:00:45
274500 -- (-1193.692) (-1190.319) (-1190.840) [-1193.223] * (-1190.786) (-1193.793) (-1191.485) [-1191.267] -- 0:00:44
275000 -- [-1196.012] (-1191.018) (-1190.286) (-1192.552) * (-1191.501) [-1191.315] (-1193.971) (-1190.612) -- 0:00:44
Average standard deviation of split frequencies: 0.010438
275500 -- [-1194.083] (-1189.541) (-1191.520) (-1189.836) * [-1190.801] (-1190.912) (-1190.984) (-1193.980) -- 0:00:44
276000 -- (-1198.114) [-1189.702] (-1190.542) (-1189.953) * (-1190.155) (-1192.119) (-1192.650) [-1190.467] -- 0:00:44
276500 -- (-1189.921) (-1189.567) (-1192.319) [-1189.794] * (-1193.010) (-1191.110) (-1191.927) [-1191.658] -- 0:00:44
277000 -- [-1190.099] (-1191.622) (-1193.134) (-1189.825) * (-1193.616) [-1192.122] (-1189.688) (-1191.465) -- 0:00:44
277500 -- (-1190.046) (-1195.415) (-1190.112) [-1189.437] * [-1190.945] (-1194.794) (-1189.400) (-1190.296) -- 0:00:44
278000 -- [-1190.040] (-1190.622) (-1195.978) (-1189.577) * (-1190.410) (-1190.652) [-1189.905] (-1194.652) -- 0:00:44
278500 -- (-1190.082) [-1190.185] (-1189.866) (-1190.142) * (-1190.965) (-1191.106) (-1193.812) [-1191.484] -- 0:00:44
279000 -- [-1191.885] (-1192.872) (-1190.060) (-1190.149) * (-1190.610) (-1193.404) (-1190.334) [-1193.276] -- 0:00:43
279500 -- (-1193.275) [-1193.194] (-1189.966) (-1193.646) * (-1194.519) (-1190.687) (-1195.134) [-1192.226] -- 0:00:43
280000 -- (-1190.099) [-1190.636] (-1192.612) (-1190.929) * [-1193.932] (-1193.894) (-1195.280) (-1195.346) -- 0:00:43
Average standard deviation of split frequencies: 0.011664
280500 -- (-1190.835) [-1191.294] (-1191.305) (-1190.920) * (-1195.684) [-1190.502] (-1193.519) (-1192.440) -- 0:00:43
281000 -- (-1190.465) [-1189.476] (-1190.878) (-1192.201) * (-1193.685) [-1189.323] (-1191.309) (-1193.279) -- 0:00:43
281500 -- (-1195.196) [-1189.485] (-1192.080) (-1195.958) * (-1192.074) (-1190.904) [-1190.470] (-1193.466) -- 0:00:43
282000 -- (-1193.470) (-1191.520) (-1192.621) [-1192.044] * (-1194.747) [-1192.859] (-1191.458) (-1192.491) -- 0:00:43
282500 -- (-1192.317) (-1191.420) [-1191.339] (-1194.352) * [-1192.760] (-1189.517) (-1191.365) (-1191.263) -- 0:00:45
283000 -- [-1191.528] (-1193.542) (-1191.293) (-1192.551) * (-1192.844) (-1190.721) (-1190.043) [-1190.352] -- 0:00:45
283500 -- (-1191.108) (-1195.807) (-1191.499) [-1190.957] * [-1192.916] (-1189.704) (-1190.540) (-1189.687) -- 0:00:45
284000 -- (-1191.738) (-1193.618) (-1192.494) [-1191.188] * (-1191.433) [-1189.886] (-1191.164) (-1190.519) -- 0:00:45
284500 -- (-1193.836) [-1190.978] (-1191.942) (-1192.769) * (-1192.047) (-1196.814) [-1191.610] (-1189.983) -- 0:00:45
285000 -- (-1193.406) (-1192.731) [-1190.243] (-1193.269) * [-1190.497] (-1191.115) (-1191.419) (-1190.190) -- 0:00:45
Average standard deviation of split frequencies: 0.010988
285500 -- (-1189.623) [-1192.687] (-1190.633) (-1192.216) * [-1189.790] (-1192.096) (-1191.889) (-1189.729) -- 0:00:45
286000 -- (-1191.001) (-1191.856) [-1190.132] (-1193.319) * (-1193.027) [-1190.438] (-1190.084) (-1190.820) -- 0:00:44
286500 -- (-1194.131) [-1194.886] (-1189.555) (-1191.157) * (-1192.978) (-1191.069) (-1191.469) [-1190.909] -- 0:00:44
287000 -- (-1192.768) (-1189.505) (-1197.203) [-1190.395] * [-1191.932] (-1192.324) (-1192.291) (-1192.296) -- 0:00:44
287500 -- (-1189.900) (-1193.205) [-1194.460] (-1193.266) * [-1190.257] (-1190.986) (-1191.222) (-1190.406) -- 0:00:44
288000 -- (-1194.606) (-1189.845) [-1189.920] (-1190.878) * [-1190.591] (-1192.270) (-1190.460) (-1189.459) -- 0:00:44
288500 -- [-1196.407] (-1190.131) (-1191.135) (-1190.892) * (-1191.115) (-1193.768) (-1189.554) [-1190.429] -- 0:00:44
289000 -- (-1192.855) (-1190.131) (-1190.775) [-1194.684] * (-1189.432) [-1191.891] (-1194.157) (-1190.781) -- 0:00:44
289500 -- (-1195.317) (-1191.400) [-1190.203] (-1191.386) * (-1189.707) [-1189.741] (-1192.502) (-1190.512) -- 0:00:44
290000 -- (-1199.810) (-1189.671) [-1197.598] (-1190.590) * [-1190.243] (-1189.665) (-1190.774) (-1191.939) -- 0:00:44
Average standard deviation of split frequencies: 0.010452
290500 -- [-1190.328] (-1190.658) (-1190.831) (-1192.272) * [-1189.236] (-1189.624) (-1192.732) (-1195.451) -- 0:00:43
291000 -- (-1191.849) (-1191.329) (-1191.963) [-1190.548] * (-1189.979) (-1190.028) [-1191.597] (-1197.081) -- 0:00:43
291500 -- (-1193.276) [-1189.651] (-1194.093) (-1191.247) * (-1193.630) (-1195.449) (-1190.773) [-1192.449] -- 0:00:43
292000 -- (-1192.708) [-1190.403] (-1191.940) (-1194.496) * (-1191.989) (-1196.096) [-1189.930] (-1196.399) -- 0:00:43
292500 -- (-1190.914) [-1189.496] (-1196.025) (-1196.266) * (-1190.251) [-1193.850] (-1190.353) (-1192.011) -- 0:00:43
293000 -- (-1190.934) [-1192.188] (-1194.109) (-1194.611) * (-1190.644) [-1189.817] (-1190.216) (-1192.058) -- 0:00:43
293500 -- [-1192.665] (-1190.341) (-1193.936) (-1194.607) * (-1191.262) (-1189.826) (-1191.363) [-1190.300] -- 0:00:43
294000 -- [-1190.100] (-1190.554) (-1191.903) (-1194.416) * (-1193.990) [-1191.113] (-1191.351) (-1191.903) -- 0:00:43
294500 -- (-1189.487) [-1194.020] (-1192.579) (-1191.420) * [-1194.403] (-1192.628) (-1194.672) (-1192.397) -- 0:00:43
295000 -- (-1190.228) (-1196.800) [-1190.150] (-1194.097) * [-1192.074] (-1192.112) (-1194.983) (-1192.396) -- 0:00:43
Average standard deviation of split frequencies: 0.010971
295500 -- (-1189.993) (-1191.020) (-1189.648) [-1193.329] * (-1192.601) (-1192.634) [-1191.026] (-1191.539) -- 0:00:42
296000 -- (-1189.605) (-1191.422) (-1194.761) [-1191.045] * (-1192.530) (-1192.712) [-1194.271] (-1193.682) -- 0:00:42
296500 -- [-1191.906] (-1191.252) (-1198.095) (-1189.976) * [-1191.870] (-1191.027) (-1190.629) (-1191.859) -- 0:00:42
297000 -- (-1190.756) (-1193.693) (-1192.240) [-1190.669] * (-1189.793) (-1197.309) (-1191.843) [-1190.591] -- 0:00:42
297500 -- (-1195.504) [-1190.931] (-1192.206) (-1190.986) * (-1193.255) (-1197.085) (-1190.858) [-1191.704] -- 0:00:42
298000 -- (-1194.912) (-1194.027) (-1189.603) [-1191.531] * (-1193.916) [-1193.946] (-1192.699) (-1191.825) -- 0:00:42
298500 -- (-1189.423) (-1191.496) (-1189.737) [-1191.588] * (-1193.881) [-1192.487] (-1191.962) (-1193.061) -- 0:00:42
299000 -- (-1190.342) (-1190.766) [-1189.408] (-1194.156) * (-1191.184) [-1196.415] (-1190.908) (-1191.321) -- 0:00:44
299500 -- (-1189.824) (-1190.631) [-1192.166] (-1192.369) * (-1190.998) [-1193.119] (-1189.836) (-1189.693) -- 0:00:44
300000 -- (-1191.173) (-1193.923) (-1193.356) [-1190.387] * (-1191.048) (-1190.833) (-1190.577) [-1191.917] -- 0:00:44
Average standard deviation of split frequencies: 0.010801
300500 -- (-1192.161) [-1193.225] (-1193.050) (-1192.066) * (-1190.552) (-1190.065) [-1193.128] (-1190.084) -- 0:00:44
301000 -- [-1189.929] (-1194.357) (-1191.265) (-1194.732) * (-1189.266) (-1189.768) [-1192.121] (-1194.584) -- 0:00:44
301500 -- [-1190.020] (-1197.003) (-1190.238) (-1191.252) * (-1189.573) (-1193.500) (-1190.780) [-1191.145] -- 0:00:44
302000 -- [-1190.958] (-1189.611) (-1190.015) (-1193.899) * (-1189.705) [-1192.192] (-1193.431) (-1191.011) -- 0:00:43
302500 -- [-1190.021] (-1189.921) (-1193.883) (-1193.560) * [-1190.928] (-1191.738) (-1193.704) (-1189.671) -- 0:00:43
303000 -- [-1190.042] (-1189.882) (-1195.297) (-1193.173) * [-1193.084] (-1191.574) (-1191.917) (-1191.971) -- 0:00:43
303500 -- [-1192.257] (-1191.427) (-1193.595) (-1191.254) * (-1192.184) (-1192.563) (-1190.697) [-1195.699] -- 0:00:43
304000 -- (-1193.884) (-1191.014) (-1192.934) [-1195.301] * (-1191.295) (-1190.450) (-1190.794) [-1191.469] -- 0:00:43
304500 -- (-1189.771) [-1191.356] (-1191.165) (-1189.490) * (-1190.618) (-1190.917) [-1191.751] (-1191.039) -- 0:00:43
305000 -- (-1194.540) (-1194.209) [-1190.387] (-1189.892) * (-1191.364) (-1196.947) (-1192.929) [-1190.122] -- 0:00:43
Average standard deviation of split frequencies: 0.011126
305500 -- (-1192.674) (-1190.506) [-1193.052] (-1191.033) * [-1190.443] (-1193.907) (-1191.470) (-1189.655) -- 0:00:43
306000 -- (-1192.549) (-1190.238) [-1192.186] (-1190.791) * (-1190.279) (-1195.334) (-1192.208) [-1189.858] -- 0:00:43
306500 -- (-1194.643) (-1192.707) [-1190.442] (-1191.506) * (-1190.270) (-1191.178) (-1195.225) [-1190.391] -- 0:00:42
307000 -- (-1192.631) [-1192.543] (-1190.606) (-1192.014) * (-1192.798) (-1189.649) [-1190.566] (-1189.561) -- 0:00:42
307500 -- (-1192.376) (-1194.374) (-1193.740) [-1190.932] * (-1191.014) [-1189.013] (-1190.548) (-1189.413) -- 0:00:42
308000 -- (-1190.645) (-1191.648) [-1191.458] (-1189.736) * (-1191.812) (-1190.432) [-1190.981] (-1190.809) -- 0:00:42
308500 -- (-1192.098) (-1191.874) [-1190.415] (-1200.830) * (-1191.620) (-1192.732) (-1191.572) [-1189.893] -- 0:00:42
309000 -- (-1191.786) (-1192.316) [-1189.598] (-1197.961) * (-1189.834) (-1192.554) [-1191.212] (-1189.248) -- 0:00:42
309500 -- [-1192.998] (-1190.522) (-1190.473) (-1198.900) * [-1189.395] (-1192.402) (-1193.475) (-1189.583) -- 0:00:42
310000 -- (-1190.996) (-1190.316) (-1191.084) [-1193.611] * (-1189.890) [-1189.890] (-1190.199) (-1189.583) -- 0:00:42
Average standard deviation of split frequencies: 0.011380
310500 -- (-1194.867) (-1189.531) [-1192.169] (-1191.615) * (-1190.974) (-1193.894) (-1190.197) [-1191.185] -- 0:00:42
311000 -- (-1190.351) (-1189.818) (-1193.313) [-1195.500] * (-1193.417) [-1192.633] (-1190.463) (-1191.977) -- 0:00:42
311500 -- [-1189.983] (-1190.138) (-1194.576) (-1191.394) * (-1189.823) [-1191.586] (-1189.856) (-1191.766) -- 0:00:41
312000 -- [-1191.539] (-1190.130) (-1191.903) (-1193.044) * [-1189.485] (-1189.790) (-1193.364) (-1191.259) -- 0:00:41
312500 -- (-1189.655) [-1189.717] (-1190.446) (-1192.778) * (-1189.446) [-1189.651] (-1190.211) (-1190.697) -- 0:00:41
313000 -- [-1189.903] (-1192.392) (-1194.087) (-1193.801) * (-1190.567) [-1189.347] (-1196.779) (-1197.210) -- 0:00:41
313500 -- (-1191.483) [-1194.484] (-1195.839) (-1191.129) * (-1191.030) [-1189.247] (-1190.857) (-1195.668) -- 0:00:41
314000 -- (-1191.974) [-1192.008] (-1190.974) (-1193.039) * [-1193.913] (-1189.909) (-1189.450) (-1193.847) -- 0:00:41
314500 -- (-1192.302) (-1198.688) [-1190.827] (-1192.312) * (-1193.328) [-1190.692] (-1189.641) (-1192.871) -- 0:00:41
315000 -- (-1190.008) [-1195.847] (-1191.465) (-1193.105) * (-1193.064) (-1190.779) (-1191.273) [-1192.398] -- 0:00:43
Average standard deviation of split frequencies: 0.010618
315500 -- [-1190.525] (-1189.494) (-1193.557) (-1193.197) * (-1192.138) [-1190.673] (-1194.824) (-1190.864) -- 0:00:43
316000 -- (-1191.001) (-1189.570) [-1194.059] (-1193.184) * (-1191.905) (-1191.590) (-1193.157) [-1191.096] -- 0:00:43
316500 -- (-1191.980) (-1190.519) [-1189.985] (-1194.835) * (-1190.332) [-1190.527] (-1196.238) (-1195.856) -- 0:00:43
317000 -- (-1190.559) [-1190.090] (-1191.083) (-1193.975) * (-1192.822) (-1191.918) (-1195.299) [-1195.929] -- 0:00:43
317500 -- (-1192.998) [-1190.148] (-1192.472) (-1191.043) * [-1191.661] (-1191.929) (-1192.057) (-1190.554) -- 0:00:42
318000 -- (-1194.646) (-1193.483) [-1191.432] (-1190.952) * (-1190.762) [-1189.882] (-1190.111) (-1190.947) -- 0:00:42
318500 -- (-1192.312) [-1191.392] (-1190.832) (-1189.266) * (-1191.156) (-1197.442) (-1190.534) [-1193.436] -- 0:00:42
319000 -- [-1190.578] (-1192.067) (-1193.786) (-1189.294) * [-1192.575] (-1195.762) (-1190.382) (-1194.886) -- 0:00:42
319500 -- [-1189.792] (-1193.017) (-1193.339) (-1189.155) * (-1190.792) (-1192.790) (-1192.013) [-1191.570] -- 0:00:42
320000 -- (-1190.558) [-1192.511] (-1194.255) (-1190.378) * [-1190.890] (-1192.426) (-1194.137) (-1191.201) -- 0:00:42
Average standard deviation of split frequencies: 0.010209
320500 -- (-1189.546) [-1189.823] (-1189.589) (-1192.499) * (-1192.976) (-1194.112) (-1192.702) [-1190.270] -- 0:00:42
321000 -- (-1190.535) [-1189.689] (-1189.705) (-1192.128) * (-1190.157) (-1192.828) (-1191.941) [-1193.322] -- 0:00:42
321500 -- (-1190.929) (-1192.660) [-1189.274] (-1194.689) * (-1189.961) (-1194.941) (-1189.330) [-1192.631] -- 0:00:42
322000 -- (-1190.942) [-1190.184] (-1191.811) (-1190.680) * (-1190.300) (-1194.673) (-1193.740) [-1191.753] -- 0:00:42
322500 -- [-1191.044] (-1194.656) (-1190.247) (-1193.550) * (-1191.255) (-1193.586) [-1194.598] (-1192.263) -- 0:00:42
323000 -- (-1189.746) [-1195.377] (-1190.032) (-1192.360) * [-1190.690] (-1190.672) (-1192.363) (-1192.770) -- 0:00:41
323500 -- (-1192.546) (-1190.810) (-1190.095) [-1189.495] * (-1191.159) (-1192.520) [-1194.688] (-1191.841) -- 0:00:41
324000 -- (-1193.068) (-1189.881) (-1194.037) [-1189.458] * (-1194.055) (-1190.633) (-1190.287) [-1193.966] -- 0:00:41
324500 -- (-1191.781) [-1192.957] (-1189.835) (-1189.350) * [-1192.198] (-1191.496) (-1191.004) (-1190.768) -- 0:00:41
325000 -- (-1190.586) (-1191.378) [-1192.496] (-1189.720) * (-1195.307) (-1190.805) (-1193.266) [-1193.309] -- 0:00:41
Average standard deviation of split frequencies: 0.009399
325500 -- (-1190.194) (-1191.960) [-1190.572] (-1191.083) * [-1192.200] (-1193.833) (-1194.551) (-1190.791) -- 0:00:41
326000 -- [-1190.203] (-1190.756) (-1191.040) (-1192.277) * (-1192.075) [-1193.462] (-1192.094) (-1191.427) -- 0:00:41
326500 -- (-1194.058) (-1192.820) (-1190.402) [-1192.799] * (-1190.461) [-1192.776] (-1190.285) (-1191.559) -- 0:00:41
327000 -- [-1192.020] (-1190.510) (-1196.781) (-1190.839) * (-1190.107) (-1192.086) (-1192.337) [-1191.043] -- 0:00:41
327500 -- (-1191.945) (-1195.810) (-1191.558) [-1192.004] * (-1191.195) (-1190.203) [-1192.819] (-1191.540) -- 0:00:41
328000 -- (-1191.349) (-1191.849) (-1192.021) [-1189.714] * [-1190.857] (-1189.829) (-1192.465) (-1191.502) -- 0:00:40
328500 -- (-1189.498) (-1189.643) [-1190.905] (-1192.597) * [-1190.861] (-1192.249) (-1195.075) (-1191.935) -- 0:00:40
329000 -- (-1191.219) (-1190.071) (-1196.390) [-1191.836] * (-1196.050) (-1190.832) (-1191.308) [-1192.831] -- 0:00:40
329500 -- (-1190.805) (-1189.908) [-1192.420] (-1195.845) * (-1190.747) [-1189.812] (-1190.272) (-1193.046) -- 0:00:40
330000 -- (-1191.142) [-1189.660] (-1190.578) (-1197.196) * (-1190.718) (-1192.499) [-1191.737] (-1191.907) -- 0:00:40
Average standard deviation of split frequencies: 0.009425
330500 -- [-1189.954] (-1191.431) (-1189.724) (-1194.195) * (-1190.987) (-1192.066) [-1191.151] (-1189.913) -- 0:00:40
331000 -- (-1189.994) (-1194.828) [-1189.926] (-1191.597) * [-1193.740] (-1191.490) (-1190.805) (-1189.655) -- 0:00:42
331500 -- (-1194.224) (-1192.338) (-1191.238) [-1192.781] * (-1194.353) (-1194.536) [-1190.249] (-1195.955) -- 0:00:42
332000 -- (-1189.809) (-1192.287) [-1192.511] (-1192.035) * (-1196.282) (-1192.914) (-1190.497) [-1193.530] -- 0:00:42
332500 -- (-1190.302) (-1193.287) [-1189.945] (-1190.897) * (-1192.943) [-1191.283] (-1190.981) (-1192.035) -- 0:00:42
333000 -- [-1190.323] (-1190.298) (-1190.224) (-1191.096) * (-1191.433) (-1193.150) (-1193.618) [-1192.455] -- 0:00:42
333500 -- (-1190.988) [-1190.409] (-1191.694) (-1190.794) * [-1191.642] (-1191.716) (-1194.559) (-1193.768) -- 0:00:41
334000 -- (-1189.163) [-1189.790] (-1189.879) (-1195.307) * [-1189.179] (-1195.258) (-1190.894) (-1194.653) -- 0:00:41
334500 -- (-1189.807) [-1190.700] (-1190.646) (-1196.944) * (-1190.135) (-1191.144) [-1191.199] (-1191.962) -- 0:00:41
335000 -- (-1190.460) [-1192.101] (-1191.796) (-1193.209) * (-1190.124) (-1190.401) [-1192.736] (-1191.823) -- 0:00:41
Average standard deviation of split frequencies: 0.010172
335500 -- (-1193.813) (-1192.720) [-1194.598] (-1191.515) * (-1190.798) [-1195.430] (-1190.415) (-1191.991) -- 0:00:41
336000 -- (-1193.367) (-1190.660) (-1191.287) [-1191.305] * (-1190.785) [-1193.794] (-1194.471) (-1193.115) -- 0:00:41
336500 -- (-1194.434) [-1190.524] (-1189.235) (-1190.742) * (-1189.602) (-1193.478) [-1191.224] (-1193.439) -- 0:00:41
337000 -- (-1192.913) (-1189.193) (-1191.029) [-1191.457] * (-1192.102) (-1190.177) [-1191.691] (-1192.308) -- 0:00:41
337500 -- (-1189.797) (-1190.921) [-1190.751] (-1191.650) * (-1191.132) (-1193.065) [-1194.683] (-1189.628) -- 0:00:41
338000 -- (-1194.825) [-1189.232] (-1193.266) (-1192.805) * [-1192.125] (-1193.134) (-1194.038) (-1192.458) -- 0:00:41
338500 -- [-1191.342] (-1189.639) (-1194.382) (-1192.272) * (-1192.927) [-1189.650] (-1191.381) (-1191.489) -- 0:00:41
339000 -- (-1192.143) [-1189.134] (-1191.972) (-1193.000) * (-1191.744) (-1191.581) [-1191.332] (-1190.952) -- 0:00:40
339500 -- [-1190.473] (-1190.171) (-1192.309) (-1193.281) * (-1191.323) (-1190.101) (-1196.618) [-1189.589] -- 0:00:40
340000 -- (-1190.893) (-1190.598) (-1190.643) [-1192.225] * [-1189.369] (-1191.450) (-1196.261) (-1189.737) -- 0:00:40
Average standard deviation of split frequencies: 0.010465
340500 -- [-1190.231] (-1191.601) (-1193.015) (-1191.863) * (-1189.972) (-1191.288) (-1193.237) [-1189.438] -- 0:00:40
341000 -- (-1192.004) [-1191.435] (-1190.053) (-1192.118) * (-1194.409) [-1191.038] (-1192.675) (-1191.342) -- 0:00:40
341500 -- [-1190.471] (-1190.886) (-1189.919) (-1189.959) * (-1190.727) (-1190.096) [-1189.872] (-1191.230) -- 0:00:40
342000 -- (-1190.349) (-1189.938) (-1189.706) [-1189.369] * [-1189.931] (-1190.590) (-1193.338) (-1192.074) -- 0:00:40
342500 -- [-1190.447] (-1189.988) (-1189.812) (-1191.792) * (-1194.074) (-1190.516) (-1191.874) [-1189.886] -- 0:00:40
343000 -- [-1191.144] (-1190.674) (-1193.478) (-1190.873) * (-1190.665) [-1189.710] (-1189.212) (-1190.749) -- 0:00:40
343500 -- (-1193.800) (-1192.621) (-1192.509) [-1190.062] * (-1191.550) (-1189.323) (-1195.265) [-1192.964] -- 0:00:40
344000 -- (-1189.505) (-1191.487) (-1193.220) [-1189.428] * (-1190.303) (-1189.344) [-1191.401] (-1189.206) -- 0:00:40
344500 -- (-1189.382) (-1191.253) (-1195.782) [-1190.689] * [-1193.906] (-1189.455) (-1193.404) (-1189.483) -- 0:00:39
345000 -- (-1189.618) [-1192.265] (-1192.248) (-1191.393) * [-1190.826] (-1192.475) (-1191.420) (-1190.689) -- 0:00:39
Average standard deviation of split frequencies: 0.010018
345500 -- [-1191.408] (-1190.666) (-1191.903) (-1190.865) * (-1193.401) (-1191.101) (-1192.266) [-1189.942] -- 0:00:39
346000 -- (-1189.816) [-1193.637] (-1193.154) (-1193.224) * (-1190.687) (-1194.007) (-1193.015) [-1193.425] -- 0:00:39
346500 -- (-1189.244) (-1191.848) (-1191.177) [-1193.378] * (-1191.930) [-1190.085] (-1194.418) (-1191.008) -- 0:00:39
347000 -- [-1192.825] (-1193.150) (-1191.620) (-1194.488) * (-1191.600) [-1191.811] (-1192.188) (-1192.476) -- 0:00:39
347500 -- (-1192.752) (-1194.180) (-1190.552) [-1191.064] * (-1191.141) (-1192.309) (-1191.057) [-1190.649] -- 0:00:41
348000 -- (-1194.278) (-1189.727) (-1190.832) [-1189.678] * (-1192.477) [-1189.866] (-1189.902) (-1192.144) -- 0:00:41
348500 -- (-1192.415) (-1191.187) [-1191.225] (-1191.924) * (-1190.268) (-1189.446) (-1191.295) [-1196.483] -- 0:00:41
349000 -- (-1190.222) (-1189.963) (-1189.871) [-1190.865] * (-1198.126) (-1189.962) [-1191.673] (-1194.467) -- 0:00:41
349500 -- (-1192.288) (-1190.007) [-1190.030] (-1191.531) * (-1196.396) (-1189.958) (-1191.243) [-1191.082] -- 0:00:40
350000 -- [-1192.953] (-1190.450) (-1190.054) (-1193.320) * [-1189.334] (-1195.034) (-1190.240) (-1191.045) -- 0:00:40
Average standard deviation of split frequencies: 0.009830
350500 -- (-1189.903) (-1191.672) (-1189.741) [-1193.295] * (-1192.802) (-1192.611) [-1192.439] (-1194.564) -- 0:00:40
351000 -- (-1191.667) (-1191.735) (-1192.524) [-1195.485] * (-1192.800) (-1191.147) [-1191.829] (-1195.489) -- 0:00:40
351500 -- (-1191.666) [-1191.347] (-1194.758) (-1192.759) * (-1190.157) (-1190.729) [-1192.943] (-1196.272) -- 0:00:40
352000 -- [-1190.834] (-1191.814) (-1190.518) (-1192.742) * (-1192.669) [-1190.536] (-1191.961) (-1192.751) -- 0:00:40
352500 -- (-1192.929) (-1190.085) [-1190.400] (-1190.075) * (-1195.407) (-1189.616) [-1190.730] (-1194.902) -- 0:00:40
353000 -- (-1191.305) (-1191.033) [-1193.234] (-1191.047) * [-1191.918] (-1193.822) (-1190.489) (-1199.583) -- 0:00:40
353500 -- [-1192.110] (-1193.578) (-1189.217) (-1192.228) * (-1192.350) [-1190.900] (-1190.796) (-1195.397) -- 0:00:40
354000 -- [-1189.680] (-1190.609) (-1190.082) (-1191.060) * (-1190.442) (-1190.452) [-1191.883] (-1194.828) -- 0:00:40
354500 -- (-1192.441) (-1189.851) [-1193.682] (-1191.673) * (-1189.899) (-1199.372) (-1193.579) [-1193.702] -- 0:00:40
355000 -- [-1191.467] (-1190.343) (-1191.975) (-1192.771) * (-1191.434) (-1195.851) (-1190.788) [-1189.906] -- 0:00:39
Average standard deviation of split frequencies: 0.009435
355500 -- (-1192.799) [-1190.516] (-1192.269) (-1190.700) * [-1190.478] (-1191.891) (-1190.289) (-1190.753) -- 0:00:39
356000 -- [-1191.548] (-1189.243) (-1191.752) (-1189.476) * [-1192.089] (-1192.395) (-1195.022) (-1191.684) -- 0:00:39
356500 -- (-1190.661) (-1190.186) (-1192.340) [-1189.936] * (-1189.800) (-1193.210) (-1190.229) [-1196.458] -- 0:00:39
357000 -- (-1189.404) [-1191.484] (-1192.933) (-1192.460) * (-1193.706) (-1194.504) [-1190.405] (-1190.768) -- 0:00:39
357500 -- (-1189.306) [-1191.152] (-1192.338) (-1191.500) * (-1189.897) (-1197.479) (-1189.888) [-1191.420] -- 0:00:39
358000 -- [-1191.020] (-1193.236) (-1191.181) (-1191.129) * [-1189.626] (-1192.905) (-1190.283) (-1192.252) -- 0:00:39
358500 -- (-1193.025) [-1191.938] (-1191.969) (-1191.732) * (-1189.405) (-1196.074) (-1194.134) [-1191.637] -- 0:00:39
359000 -- (-1193.073) (-1189.741) (-1198.471) [-1189.831] * (-1190.755) [-1194.809] (-1190.849) (-1191.574) -- 0:00:39
359500 -- [-1198.847] (-1192.262) (-1191.983) (-1191.206) * (-1191.707) (-1192.544) [-1191.074] (-1191.597) -- 0:00:39
360000 -- (-1192.556) [-1189.451] (-1192.947) (-1192.266) * (-1190.057) (-1190.663) (-1192.749) [-1192.468] -- 0:00:39
Average standard deviation of split frequencies: 0.009966
360500 -- (-1190.750) (-1190.325) (-1191.417) [-1191.537] * [-1191.281] (-1189.641) (-1197.899) (-1191.221) -- 0:00:39
361000 -- (-1191.560) (-1191.891) [-1189.856] (-1191.985) * (-1195.878) (-1191.171) (-1193.959) [-1193.567] -- 0:00:38
361500 -- [-1193.634] (-1191.729) (-1192.019) (-1194.931) * [-1192.521] (-1196.013) (-1192.295) (-1189.917) -- 0:00:38
362000 -- (-1189.222) [-1196.036] (-1191.740) (-1194.072) * [-1191.940] (-1191.950) (-1195.632) (-1191.155) -- 0:00:38
362500 -- [-1189.448] (-1195.685) (-1192.375) (-1193.967) * (-1192.226) (-1194.677) [-1192.322] (-1191.786) -- 0:00:38
363000 -- (-1193.922) [-1196.034] (-1191.550) (-1191.869) * (-1195.383) (-1195.804) [-1189.203] (-1189.828) -- 0:00:38
363500 -- [-1193.277] (-1191.576) (-1191.550) (-1192.814) * (-1191.435) (-1195.122) [-1190.599] (-1190.295) -- 0:00:40
364000 -- (-1192.121) (-1190.323) [-1190.911] (-1191.573) * [-1190.443] (-1190.694) (-1189.823) (-1198.218) -- 0:00:40
364500 -- (-1190.987) [-1190.590] (-1191.412) (-1190.479) * [-1190.447] (-1189.224) (-1193.248) (-1189.678) -- 0:00:40
365000 -- [-1194.152] (-1195.151) (-1189.405) (-1189.972) * (-1190.775) [-1190.866] (-1192.476) (-1193.936) -- 0:00:40
Average standard deviation of split frequencies: 0.008855
365500 -- [-1194.930] (-1189.644) (-1189.287) (-1191.690) * (-1192.363) [-1190.432] (-1193.657) (-1192.407) -- 0:00:39
366000 -- (-1192.060) [-1190.714] (-1190.846) (-1197.531) * (-1189.717) [-1192.863] (-1191.760) (-1192.664) -- 0:00:39
366500 -- (-1192.187) (-1189.569) [-1197.006] (-1190.161) * (-1189.660) (-1193.495) [-1193.412] (-1192.127) -- 0:00:39
367000 -- [-1192.158] (-1189.610) (-1192.597) (-1190.878) * (-1189.817) (-1189.748) (-1191.023) [-1192.014] -- 0:00:39
367500 -- (-1192.090) (-1189.618) (-1190.076) [-1190.289] * (-1193.780) (-1199.026) (-1191.607) [-1189.239] -- 0:00:39
368000 -- (-1190.093) (-1190.656) (-1191.475) [-1194.216] * (-1190.023) (-1195.376) (-1191.664) [-1191.867] -- 0:00:39
368500 -- (-1192.032) (-1190.779) [-1192.126] (-1191.392) * [-1189.764] (-1192.130) (-1190.914) (-1189.870) -- 0:00:39
369000 -- [-1191.610] (-1193.646) (-1190.883) (-1191.628) * [-1190.178] (-1194.758) (-1190.815) (-1190.268) -- 0:00:39
369500 -- [-1192.275] (-1194.263) (-1194.214) (-1191.537) * (-1192.533) (-1194.661) [-1191.372] (-1191.200) -- 0:00:39
370000 -- (-1194.919) (-1191.897) [-1190.382] (-1191.121) * (-1192.632) [-1192.198] (-1196.252) (-1191.084) -- 0:00:39
Average standard deviation of split frequencies: 0.009501
370500 -- [-1191.525] (-1190.231) (-1192.606) (-1193.875) * (-1193.515) (-1191.878) (-1191.596) [-1189.412] -- 0:00:39
371000 -- (-1191.829) [-1190.080] (-1193.793) (-1194.327) * (-1189.420) (-1190.643) [-1192.118] (-1192.868) -- 0:00:38
371500 -- (-1192.111) (-1192.556) (-1194.205) [-1193.861] * (-1190.932) [-1192.028] (-1191.602) (-1192.889) -- 0:00:38
372000 -- (-1191.500) (-1192.094) [-1194.240] (-1193.530) * (-1190.883) (-1194.169) (-1192.116) [-1190.238] -- 0:00:38
372500 -- (-1191.248) [-1190.340] (-1198.766) (-1194.282) * (-1193.191) [-1194.114] (-1189.214) (-1192.408) -- 0:00:38
373000 -- (-1190.713) (-1190.781) [-1191.878] (-1193.249) * [-1195.888] (-1194.462) (-1189.209) (-1190.029) -- 0:00:38
373500 -- (-1193.693) (-1191.321) [-1190.377] (-1193.375) * (-1191.286) (-1193.038) [-1192.139] (-1190.244) -- 0:00:38
374000 -- (-1191.377) [-1191.246] (-1195.611) (-1191.981) * (-1191.516) (-1192.647) [-1191.176] (-1190.660) -- 0:00:38
374500 -- [-1191.683] (-1191.613) (-1191.031) (-1191.602) * (-1192.954) [-1192.663] (-1190.240) (-1192.591) -- 0:00:38
375000 -- (-1198.031) [-1190.373] (-1192.783) (-1193.080) * (-1191.097) [-1191.002] (-1190.282) (-1190.787) -- 0:00:38
Average standard deviation of split frequencies: 0.009587
375500 -- (-1194.259) (-1190.948) (-1196.216) [-1190.138] * (-1197.845) [-1190.349] (-1189.989) (-1190.211) -- 0:00:38
376000 -- (-1197.965) [-1192.521] (-1196.768) (-1192.918) * (-1193.520) [-1190.364] (-1190.802) (-1191.293) -- 0:00:38
376500 -- (-1196.551) (-1191.597) (-1193.037) [-1191.017] * (-1194.040) (-1189.752) [-1196.298] (-1192.120) -- 0:00:38
377000 -- (-1192.922) [-1194.139] (-1191.975) (-1191.492) * (-1191.571) [-1191.761] (-1192.539) (-1193.388) -- 0:00:38
377500 -- [-1193.467] (-1190.779) (-1189.843) (-1190.485) * [-1193.853] (-1193.617) (-1189.892) (-1191.675) -- 0:00:37
378000 -- (-1192.597) (-1193.267) [-1190.399] (-1189.937) * [-1190.477] (-1198.228) (-1190.831) (-1190.676) -- 0:00:37
378500 -- (-1189.524) (-1194.247) (-1193.215) [-1190.528] * [-1190.649] (-1190.746) (-1190.756) (-1191.897) -- 0:00:37
379000 -- (-1190.923) (-1191.835) [-1192.802] (-1189.874) * (-1192.568) (-1190.798) [-1193.722] (-1190.602) -- 0:00:37
379500 -- (-1190.917) (-1192.253) (-1189.575) [-1190.588] * (-1192.900) (-1190.278) [-1192.472] (-1190.903) -- 0:00:37
380000 -- (-1190.148) (-1191.327) (-1189.640) [-1189.234] * (-1193.198) (-1191.357) (-1191.255) [-1191.170] -- 0:00:39
Average standard deviation of split frequencies: 0.009632
380500 -- [-1189.954] (-1189.596) (-1189.989) (-1190.862) * (-1197.718) [-1190.316] (-1192.197) (-1191.534) -- 0:00:39
381000 -- (-1189.761) (-1190.623) [-1189.487] (-1191.135) * (-1194.180) (-1190.519) [-1191.807] (-1190.228) -- 0:00:38
381500 -- (-1193.595) (-1190.872) (-1190.547) [-1191.131] * (-1190.905) [-1193.064] (-1189.537) (-1190.436) -- 0:00:38
382000 -- (-1192.859) (-1192.672) [-1191.820] (-1193.228) * [-1190.473] (-1196.384) (-1190.728) (-1189.434) -- 0:00:38
382500 -- (-1192.439) (-1193.005) [-1191.127] (-1193.871) * (-1190.276) [-1189.957] (-1190.358) (-1192.884) -- 0:00:38
383000 -- (-1192.147) [-1192.261] (-1189.530) (-1192.276) * (-1189.460) (-1190.733) (-1190.979) [-1193.512] -- 0:00:38
383500 -- (-1192.362) (-1196.723) (-1190.226) [-1189.685] * (-1192.321) [-1189.490] (-1191.045) (-1192.290) -- 0:00:38
384000 -- (-1193.356) (-1190.459) [-1189.756] (-1191.241) * (-1192.999) [-1190.427] (-1192.216) (-1196.295) -- 0:00:38
384500 -- (-1192.279) (-1190.236) (-1190.951) [-1194.606] * (-1194.473) [-1190.485] (-1192.050) (-1193.688) -- 0:00:38
385000 -- (-1190.437) (-1191.561) (-1190.191) [-1190.961] * (-1195.922) [-1189.512] (-1189.703) (-1191.795) -- 0:00:38
Average standard deviation of split frequencies: 0.008405
385500 -- (-1191.403) (-1190.656) [-1190.445] (-1191.736) * (-1196.548) [-1190.739] (-1190.897) (-1192.365) -- 0:00:38
386000 -- (-1190.664) (-1190.571) (-1189.991) [-1191.131] * (-1190.784) (-1190.134) [-1191.318] (-1193.551) -- 0:00:38
386500 -- (-1190.442) (-1190.216) [-1192.433] (-1191.673) * [-1190.065] (-1191.045) (-1195.745) (-1190.679) -- 0:00:38
387000 -- (-1191.814) (-1193.390) (-1193.610) [-1191.329] * (-1189.598) (-1191.847) (-1189.787) [-1191.717] -- 0:00:38
387500 -- [-1191.824] (-1189.840) (-1196.103) (-1190.271) * [-1191.521] (-1190.435) (-1192.423) (-1190.065) -- 0:00:37
388000 -- (-1193.498) (-1189.739) (-1193.146) [-1191.710] * (-1197.449) [-1194.303] (-1191.066) (-1191.908) -- 0:00:37
388500 -- (-1189.633) [-1190.380] (-1191.282) (-1192.126) * [-1191.035] (-1190.775) (-1190.588) (-1191.656) -- 0:00:37
389000 -- (-1189.819) (-1193.295) [-1192.173] (-1191.390) * (-1195.599) (-1190.653) (-1192.616) [-1192.754] -- 0:00:37
389500 -- (-1189.664) (-1193.478) (-1193.031) [-1193.073] * (-1191.840) [-1191.754] (-1192.514) (-1193.042) -- 0:00:37
390000 -- (-1192.798) [-1190.426] (-1189.899) (-1190.909) * (-1190.459) [-1190.956] (-1190.243) (-1193.198) -- 0:00:37
Average standard deviation of split frequencies: 0.008447
390500 -- (-1191.805) [-1190.688] (-1193.724) (-1193.315) * (-1191.991) [-1189.908] (-1193.916) (-1194.771) -- 0:00:37
391000 -- (-1194.988) (-1190.639) (-1196.384) [-1192.568] * (-1191.326) (-1189.792) (-1195.404) [-1190.977] -- 0:00:37
391500 -- [-1191.086] (-1190.587) (-1192.525) (-1189.961) * (-1190.861) [-1191.235] (-1198.100) (-1191.996) -- 0:00:37
392000 -- (-1191.062) (-1191.043) (-1190.659) [-1189.992] * (-1190.033) [-1195.602] (-1191.145) (-1191.195) -- 0:00:37
392500 -- (-1193.236) [-1196.024] (-1189.947) (-1190.030) * (-1190.028) [-1190.333] (-1192.580) (-1191.090) -- 0:00:37
393000 -- (-1191.275) (-1192.013) (-1189.529) [-1192.568] * [-1189.856] (-1193.638) (-1194.389) (-1191.856) -- 0:00:37
393500 -- [-1193.397] (-1191.670) (-1190.572) (-1193.953) * (-1189.235) (-1192.087) (-1191.467) [-1190.119] -- 0:00:36
394000 -- (-1193.651) (-1190.440) (-1190.248) [-1191.000] * (-1189.492) (-1190.008) (-1197.716) [-1191.199] -- 0:00:36
394500 -- [-1198.164] (-1190.780) (-1189.542) (-1189.935) * [-1189.863] (-1191.933) (-1190.054) (-1193.401) -- 0:00:36
395000 -- (-1192.432) [-1189.512] (-1190.451) (-1190.988) * [-1189.789] (-1195.327) (-1189.711) (-1193.823) -- 0:00:36
Average standard deviation of split frequencies: 0.007589
395500 -- (-1194.764) [-1190.601] (-1190.431) (-1190.297) * [-1192.730] (-1193.691) (-1191.160) (-1193.299) -- 0:00:36
396000 -- (-1191.917) (-1192.309) (-1193.373) [-1190.070] * (-1192.208) (-1192.068) (-1191.974) [-1192.936] -- 0:00:36
396500 -- (-1191.800) [-1194.126] (-1193.864) (-1192.706) * (-1192.269) (-1192.938) (-1191.371) [-1192.333] -- 0:00:38
397000 -- (-1189.986) (-1192.027) (-1190.279) [-1191.386] * [-1189.894] (-1194.170) (-1191.015) (-1191.786) -- 0:00:37
397500 -- (-1189.859) (-1190.388) [-1191.714] (-1190.794) * (-1191.900) (-1192.715) (-1191.285) [-1189.781] -- 0:00:37
398000 -- (-1193.979) [-1189.778] (-1192.018) (-1190.229) * [-1190.333] (-1191.685) (-1190.395) (-1193.250) -- 0:00:37
398500 -- (-1192.378) [-1189.785] (-1191.200) (-1190.461) * [-1191.299] (-1191.070) (-1191.405) (-1190.828) -- 0:00:37
399000 -- (-1194.937) (-1193.521) (-1196.369) [-1189.573] * (-1192.857) [-1189.450] (-1190.660) (-1189.322) -- 0:00:37
399500 -- [-1190.018] (-1195.722) (-1196.081) (-1190.078) * (-1194.195) (-1192.867) (-1189.562) [-1190.752] -- 0:00:37
400000 -- [-1189.895] (-1189.928) (-1190.503) (-1189.569) * (-1193.353) [-1189.211] (-1191.239) (-1192.492) -- 0:00:37
Average standard deviation of split frequencies: 0.007059
400500 -- [-1192.231] (-1190.578) (-1190.712) (-1189.233) * (-1193.245) (-1189.534) (-1190.172) [-1191.517] -- 0:00:37
401000 -- (-1189.530) (-1192.914) [-1190.459] (-1190.978) * (-1190.806) [-1192.456] (-1193.176) (-1192.443) -- 0:00:37
401500 -- (-1194.989) (-1194.617) (-1192.721) [-1190.947] * (-1192.674) (-1189.737) (-1191.228) [-1190.674] -- 0:00:37
402000 -- (-1190.055) (-1193.323) (-1192.948) [-1192.251] * (-1192.438) (-1190.966) (-1195.030) [-1190.488] -- 0:00:37
402500 -- (-1190.088) [-1192.035] (-1192.756) (-1191.269) * (-1190.002) [-1190.731] (-1191.241) (-1190.101) -- 0:00:37
403000 -- (-1189.856) (-1189.610) [-1191.159] (-1191.124) * [-1192.414] (-1190.575) (-1192.031) (-1190.446) -- 0:00:37
403500 -- (-1190.879) (-1189.442) (-1192.975) [-1190.362] * [-1191.490] (-1193.777) (-1192.294) (-1191.108) -- 0:00:36
404000 -- (-1190.506) [-1191.103] (-1193.678) (-1192.010) * (-1190.723) (-1190.554) [-1192.047] (-1191.733) -- 0:00:36
404500 -- [-1193.719] (-1190.858) (-1190.555) (-1192.697) * (-1189.952) (-1190.271) (-1193.511) [-1191.234] -- 0:00:36
405000 -- (-1190.926) (-1190.765) (-1190.402) [-1191.116] * [-1191.495] (-1195.092) (-1194.770) (-1193.259) -- 0:00:36
Average standard deviation of split frequencies: 0.007329
405500 -- (-1193.700) (-1192.347) (-1197.772) [-1189.716] * (-1189.685) [-1191.966] (-1192.976) (-1190.971) -- 0:00:36
406000 -- (-1190.088) (-1191.069) [-1190.382] (-1190.665) * (-1191.418) [-1191.991] (-1189.556) (-1194.346) -- 0:00:36
406500 -- [-1193.804] (-1189.848) (-1190.797) (-1191.731) * (-1191.600) (-1190.532) [-1189.732] (-1190.546) -- 0:00:36
407000 -- (-1194.724) [-1190.787] (-1192.527) (-1192.931) * (-1192.961) [-1190.785] (-1189.801) (-1189.663) -- 0:00:36
407500 -- (-1193.569) (-1193.488) [-1194.123] (-1189.851) * (-1193.202) [-1190.227] (-1195.830) (-1192.509) -- 0:00:36
408000 -- (-1194.299) (-1193.496) [-1191.999] (-1189.129) * (-1195.402) [-1189.918] (-1192.559) (-1190.471) -- 0:00:36
408500 -- (-1189.466) (-1191.999) (-1192.300) [-1189.129] * (-1193.781) (-1193.160) [-1193.866] (-1190.867) -- 0:00:36
409000 -- [-1195.895] (-1191.041) (-1191.729) (-1189.129) * (-1197.833) [-1191.708] (-1196.271) (-1193.212) -- 0:00:36
409500 -- (-1190.190) (-1191.990) [-1190.938] (-1189.836) * (-1191.530) (-1191.280) (-1190.750) [-1199.791] -- 0:00:36
410000 -- [-1191.943] (-1190.240) (-1191.570) (-1192.179) * (-1195.336) (-1191.863) [-1192.289] (-1190.473) -- 0:00:35
Average standard deviation of split frequencies: 0.007748
410500 -- [-1189.261] (-1191.356) (-1192.378) (-1190.345) * (-1194.977) (-1190.239) [-1190.017] (-1194.477) -- 0:00:35
411000 -- (-1194.740) (-1192.618) (-1191.087) [-1190.093] * (-1192.902) (-1189.699) (-1189.768) [-1193.879] -- 0:00:35
411500 -- (-1196.397) [-1189.337] (-1195.936) (-1192.054) * (-1194.416) (-1189.341) [-1190.102] (-1191.240) -- 0:00:35
412000 -- (-1192.072) (-1191.090) (-1194.315) [-1191.741] * (-1192.255) (-1189.340) (-1194.130) [-1190.070] -- 0:00:35
412500 -- (-1194.162) (-1193.044) [-1195.947] (-1194.223) * (-1189.971) (-1190.998) (-1190.853) [-1190.014] -- 0:00:37
413000 -- (-1189.392) (-1196.134) [-1198.763] (-1191.609) * (-1192.934) (-1189.900) [-1192.688] (-1190.542) -- 0:00:36
413500 -- [-1189.936] (-1191.343) (-1189.941) (-1192.383) * (-1190.921) [-1192.748] (-1189.978) (-1191.566) -- 0:00:36
414000 -- (-1193.979) (-1191.636) [-1195.900] (-1195.425) * (-1193.428) (-1190.821) [-1190.063] (-1191.095) -- 0:00:36
414500 -- (-1191.418) [-1191.615] (-1189.675) (-1190.673) * [-1192.581] (-1190.178) (-1190.740) (-1190.694) -- 0:00:36
415000 -- [-1190.922] (-1193.577) (-1191.123) (-1190.023) * (-1192.653) (-1191.962) (-1190.670) [-1190.682] -- 0:00:36
Average standard deviation of split frequencies: 0.007599
415500 -- [-1189.508] (-1191.979) (-1195.011) (-1190.075) * [-1190.953] (-1193.768) (-1191.021) (-1191.355) -- 0:00:36
416000 -- (-1190.694) (-1190.535) (-1190.595) [-1190.694] * (-1189.660) (-1195.753) (-1190.564) [-1189.989] -- 0:00:36
416500 -- (-1192.184) [-1190.481] (-1192.462) (-1191.091) * (-1190.225) (-1193.865) (-1193.835) [-1189.677] -- 0:00:36
417000 -- (-1190.627) (-1195.700) [-1190.318] (-1199.709) * (-1192.167) (-1194.378) [-1192.851] (-1192.894) -- 0:00:36
417500 -- (-1194.633) (-1192.026) (-1193.440) [-1196.503] * (-1193.463) (-1194.977) (-1191.744) [-1192.648] -- 0:00:36
418000 -- (-1194.407) (-1196.156) (-1193.672) [-1192.557] * (-1192.120) [-1193.018] (-1189.568) (-1189.556) -- 0:00:36
418500 -- [-1190.733] (-1193.139) (-1192.052) (-1189.922) * [-1190.831] (-1189.981) (-1189.474) (-1190.020) -- 0:00:36
419000 -- (-1190.113) (-1193.613) [-1190.070] (-1196.180) * [-1192.246] (-1190.642) (-1190.739) (-1191.270) -- 0:00:36
419500 -- (-1190.243) [-1191.520] (-1190.592) (-1194.423) * (-1193.885) (-1189.483) [-1193.048] (-1191.415) -- 0:00:35
420000 -- (-1189.988) (-1190.653) (-1189.846) [-1190.377] * (-1199.583) (-1193.022) [-1193.398] (-1192.994) -- 0:00:35
Average standard deviation of split frequencies: 0.007144
420500 -- [-1190.017] (-1194.939) (-1195.380) (-1194.049) * (-1191.263) [-1193.931] (-1194.401) (-1192.025) -- 0:00:35
421000 -- [-1189.755] (-1196.504) (-1191.750) (-1189.620) * (-1192.831) [-1190.497] (-1190.235) (-1191.433) -- 0:00:35
421500 -- (-1191.936) (-1193.182) [-1192.269] (-1194.587) * (-1191.522) (-1191.312) (-1189.596) [-1192.286] -- 0:00:35
422000 -- (-1189.920) [-1191.187] (-1195.377) (-1194.625) * [-1190.133] (-1194.383) (-1189.763) (-1191.140) -- 0:00:35
422500 -- (-1192.859) (-1191.501) [-1193.959] (-1191.624) * (-1199.239) [-1192.113] (-1191.274) (-1193.349) -- 0:00:35
423000 -- (-1191.738) (-1193.727) (-1194.744) [-1191.576] * (-1191.297) [-1190.413] (-1190.559) (-1192.780) -- 0:00:35
423500 -- (-1192.454) [-1190.525] (-1189.732) (-1194.203) * (-1194.363) (-1192.078) [-1190.545] (-1190.180) -- 0:00:35
424000 -- (-1190.881) (-1195.859) (-1189.690) [-1191.840] * [-1194.704] (-1193.134) (-1190.852) (-1190.056) -- 0:00:35
424500 -- (-1190.243) (-1192.358) [-1189.507] (-1191.933) * (-1193.145) [-1191.406] (-1190.352) (-1192.725) -- 0:00:35
425000 -- [-1190.978] (-1189.824) (-1190.469) (-1193.335) * (-1191.089) [-1191.958] (-1192.985) (-1194.248) -- 0:00:35
Average standard deviation of split frequencies: 0.007303
425500 -- [-1193.263] (-1191.198) (-1189.741) (-1192.837) * [-1195.045] (-1191.068) (-1190.071) (-1191.432) -- 0:00:35
426000 -- (-1192.412) [-1190.941] (-1189.882) (-1190.251) * [-1191.549] (-1190.241) (-1190.940) (-1190.680) -- 0:00:35
426500 -- [-1189.438] (-1191.721) (-1189.056) (-1189.664) * (-1190.556) (-1193.089) [-1190.294] (-1189.992) -- 0:00:34
427000 -- (-1190.716) (-1189.951) (-1189.896) [-1190.022] * (-1190.290) (-1191.420) (-1190.209) [-1190.062] -- 0:00:34
427500 -- (-1192.292) (-1191.153) [-1189.748] (-1193.767) * (-1196.862) (-1194.358) (-1195.183) [-1189.543] -- 0:00:34
428000 -- (-1193.185) (-1189.918) (-1189.942) [-1189.433] * (-1194.866) (-1193.518) [-1193.391] (-1194.262) -- 0:00:34
428500 -- (-1191.406) [-1191.799] (-1190.164) (-1191.364) * (-1193.027) (-1191.888) (-1191.761) [-1192.124] -- 0:00:34
429000 -- (-1190.495) (-1191.332) (-1192.091) [-1192.544] * (-1193.264) [-1193.020] (-1192.516) (-1190.611) -- 0:00:35
429500 -- (-1192.404) (-1197.496) [-1192.100] (-1192.825) * (-1194.630) (-1191.690) [-1191.373] (-1190.804) -- 0:00:35
430000 -- (-1194.569) (-1192.253) [-1191.487] (-1191.047) * (-1192.184) [-1191.640] (-1193.130) (-1194.702) -- 0:00:35
Average standard deviation of split frequencies: 0.007224
430500 -- (-1190.090) (-1192.905) (-1190.368) [-1189.772] * (-1191.266) (-1191.259) (-1191.574) [-1194.237] -- 0:00:35
431000 -- (-1191.721) (-1195.384) (-1192.915) [-1189.513] * [-1190.798] (-1191.895) (-1191.683) (-1195.411) -- 0:00:35
431500 -- (-1190.328) [-1193.221] (-1192.237) (-1189.222) * (-1190.075) [-1190.572] (-1190.402) (-1199.313) -- 0:00:35
432000 -- (-1190.652) (-1192.240) [-1189.758] (-1191.653) * (-1193.448) (-1190.308) [-1191.560] (-1194.369) -- 0:00:35
432500 -- (-1191.594) (-1192.506) [-1189.261] (-1189.900) * (-1191.229) [-1190.475] (-1191.921) (-1191.131) -- 0:00:35
433000 -- (-1190.126) [-1194.721] (-1191.177) (-1193.327) * (-1189.543) [-1191.116] (-1191.760) (-1191.388) -- 0:00:35
433500 -- (-1192.967) [-1195.016] (-1190.851) (-1189.608) * (-1191.768) [-1192.143] (-1192.264) (-1190.042) -- 0:00:35
434000 -- (-1192.259) [-1191.924] (-1191.891) (-1190.321) * [-1191.075] (-1191.631) (-1195.333) (-1190.029) -- 0:00:35
434500 -- (-1190.086) (-1189.988) [-1190.872] (-1190.313) * [-1190.716] (-1190.293) (-1199.408) (-1190.331) -- 0:00:35
435000 -- (-1191.130) (-1190.878) [-1193.264] (-1193.324) * (-1192.239) (-1192.740) (-1191.635) [-1191.123] -- 0:00:35
Average standard deviation of split frequencies: 0.006920
435500 -- (-1192.076) [-1189.700] (-1194.126) (-1193.634) * (-1189.427) [-1192.996] (-1196.975) (-1191.743) -- 0:00:34
436000 -- (-1194.803) (-1191.410) [-1190.571] (-1193.107) * (-1190.143) [-1192.762] (-1190.214) (-1191.002) -- 0:00:34
436500 -- (-1189.835) (-1191.359) [-1190.595] (-1189.862) * (-1190.081) (-1191.079) [-1193.421] (-1190.496) -- 0:00:34
437000 -- [-1191.739] (-1193.164) (-1194.257) (-1190.051) * (-1194.944) (-1190.377) (-1191.068) [-1190.229] -- 0:00:34
437500 -- (-1191.194) (-1193.250) (-1190.942) [-1191.790] * [-1193.839] (-1192.223) (-1190.770) (-1192.724) -- 0:00:34
438000 -- (-1189.934) (-1200.804) [-1192.492] (-1193.008) * (-1193.792) [-1190.505] (-1191.029) (-1192.045) -- 0:00:34
438500 -- [-1190.023] (-1191.226) (-1191.452) (-1193.469) * [-1191.370] (-1193.816) (-1192.159) (-1191.230) -- 0:00:34
439000 -- [-1191.039] (-1190.240) (-1190.860) (-1191.732) * (-1191.380) (-1196.364) (-1191.153) [-1191.452] -- 0:00:34
439500 -- (-1191.102) (-1191.407) [-1191.066] (-1190.644) * (-1189.616) (-1191.974) (-1195.536) [-1192.508] -- 0:00:34
440000 -- (-1193.029) [-1189.994] (-1191.356) (-1194.039) * (-1192.196) (-1189.886) (-1191.759) [-1190.505] -- 0:00:34
Average standard deviation of split frequencies: 0.006953
440500 -- (-1191.943) [-1190.251] (-1190.773) (-1189.753) * (-1190.522) (-1189.864) (-1193.797) [-1190.839] -- 0:00:34
441000 -- (-1193.970) [-1192.171] (-1189.883) (-1191.923) * (-1189.345) (-1190.470) (-1192.111) [-1190.739] -- 0:00:34
441500 -- (-1189.735) [-1190.760] (-1191.023) (-1191.665) * (-1191.343) (-1189.757) [-1190.754] (-1193.605) -- 0:00:34
442000 -- (-1189.763) [-1191.154] (-1191.160) (-1191.019) * [-1190.062] (-1192.590) (-1190.045) (-1189.659) -- 0:00:34
442500 -- (-1190.190) [-1191.763] (-1190.476) (-1191.465) * (-1189.660) [-1191.641] (-1189.832) (-1191.199) -- 0:00:34
443000 -- (-1193.367) (-1193.756) (-1191.247) [-1190.454] * (-1193.470) (-1191.610) (-1190.141) [-1191.089] -- 0:00:33
443500 -- (-1195.435) (-1192.577) (-1191.937) [-1189.939] * [-1189.449] (-1190.098) (-1190.667) (-1191.404) -- 0:00:33
444000 -- (-1191.108) [-1192.252] (-1190.904) (-1192.244) * [-1193.303] (-1190.133) (-1189.839) (-1189.840) -- 0:00:33
444500 -- (-1191.670) (-1196.308) [-1190.559] (-1189.980) * (-1193.011) (-1193.583) (-1193.569) [-1197.081] -- 0:00:33
445000 -- (-1191.345) (-1194.535) (-1190.660) [-1189.954] * (-1193.082) (-1191.209) (-1190.607) [-1190.132] -- 0:00:34
Average standard deviation of split frequencies: 0.006483
445500 -- (-1196.488) (-1195.046) [-1189.532] (-1189.667) * (-1193.735) (-1190.345) (-1190.458) [-1190.236] -- 0:00:34
446000 -- (-1193.985) [-1193.411] (-1190.521) (-1195.408) * [-1191.632] (-1190.034) (-1191.284) (-1194.313) -- 0:00:34
446500 -- (-1192.511) (-1195.054) [-1191.036] (-1199.170) * [-1190.517] (-1190.776) (-1191.167) (-1195.075) -- 0:00:34
447000 -- (-1194.467) [-1192.133] (-1191.600) (-1196.138) * [-1190.925] (-1191.606) (-1191.144) (-1191.744) -- 0:00:34
447500 -- (-1190.520) (-1195.241) (-1190.473) [-1191.706] * (-1190.520) [-1192.281] (-1190.878) (-1196.080) -- 0:00:34
448000 -- [-1191.438] (-1191.121) (-1190.820) (-1190.550) * [-1191.986] (-1194.797) (-1195.683) (-1194.428) -- 0:00:34
448500 -- [-1193.154] (-1191.030) (-1196.241) (-1192.289) * [-1190.125] (-1192.777) (-1194.018) (-1191.473) -- 0:00:34
449000 -- (-1192.631) (-1192.479) [-1193.762] (-1191.451) * (-1191.286) (-1191.070) [-1193.690] (-1191.107) -- 0:00:34
449500 -- (-1190.296) (-1194.854) [-1193.172] (-1191.865) * (-1191.188) (-1189.823) [-1193.278] (-1191.158) -- 0:00:34
450000 -- [-1191.538] (-1192.234) (-1194.331) (-1190.911) * [-1190.048] (-1190.484) (-1191.328) (-1191.190) -- 0:00:34
Average standard deviation of split frequencies: 0.006555
450500 -- (-1192.083) [-1191.668] (-1191.608) (-1189.986) * [-1189.565] (-1189.804) (-1194.992) (-1191.348) -- 0:00:34
451000 -- (-1193.959) [-1195.858] (-1196.818) (-1190.420) * (-1191.123) (-1191.582) [-1191.280] (-1194.985) -- 0:00:34
451500 -- (-1191.724) [-1191.617] (-1190.858) (-1189.813) * (-1192.145) [-1191.407] (-1190.425) (-1191.987) -- 0:00:34
452000 -- [-1190.453] (-1190.404) (-1189.665) (-1190.262) * (-1194.220) (-1190.688) (-1190.662) [-1191.282] -- 0:00:33
452500 -- (-1193.314) [-1192.760] (-1194.229) (-1191.201) * (-1195.124) [-1190.524] (-1193.380) (-1192.295) -- 0:00:33
453000 -- [-1189.564] (-1190.296) (-1195.535) (-1196.305) * (-1191.042) [-1191.273] (-1190.991) (-1192.114) -- 0:00:33
453500 -- (-1192.863) [-1191.475] (-1191.087) (-1194.037) * (-1193.578) [-1194.397] (-1191.154) (-1192.611) -- 0:00:33
454000 -- (-1196.533) (-1190.369) [-1190.585] (-1194.088) * [-1190.603] (-1194.358) (-1190.062) (-1195.216) -- 0:00:33
454500 -- (-1189.529) [-1190.085] (-1190.209) (-1193.154) * [-1190.356] (-1192.512) (-1191.334) (-1191.373) -- 0:00:33
455000 -- (-1191.057) [-1190.141] (-1189.800) (-1192.089) * (-1190.821) (-1193.130) [-1190.095] (-1191.174) -- 0:00:33
Average standard deviation of split frequencies: 0.007099
455500 -- (-1189.992) (-1191.191) (-1189.756) [-1191.222] * (-1190.015) [-1191.875] (-1191.953) (-1191.476) -- 0:00:33
456000 -- (-1191.513) [-1190.645] (-1189.911) (-1193.262) * (-1190.839) [-1193.784] (-1190.303) (-1191.047) -- 0:00:33
456500 -- (-1190.993) [-1196.400] (-1189.958) (-1191.625) * (-1191.181) (-1190.851) (-1191.056) [-1191.841] -- 0:00:33
457000 -- [-1190.893] (-1190.627) (-1193.623) (-1192.292) * [-1189.418] (-1189.875) (-1190.571) (-1189.355) -- 0:00:33
457500 -- [-1191.189] (-1190.088) (-1195.028) (-1192.941) * (-1189.769) [-1191.087] (-1193.478) (-1190.038) -- 0:00:33
458000 -- (-1192.819) (-1189.684) (-1192.692) [-1196.176] * [-1190.537] (-1195.504) (-1190.938) (-1190.399) -- 0:00:33
458500 -- [-1192.815] (-1190.657) (-1192.032) (-1190.141) * [-1189.363] (-1196.799) (-1189.668) (-1191.019) -- 0:00:33
459000 -- (-1192.475) (-1191.646) [-1190.759] (-1189.730) * [-1189.481] (-1191.355) (-1193.510) (-1193.060) -- 0:00:33
459500 -- (-1192.167) [-1189.519] (-1190.284) (-1190.522) * (-1191.244) (-1190.510) [-1191.330] (-1195.123) -- 0:00:32
460000 -- [-1189.795] (-1190.717) (-1190.515) (-1190.823) * (-1190.249) (-1190.720) (-1190.953) [-1192.538] -- 0:00:32
Average standard deviation of split frequencies: 0.007163
460500 -- [-1190.146] (-1190.653) (-1192.780) (-1193.364) * [-1191.554] (-1191.070) (-1192.787) (-1192.185) -- 0:00:33
461000 -- (-1190.903) (-1190.717) (-1190.844) [-1191.878] * (-1191.345) (-1191.170) (-1190.854) [-1193.649] -- 0:00:33
461500 -- (-1190.826) (-1197.191) [-1191.507] (-1190.796) * (-1190.173) (-1194.057) [-1191.053] (-1198.986) -- 0:00:33
462000 -- [-1190.577] (-1197.701) (-1193.082) (-1199.140) * [-1193.622] (-1190.049) (-1193.407) (-1193.268) -- 0:00:33
462500 -- [-1191.563] (-1194.705) (-1197.681) (-1194.602) * (-1196.644) (-1190.285) (-1190.514) [-1189.615] -- 0:00:33
463000 -- (-1190.110) (-1192.797) [-1191.717] (-1195.053) * [-1191.349] (-1191.197) (-1190.616) (-1194.521) -- 0:00:33
463500 -- [-1189.616] (-1190.975) (-1195.445) (-1194.429) * (-1194.027) (-1189.930) (-1190.930) [-1189.702] -- 0:00:33
464000 -- [-1192.620] (-1190.958) (-1194.561) (-1193.356) * (-1189.723) (-1190.531) [-1190.362] (-1189.695) -- 0:00:33
464500 -- (-1192.916) (-1191.146) [-1196.968] (-1200.196) * (-1189.227) (-1190.690) [-1190.951] (-1189.675) -- 0:00:33
465000 -- [-1191.406] (-1190.222) (-1191.566) (-1189.767) * (-1191.342) [-1190.930] (-1190.032) (-1191.089) -- 0:00:33
Average standard deviation of split frequencies: 0.007014
465500 -- [-1194.600] (-1190.566) (-1192.233) (-1190.139) * (-1190.051) (-1193.604) [-1189.536] (-1191.889) -- 0:00:33
466000 -- [-1190.659] (-1190.276) (-1192.236) (-1190.745) * (-1190.263) (-1191.436) [-1189.740] (-1193.807) -- 0:00:33
466500 -- (-1191.887) (-1191.536) (-1198.168) [-1189.489] * (-1189.398) [-1191.635] (-1192.944) (-1191.554) -- 0:00:33
467000 -- (-1192.307) (-1192.435) [-1193.630] (-1190.622) * (-1191.786) (-1189.985) [-1190.557] (-1190.362) -- 0:00:33
467500 -- (-1192.250) [-1190.593] (-1190.031) (-1190.133) * (-1192.007) [-1190.364] (-1191.650) (-1190.721) -- 0:00:33
468000 -- (-1194.228) [-1192.431] (-1190.130) (-1191.096) * [-1191.130] (-1195.185) (-1192.264) (-1191.655) -- 0:00:32
468500 -- (-1193.821) (-1193.209) (-1191.363) [-1194.637] * (-1191.245) [-1192.280] (-1193.438) (-1192.162) -- 0:00:32
469000 -- (-1190.608) (-1192.367) (-1192.521) [-1193.335] * (-1193.219) (-1190.332) [-1193.839] (-1191.526) -- 0:00:32
469500 -- (-1189.800) (-1189.948) (-1193.152) [-1192.024] * (-1191.108) (-1189.584) (-1198.096) [-1191.000] -- 0:00:32
470000 -- [-1190.790] (-1191.301) (-1191.752) (-1192.789) * (-1192.555) [-1191.198] (-1194.650) (-1189.854) -- 0:00:32
Average standard deviation of split frequencies: 0.007078
470500 -- [-1192.810] (-1190.506) (-1189.934) (-1190.421) * (-1191.633) [-1191.102] (-1190.446) (-1189.956) -- 0:00:32
471000 -- (-1192.684) [-1193.493] (-1191.537) (-1192.339) * (-1191.328) (-1191.532) [-1190.566] (-1192.965) -- 0:00:32
471500 -- (-1190.539) (-1191.304) [-1191.640] (-1190.403) * [-1190.658] (-1194.706) (-1190.962) (-1199.513) -- 0:00:32
472000 -- (-1190.542) (-1196.269) (-1191.469) [-1195.164] * (-1192.256) [-1192.030] (-1189.419) (-1191.156) -- 0:00:32
472500 -- (-1190.538) [-1189.340] (-1190.996) (-1194.325) * (-1192.661) [-1192.196] (-1190.514) (-1191.977) -- 0:00:32
473000 -- (-1190.378) [-1189.312] (-1190.482) (-1191.725) * [-1195.692] (-1191.037) (-1190.014) (-1192.119) -- 0:00:32
473500 -- [-1193.290] (-1189.722) (-1190.339) (-1190.793) * (-1192.937) (-1196.372) [-1190.047] (-1190.491) -- 0:00:32
474000 -- (-1190.924) (-1190.561) [-1191.041] (-1190.479) * [-1191.222] (-1192.059) (-1191.331) (-1190.063) -- 0:00:32
474500 -- (-1192.367) (-1190.642) (-1192.915) [-1190.335] * (-1199.925) (-1192.497) (-1192.034) [-1189.128] -- 0:00:32
475000 -- (-1190.968) (-1191.282) [-1190.655] (-1190.337) * (-1195.432) [-1191.934] (-1191.734) (-1189.482) -- 0:00:32
Average standard deviation of split frequencies: 0.007461
475500 -- (-1194.318) (-1191.878) [-1189.091] (-1190.262) * (-1195.432) [-1194.524] (-1189.150) (-1190.666) -- 0:00:33
476000 -- (-1194.956) (-1190.208) [-1190.946] (-1189.632) * (-1197.722) (-1190.910) (-1189.150) [-1190.444] -- 0:00:33
476500 -- [-1193.077] (-1192.962) (-1191.563) (-1191.497) * (-1194.159) (-1195.295) [-1192.218] (-1191.428) -- 0:00:32
477000 -- (-1192.959) (-1192.065) [-1192.349] (-1190.663) * (-1190.787) [-1194.123] (-1190.262) (-1190.044) -- 0:00:32
477500 -- (-1189.608) (-1190.057) (-1189.966) [-1190.383] * (-1190.186) (-1190.055) [-1191.029] (-1190.013) -- 0:00:32
478000 -- (-1190.185) (-1190.254) (-1191.008) [-1191.677] * [-1189.974] (-1192.684) (-1190.147) (-1189.809) -- 0:00:32
478500 -- (-1190.597) (-1200.364) (-1189.065) [-1192.184] * (-1194.782) [-1189.624] (-1192.431) (-1192.127) -- 0:00:32
479000 -- (-1190.577) (-1196.088) [-1190.146] (-1190.652) * (-1191.059) (-1200.338) [-1190.038] (-1192.661) -- 0:00:32
479500 -- (-1193.012) (-1193.510) [-1192.438] (-1191.339) * (-1190.313) (-1191.145) (-1189.468) [-1193.603] -- 0:00:32
480000 -- (-1191.456) [-1191.617] (-1191.594) (-1191.692) * (-1190.227) [-1192.755] (-1193.421) (-1197.432) -- 0:00:32
Average standard deviation of split frequencies: 0.008238
480500 -- (-1191.090) (-1190.431) (-1192.798) [-1190.395] * [-1191.692] (-1190.878) (-1190.552) (-1192.785) -- 0:00:32
481000 -- (-1194.128) (-1190.048) [-1190.615] (-1190.654) * [-1190.426] (-1190.069) (-1192.354) (-1193.314) -- 0:00:32
481500 -- (-1193.405) [-1190.309] (-1191.765) (-1190.763) * (-1190.882) (-1192.041) (-1193.281) [-1193.345] -- 0:00:32
482000 -- (-1196.827) [-1190.753] (-1191.432) (-1194.999) * (-1191.463) [-1193.625] (-1190.853) (-1191.158) -- 0:00:32
482500 -- (-1199.531) (-1193.315) (-1191.936) [-1191.885] * (-1190.763) (-1196.381) [-1190.676] (-1190.318) -- 0:00:32
483000 -- (-1190.153) (-1191.102) (-1190.229) [-1191.276] * (-1191.650) [-1193.926] (-1190.573) (-1190.971) -- 0:00:32
483500 -- (-1189.530) [-1195.189] (-1190.485) (-1191.492) * [-1191.802] (-1194.660) (-1192.757) (-1190.942) -- 0:00:32
484000 -- (-1190.355) [-1191.750] (-1190.317) (-1190.467) * [-1192.762] (-1190.435) (-1190.000) (-1190.543) -- 0:00:31
484500 -- (-1189.799) [-1189.256] (-1192.689) (-1190.275) * (-1189.124) (-1191.683) [-1189.334] (-1191.378) -- 0:00:31
485000 -- (-1189.283) [-1190.380] (-1194.540) (-1192.138) * [-1192.145] (-1189.550) (-1190.631) (-1190.875) -- 0:00:31
Average standard deviation of split frequencies: 0.008730
485500 -- (-1191.614) [-1194.929] (-1196.420) (-1192.862) * (-1189.894) [-1192.031] (-1191.446) (-1190.480) -- 0:00:31
486000 -- (-1191.596) (-1193.984) [-1191.888] (-1190.653) * (-1191.638) (-1192.608) (-1189.199) [-1190.645] -- 0:00:31
486500 -- [-1191.013] (-1191.114) (-1189.699) (-1192.440) * (-1191.738) [-1190.277] (-1190.170) (-1189.593) -- 0:00:31
487000 -- (-1190.767) (-1197.643) [-1191.470] (-1194.772) * (-1191.065) (-1191.524) [-1192.391] (-1191.223) -- 0:00:31
487500 -- [-1193.462] (-1189.191) (-1190.167) (-1195.561) * (-1191.690) (-1190.280) (-1193.335) [-1195.899] -- 0:00:31
488000 -- [-1193.375] (-1190.534) (-1190.645) (-1194.426) * [-1191.124] (-1190.084) (-1193.721) (-1196.717) -- 0:00:31
488500 -- [-1191.845] (-1192.250) (-1189.757) (-1193.761) * [-1196.111] (-1193.251) (-1190.325) (-1192.293) -- 0:00:31
489000 -- (-1190.219) (-1194.467) (-1189.843) [-1192.373] * [-1190.955] (-1190.652) (-1192.354) (-1193.401) -- 0:00:31
489500 -- (-1191.901) (-1193.088) [-1190.003] (-1193.585) * (-1189.597) (-1189.650) (-1190.094) [-1190.497] -- 0:00:31
490000 -- [-1189.948] (-1191.265) (-1190.809) (-1189.654) * (-1190.168) (-1192.468) [-1189.741] (-1193.101) -- 0:00:31
Average standard deviation of split frequencies: 0.008583
490500 -- (-1191.017) (-1194.019) (-1195.895) [-1190.927] * [-1189.887] (-1195.449) (-1190.625) (-1195.785) -- 0:00:31
491000 -- (-1191.264) (-1190.345) (-1194.539) [-1190.163] * (-1190.172) (-1191.035) (-1189.757) [-1194.889] -- 0:00:31
491500 -- [-1191.396] (-1194.622) (-1191.801) (-1190.716) * [-1191.643] (-1194.367) (-1190.430) (-1193.418) -- 0:00:31
492000 -- (-1192.540) [-1192.763] (-1190.877) (-1195.692) * [-1190.945] (-1192.683) (-1190.724) (-1194.088) -- 0:00:32
492500 -- (-1190.332) (-1191.512) [-1190.337] (-1191.956) * [-1189.611] (-1193.418) (-1190.574) (-1189.653) -- 0:00:31
493000 -- (-1189.980) (-1193.026) (-1189.897) [-1191.947] * [-1190.335] (-1190.734) (-1190.637) (-1191.248) -- 0:00:31
493500 -- (-1189.947) [-1191.677] (-1193.172) (-1190.381) * (-1191.276) [-1189.509] (-1189.680) (-1194.804) -- 0:00:31
494000 -- (-1190.004) (-1193.270) (-1192.876) [-1190.597] * [-1191.426] (-1189.609) (-1190.336) (-1190.521) -- 0:00:31
494500 -- [-1190.400] (-1192.360) (-1193.025) (-1192.087) * (-1190.992) (-1190.470) [-1190.493] (-1193.729) -- 0:00:31
495000 -- (-1191.700) (-1191.246) (-1191.251) [-1192.549] * (-1191.442) [-1190.074] (-1192.991) (-1195.103) -- 0:00:31
Average standard deviation of split frequencies: 0.007667
495500 -- (-1189.986) (-1190.185) [-1189.731] (-1191.698) * [-1194.507] (-1189.736) (-1191.199) (-1192.046) -- 0:00:31
496000 -- (-1190.487) [-1192.552] (-1189.493) (-1192.148) * [-1190.366] (-1192.169) (-1194.959) (-1189.913) -- 0:00:31
496500 -- (-1192.836) (-1192.729) (-1189.919) [-1191.499] * (-1190.550) (-1190.395) [-1192.133] (-1190.334) -- 0:00:31
497000 -- (-1193.157) (-1193.683) (-1190.661) [-1194.966] * [-1189.062] (-1190.431) (-1189.197) (-1189.755) -- 0:00:31
497500 -- (-1190.770) (-1191.528) [-1191.764] (-1194.208) * [-1190.616] (-1190.194) (-1190.947) (-1191.598) -- 0:00:31
498000 -- (-1192.892) (-1193.598) (-1193.949) [-1190.130] * (-1192.348) (-1194.393) [-1192.339] (-1191.983) -- 0:00:31
498500 -- [-1194.895] (-1190.098) (-1192.358) (-1191.369) * (-1192.013) (-1192.400) [-1190.311] (-1191.626) -- 0:00:31
499000 -- [-1192.281] (-1190.663) (-1192.549) (-1197.160) * (-1197.852) (-1190.432) [-1190.312] (-1190.480) -- 0:00:31
499500 -- (-1191.411) (-1189.865) [-1193.820] (-1193.547) * (-1193.480) (-1192.171) [-1190.608] (-1197.281) -- 0:00:31
500000 -- [-1189.322] (-1190.557) (-1190.266) (-1190.269) * (-1190.675) (-1190.218) (-1191.684) [-1192.422] -- 0:00:31
Average standard deviation of split frequencies: 0.007784
500500 -- [-1189.325] (-1190.933) (-1194.034) (-1190.340) * (-1193.243) (-1190.886) (-1190.125) [-1189.826] -- 0:00:30
501000 -- (-1189.357) (-1191.437) (-1191.903) [-1191.180] * (-1191.260) (-1194.866) [-1190.349] (-1190.406) -- 0:00:30
501500 -- [-1190.112] (-1191.794) (-1191.387) (-1194.154) * (-1192.175) [-1191.276] (-1189.714) (-1189.459) -- 0:00:30
502000 -- (-1189.539) [-1191.084] (-1194.834) (-1192.269) * (-1194.186) (-1190.129) (-1191.882) [-1189.603] -- 0:00:30
502500 -- (-1190.474) (-1189.661) (-1190.874) [-1189.799] * (-1194.125) (-1191.009) [-1191.803] (-1192.801) -- 0:00:30
503000 -- (-1192.537) (-1189.603) [-1193.654] (-1189.669) * (-1193.114) [-1189.856] (-1191.039) (-1193.176) -- 0:00:30
503500 -- (-1192.541) (-1191.127) (-1193.949) [-1190.828] * (-1192.089) (-1190.461) (-1192.649) [-1192.689] -- 0:00:30
504000 -- (-1194.147) [-1189.423] (-1192.350) (-1190.890) * (-1193.905) (-1190.944) [-1191.796] (-1196.118) -- 0:00:30
504500 -- (-1191.964) (-1192.526) [-1190.491] (-1190.323) * (-1190.173) [-1190.768] (-1189.947) (-1191.200) -- 0:00:30
505000 -- (-1192.766) (-1196.269) [-1191.261] (-1195.397) * (-1196.065) (-1189.791) [-1189.718] (-1192.333) -- 0:00:30
Average standard deviation of split frequencies: 0.008792
505500 -- (-1190.424) (-1193.386) (-1190.690) [-1190.146] * (-1197.615) [-1191.120] (-1194.248) (-1192.313) -- 0:00:30
506000 -- (-1192.244) [-1193.404] (-1192.060) (-1190.741) * [-1194.424] (-1192.949) (-1197.038) (-1192.235) -- 0:00:30
506500 -- [-1190.038] (-1189.541) (-1194.158) (-1190.080) * (-1189.462) [-1194.930] (-1197.713) (-1191.774) -- 0:00:30
507000 -- (-1191.560) [-1189.367] (-1193.689) (-1190.021) * [-1189.531] (-1190.633) (-1193.613) (-1189.677) -- 0:00:30
507500 -- (-1192.383) (-1191.072) [-1192.028] (-1192.249) * (-1189.171) (-1190.487) (-1191.167) [-1191.161] -- 0:00:31
508000 -- [-1195.498] (-1194.779) (-1195.463) (-1193.685) * (-1192.976) [-1189.840] (-1192.232) (-1191.464) -- 0:00:30
508500 -- (-1196.524) (-1193.216) [-1192.097] (-1190.992) * (-1190.205) [-1191.887] (-1193.970) (-1193.224) -- 0:00:30
509000 -- (-1193.144) [-1190.147] (-1194.939) (-1191.426) * (-1192.585) (-1194.167) [-1191.396] (-1193.580) -- 0:00:30
509500 -- (-1197.912) [-1190.529] (-1191.290) (-1191.274) * (-1191.015) (-1194.285) (-1193.332) [-1195.504] -- 0:00:30
510000 -- (-1190.007) (-1190.713) (-1190.853) [-1190.072] * (-1190.053) [-1201.181] (-1195.586) (-1192.563) -- 0:00:30
Average standard deviation of split frequencies: 0.008431
510500 -- (-1191.651) [-1191.905] (-1189.920) (-1192.613) * [-1191.903] (-1193.811) (-1191.113) (-1190.629) -- 0:00:30
511000 -- (-1190.030) (-1193.930) (-1189.595) [-1191.152] * (-1190.415) (-1196.093) [-1190.693] (-1193.614) -- 0:00:30
511500 -- (-1190.972) [-1190.164] (-1193.450) (-1190.986) * (-1191.380) (-1190.964) (-1191.203) [-1189.744] -- 0:00:30
512000 -- (-1195.844) (-1191.761) [-1189.889] (-1191.889) * (-1191.893) (-1192.246) (-1190.583) [-1191.829] -- 0:00:30
512500 -- (-1189.418) (-1191.546) [-1193.273] (-1189.909) * (-1196.717) (-1193.089) (-1190.423) [-1190.296] -- 0:00:30
513000 -- (-1191.539) (-1191.425) [-1190.008] (-1190.691) * (-1191.783) [-1197.762] (-1191.287) (-1189.971) -- 0:00:30
513500 -- (-1191.770) (-1191.367) (-1189.993) [-1191.528] * (-1192.715) [-1190.986] (-1191.234) (-1189.564) -- 0:00:30
514000 -- (-1190.183) (-1191.272) (-1190.175) [-1192.221] * (-1192.552) (-1190.110) [-1191.338] (-1191.911) -- 0:00:30
514500 -- (-1192.556) (-1194.088) [-1192.272] (-1189.772) * (-1189.518) (-1192.941) (-1190.523) [-1190.180] -- 0:00:30
515000 -- (-1193.381) (-1192.180) [-1190.542] (-1191.437) * (-1189.793) (-1193.161) [-1190.425] (-1191.093) -- 0:00:30
Average standard deviation of split frequencies: 0.008892
515500 -- (-1193.341) [-1194.188] (-1193.119) (-1193.719) * (-1194.030) (-1191.476) (-1190.902) [-1190.891] -- 0:00:30
516000 -- (-1193.132) [-1191.903] (-1193.432) (-1191.201) * (-1190.818) [-1190.043] (-1195.087) (-1191.580) -- 0:00:30
516500 -- [-1193.289] (-1190.030) (-1197.262) (-1190.322) * (-1190.734) (-1191.308) [-1193.338] (-1192.798) -- 0:00:29
517000 -- (-1193.529) [-1189.716] (-1191.792) (-1190.225) * (-1190.291) (-1194.588) (-1196.473) [-1192.767] -- 0:00:29
517500 -- (-1190.265) [-1191.372] (-1190.877) (-1190.822) * (-1191.472) (-1195.705) [-1194.400] (-1192.078) -- 0:00:29
518000 -- [-1191.434] (-1190.646) (-1190.300) (-1191.411) * (-1191.068) (-1192.042) (-1194.059) [-1190.083] -- 0:00:29
518500 -- (-1191.542) (-1191.593) (-1192.775) [-1191.224] * (-1192.621) [-1193.257] (-1193.500) (-1190.345) -- 0:00:29
519000 -- (-1195.293) [-1193.087] (-1190.548) (-1194.060) * (-1190.367) [-1194.322] (-1189.223) (-1195.152) -- 0:00:29
519500 -- (-1191.754) [-1189.552] (-1194.733) (-1192.800) * (-1192.319) (-1197.757) [-1191.307] (-1189.788) -- 0:00:29
520000 -- (-1193.762) [-1190.974] (-1199.955) (-1193.572) * (-1190.747) (-1191.249) (-1189.874) [-1190.183] -- 0:00:29
Average standard deviation of split frequencies: 0.008450
520500 -- (-1191.903) (-1190.084) [-1193.809] (-1189.480) * [-1190.145] (-1193.438) (-1189.162) (-1192.253) -- 0:00:29
521000 -- [-1191.778] (-1189.364) (-1193.559) (-1189.530) * (-1192.785) (-1193.063) [-1189.603] (-1190.240) -- 0:00:30
521500 -- (-1190.958) [-1189.245] (-1190.359) (-1189.445) * (-1195.951) (-1192.446) (-1194.306) [-1189.384] -- 0:00:30
522000 -- [-1191.340] (-1192.442) (-1190.134) (-1190.833) * (-1195.371) (-1192.493) (-1193.051) [-1193.064] -- 0:00:30
522500 -- [-1193.083] (-1190.334) (-1190.165) (-1189.631) * [-1191.287] (-1190.141) (-1191.407) (-1191.596) -- 0:00:30
523000 -- (-1189.660) (-1190.938) [-1192.777] (-1189.658) * (-1192.036) (-1192.714) [-1191.927] (-1193.094) -- 0:00:30
523500 -- [-1192.244] (-1190.074) (-1192.156) (-1190.762) * (-1190.541) [-1190.482] (-1191.080) (-1192.906) -- 0:00:30
524000 -- [-1193.949] (-1194.205) (-1190.058) (-1191.279) * [-1193.367] (-1189.515) (-1190.229) (-1191.296) -- 0:00:29
524500 -- [-1190.777] (-1189.801) (-1192.061) (-1189.474) * [-1191.991] (-1189.676) (-1189.010) (-1193.263) -- 0:00:29
525000 -- (-1191.179) (-1189.854) (-1193.619) [-1189.501] * (-1197.630) (-1194.128) (-1189.214) [-1191.046] -- 0:00:29
Average standard deviation of split frequencies: 0.008783
525500 -- (-1189.616) (-1189.843) (-1191.212) [-1194.763] * (-1192.232) (-1193.958) [-1193.737] (-1193.260) -- 0:00:29
526000 -- (-1194.766) (-1190.440) (-1192.524) [-1196.844] * (-1190.552) (-1191.139) [-1194.260] (-1196.051) -- 0:00:29
526500 -- (-1193.510) [-1194.064] (-1190.949) (-1189.598) * [-1191.611] (-1190.807) (-1192.436) (-1194.928) -- 0:00:29
527000 -- (-1189.889) (-1191.865) [-1190.070] (-1189.605) * (-1190.593) [-1190.706] (-1191.895) (-1192.341) -- 0:00:29
527500 -- (-1190.090) (-1190.653) [-1190.259] (-1190.975) * [-1190.947] (-1191.510) (-1191.895) (-1193.311) -- 0:00:29
528000 -- [-1191.018] (-1190.207) (-1190.824) (-1193.549) * (-1192.231) (-1192.052) (-1191.028) [-1191.195] -- 0:00:29
528500 -- (-1193.640) (-1194.548) [-1190.792] (-1192.931) * [-1194.687] (-1190.934) (-1195.373) (-1189.727) -- 0:00:29
529000 -- (-1192.211) [-1192.377] (-1190.751) (-1191.752) * (-1191.594) (-1192.611) [-1192.383] (-1192.806) -- 0:00:29
529500 -- (-1192.091) (-1192.008) [-1190.184] (-1193.709) * (-1192.217) [-1191.986] (-1190.390) (-1192.401) -- 0:00:29
530000 -- (-1194.834) (-1193.347) (-1191.010) [-1191.486] * (-1190.141) [-1197.690] (-1189.759) (-1189.982) -- 0:00:29
Average standard deviation of split frequencies: 0.008528
530500 -- (-1191.254) (-1190.877) (-1190.823) [-1189.642] * (-1193.586) (-1191.711) (-1189.290) [-1191.187] -- 0:00:29
531000 -- (-1193.648) (-1190.609) [-1190.262] (-1189.651) * (-1193.902) (-1192.276) [-1189.117] (-1190.186) -- 0:00:29
531500 -- (-1193.001) (-1197.082) [-1190.119] (-1190.425) * [-1195.407] (-1190.497) (-1192.252) (-1195.572) -- 0:00:29
532000 -- (-1197.410) [-1193.269] (-1191.812) (-1191.257) * (-1190.148) (-1189.896) (-1190.649) [-1192.114] -- 0:00:29
532500 -- (-1192.046) [-1194.227] (-1190.490) (-1190.820) * (-1193.400) (-1193.052) (-1191.230) [-1192.532] -- 0:00:28
533000 -- [-1194.312] (-1197.268) (-1189.926) (-1190.858) * (-1190.294) [-1190.635] (-1191.876) (-1190.990) -- 0:00:28
533500 -- (-1190.928) (-1189.134) [-1192.058] (-1192.188) * (-1194.393) (-1193.983) (-1191.627) [-1191.238] -- 0:00:28
534000 -- [-1190.645] (-1190.029) (-1192.120) (-1191.344) * (-1192.189) [-1192.045] (-1194.352) (-1190.620) -- 0:00:28
534500 -- [-1193.063] (-1191.471) (-1190.368) (-1192.824) * (-1194.034) (-1192.518) [-1192.290] (-1190.508) -- 0:00:28
535000 -- (-1189.460) (-1194.925) [-1194.614] (-1191.876) * (-1189.501) [-1191.255] (-1191.690) (-1189.356) -- 0:00:28
Average standard deviation of split frequencies: 0.007974
535500 -- (-1192.023) (-1191.096) [-1191.845] (-1192.675) * [-1191.131] (-1192.680) (-1196.340) (-1189.927) -- 0:00:28
536000 -- (-1193.597) (-1190.303) [-1192.054] (-1189.501) * (-1191.858) (-1190.129) [-1193.225] (-1190.394) -- 0:00:28
536500 -- (-1192.938) (-1190.900) (-1191.061) [-1191.031] * (-1189.976) (-1190.482) [-1190.504] (-1192.517) -- 0:00:29
537000 -- [-1190.724] (-1191.345) (-1190.658) (-1189.578) * (-1189.970) [-1189.854] (-1191.030) (-1191.453) -- 0:00:29
537500 -- (-1194.574) (-1194.331) (-1192.590) [-1191.229] * (-1192.072) (-1190.843) (-1191.011) [-1190.814] -- 0:00:29
538000 -- (-1192.308) (-1192.074) (-1189.134) [-1190.333] * (-1189.980) (-1193.218) [-1190.851] (-1189.759) -- 0:00:29
538500 -- (-1197.582) (-1191.699) [-1190.419] (-1190.294) * (-1191.099) (-1191.226) [-1190.103] (-1189.520) -- 0:00:29
539000 -- [-1196.323] (-1190.393) (-1193.469) (-1192.630) * (-1191.213) (-1194.836) (-1190.498) [-1194.384] -- 0:00:29
539500 -- (-1191.795) (-1192.501) [-1193.279] (-1193.763) * [-1191.108] (-1199.166) (-1191.461) (-1190.147) -- 0:00:29
540000 -- [-1189.519] (-1190.790) (-1192.786) (-1191.892) * (-1190.507) (-1199.283) [-1192.642] (-1191.934) -- 0:00:28
Average standard deviation of split frequencies: 0.008080
540500 -- (-1190.595) [-1190.184] (-1190.258) (-1190.458) * [-1191.032] (-1191.148) (-1192.196) (-1191.438) -- 0:00:28
541000 -- (-1189.687) (-1190.328) [-1190.525] (-1190.329) * (-1192.766) (-1192.059) (-1195.565) [-1190.951] -- 0:00:28
541500 -- (-1189.530) [-1189.410] (-1194.114) (-1191.714) * (-1192.880) [-1196.770] (-1191.958) (-1191.199) -- 0:00:28
542000 -- (-1193.834) (-1190.039) [-1192.893] (-1190.694) * (-1198.553) (-1193.589) [-1195.981] (-1190.800) -- 0:00:28
542500 -- (-1191.101) (-1190.449) (-1189.967) [-1190.098] * (-1188.998) [-1191.654] (-1192.265) (-1192.877) -- 0:00:28
543000 -- (-1194.572) [-1191.882] (-1189.995) (-1190.207) * (-1191.030) (-1189.335) (-1189.251) [-1193.200] -- 0:00:28
543500 -- (-1192.652) [-1194.578] (-1191.559) (-1190.643) * (-1190.709) (-1191.006) (-1192.007) [-1192.295] -- 0:00:28
544000 -- (-1198.296) [-1194.050] (-1194.055) (-1191.264) * (-1194.661) (-1191.164) [-1193.093] (-1196.449) -- 0:00:28
544500 -- (-1192.972) (-1192.449) (-1189.986) [-1191.058] * (-1190.858) (-1192.425) (-1196.643) [-1191.303] -- 0:00:28
545000 -- [-1191.119] (-1191.761) (-1189.858) (-1195.027) * [-1190.318] (-1189.853) (-1193.189) (-1190.202) -- 0:00:28
Average standard deviation of split frequencies: 0.007713
545500 -- (-1192.729) (-1193.142) [-1192.128] (-1191.752) * (-1190.771) (-1192.433) (-1191.107) [-1190.515] -- 0:00:28
546000 -- [-1191.251] (-1193.900) (-1191.301) (-1192.880) * [-1192.459] (-1190.119) (-1191.875) (-1191.487) -- 0:00:28
546500 -- [-1191.687] (-1191.577) (-1192.843) (-1191.106) * [-1192.608] (-1190.844) (-1194.072) (-1191.766) -- 0:00:28
547000 -- (-1193.344) (-1191.390) (-1192.856) [-1192.012] * (-1190.286) (-1190.846) (-1191.049) [-1192.142] -- 0:00:28
547500 -- [-1191.477] (-1193.285) (-1190.404) (-1189.944) * (-1189.732) [-1192.447] (-1190.137) (-1190.435) -- 0:00:28
548000 -- (-1192.253) (-1192.926) (-1190.103) [-1190.902] * (-1191.552) [-1191.373] (-1191.016) (-1193.622) -- 0:00:28
548500 -- (-1191.824) (-1191.057) (-1190.888) [-1193.751] * (-1191.910) [-1194.066] (-1192.089) (-1195.587) -- 0:00:27
549000 -- (-1190.074) (-1191.706) [-1191.375] (-1189.989) * (-1191.342) (-1198.913) [-1189.699] (-1192.602) -- 0:00:27
549500 -- [-1193.099] (-1191.695) (-1189.507) (-1192.408) * (-1189.390) (-1193.927) [-1190.006] (-1190.632) -- 0:00:27
550000 -- (-1193.716) [-1192.129] (-1190.050) (-1191.940) * (-1189.280) (-1191.054) [-1190.044] (-1191.724) -- 0:00:27
Average standard deviation of split frequencies: 0.007705
550500 -- (-1194.188) [-1189.306] (-1193.925) (-1190.911) * (-1191.461) (-1190.280) [-1190.011] (-1193.751) -- 0:00:27
551000 -- (-1194.918) (-1190.177) [-1190.629] (-1191.708) * (-1191.049) (-1196.454) [-1193.617] (-1193.197) -- 0:00:27
551500 -- (-1190.285) (-1190.177) [-1193.427] (-1189.936) * (-1192.176) (-1191.167) [-1192.023] (-1195.571) -- 0:00:27
552000 -- (-1189.089) [-1191.464] (-1190.443) (-1190.527) * (-1196.441) (-1191.312) [-1190.385] (-1195.445) -- 0:00:27
552500 -- (-1189.669) (-1192.017) (-1192.811) [-1190.323] * [-1194.851] (-1194.029) (-1192.398) (-1194.015) -- 0:00:28
553000 -- (-1191.598) (-1192.019) (-1192.828) [-1190.056] * (-1192.368) [-1193.209] (-1190.881) (-1193.993) -- 0:00:28
553500 -- (-1193.484) (-1191.665) [-1193.085] (-1189.609) * (-1191.752) [-1190.201] (-1191.791) (-1190.220) -- 0:00:28
554000 -- [-1192.997] (-1190.913) (-1194.812) (-1192.672) * [-1190.909] (-1189.669) (-1190.880) (-1190.352) -- 0:00:28
554500 -- [-1192.789] (-1191.714) (-1195.620) (-1191.399) * [-1189.952] (-1191.852) (-1190.846) (-1189.294) -- 0:00:28
555000 -- (-1192.594) (-1190.457) [-1195.765] (-1191.759) * [-1192.445] (-1193.445) (-1190.169) (-1189.917) -- 0:00:28
Average standard deviation of split frequencies: 0.007800
555500 -- (-1191.132) [-1189.491] (-1190.531) (-1196.489) * (-1194.116) (-1190.716) (-1192.018) [-1190.492] -- 0:00:28
556000 -- (-1190.131) [-1190.407] (-1191.540) (-1191.667) * (-1193.744) (-1192.618) (-1192.018) [-1191.709] -- 0:00:27
556500 -- (-1191.519) [-1189.607] (-1192.014) (-1194.046) * [-1195.695] (-1195.443) (-1190.689) (-1191.696) -- 0:00:27
557000 -- (-1194.340) (-1191.526) [-1192.033] (-1197.944) * (-1197.312) (-1189.695) [-1191.233] (-1195.356) -- 0:00:27
557500 -- [-1194.093] (-1194.510) (-1192.136) (-1193.447) * (-1191.390) (-1189.697) (-1192.412) [-1194.752] -- 0:00:27
558000 -- (-1200.976) (-1189.375) (-1193.404) [-1192.828] * (-1191.863) (-1196.816) (-1193.179) [-1191.927] -- 0:00:27
558500 -- (-1191.281) (-1191.188) [-1192.843] (-1196.609) * (-1191.849) (-1197.271) [-1190.953] (-1192.882) -- 0:00:27
559000 -- (-1193.872) (-1190.330) (-1191.099) [-1192.855] * (-1190.203) (-1193.445) (-1192.735) [-1191.594] -- 0:00:27
559500 -- (-1191.565) [-1190.301] (-1191.037) (-1193.725) * [-1191.901] (-1192.578) (-1196.100) (-1192.503) -- 0:00:27
560000 -- (-1194.793) (-1194.596) (-1190.142) [-1194.162] * [-1193.189] (-1191.926) (-1194.732) (-1192.981) -- 0:00:27
Average standard deviation of split frequencies: 0.007511
560500 -- (-1190.886) (-1192.972) [-1190.634] (-1197.399) * (-1193.587) (-1195.820) [-1192.045] (-1192.874) -- 0:00:27
561000 -- [-1190.393] (-1194.293) (-1189.793) (-1194.104) * [-1193.704] (-1190.793) (-1190.776) (-1193.313) -- 0:00:27
561500 -- (-1191.230) (-1196.547) (-1189.723) [-1190.832] * (-1191.267) [-1192.369] (-1190.816) (-1191.229) -- 0:00:27
562000 -- (-1193.904) [-1193.376] (-1190.909) (-1191.330) * [-1197.872] (-1191.624) (-1190.927) (-1197.251) -- 0:00:27
562500 -- (-1190.555) (-1196.470) [-1190.244] (-1191.889) * (-1195.837) (-1191.082) (-1189.858) [-1198.750] -- 0:00:27
563000 -- (-1194.924) (-1194.463) (-1191.382) [-1189.757] * (-1189.831) [-1191.105] (-1189.508) (-1195.235) -- 0:00:27
563500 -- (-1192.046) (-1189.573) [-1191.025] (-1189.496) * (-1190.958) [-1191.189] (-1191.009) (-1190.501) -- 0:00:27
564000 -- [-1197.830] (-1193.237) (-1189.953) (-1190.077) * (-1190.989) (-1191.600) [-1191.163] (-1191.948) -- 0:00:27
564500 -- (-1195.122) (-1192.583) (-1190.515) [-1193.180] * (-1189.570) [-1190.206] (-1190.964) (-1190.666) -- 0:00:27
565000 -- (-1195.667) (-1193.018) [-1189.404] (-1193.087) * (-1192.945) [-1191.350] (-1189.864) (-1194.331) -- 0:00:26
Average standard deviation of split frequencies: 0.007773
565500 -- [-1189.494] (-1191.415) (-1189.424) (-1196.060) * (-1195.413) (-1191.778) (-1189.697) [-1194.927] -- 0:00:26
566000 -- (-1191.044) [-1189.748] (-1195.401) (-1191.068) * (-1192.456) [-1189.659] (-1189.697) (-1195.949) -- 0:00:26
566500 -- (-1191.452) (-1191.524) (-1189.900) [-1190.160] * [-1194.415] (-1190.360) (-1193.883) (-1195.256) -- 0:00:26
567000 -- (-1191.304) [-1190.830] (-1191.308) (-1191.011) * (-1190.284) [-1193.536] (-1191.909) (-1197.275) -- 0:00:26
567500 -- (-1193.879) (-1192.312) (-1192.921) [-1189.980] * [-1195.290] (-1194.098) (-1189.926) (-1192.376) -- 0:00:26
568000 -- (-1194.049) (-1192.065) (-1190.042) [-1192.987] * [-1189.627] (-1196.287) (-1190.878) (-1192.600) -- 0:00:26
568500 -- (-1196.265) (-1191.602) [-1194.808] (-1193.456) * (-1190.266) [-1193.661] (-1190.893) (-1193.022) -- 0:00:27
569000 -- (-1191.135) (-1191.600) (-1189.761) [-1191.442] * [-1189.948] (-1195.362) (-1189.552) (-1193.447) -- 0:00:27
569500 -- (-1195.473) (-1191.209) [-1195.532] (-1190.480) * [-1194.749] (-1190.504) (-1189.363) (-1192.367) -- 0:00:27
570000 -- (-1192.798) (-1191.276) (-1194.399) [-1190.267] * (-1191.099) (-1190.430) (-1189.370) [-1190.010] -- 0:00:27
Average standard deviation of split frequencies: 0.007435
570500 -- [-1194.213] (-1190.655) (-1192.901) (-1190.176) * (-1192.307) (-1190.049) [-1189.386] (-1189.941) -- 0:00:27
571000 -- (-1194.253) [-1190.876] (-1192.426) (-1190.123) * (-1190.289) (-1192.662) (-1190.656) [-1192.517] -- 0:00:27
571500 -- (-1193.783) (-1189.800) (-1191.141) [-1193.634] * [-1191.462] (-1190.229) (-1190.059) (-1193.896) -- 0:00:26
572000 -- [-1192.508] (-1191.125) (-1190.600) (-1193.559) * (-1191.332) [-1189.626] (-1190.355) (-1193.125) -- 0:00:26
572500 -- (-1190.521) (-1191.678) (-1190.690) [-1193.108] * (-1193.142) [-1190.037] (-1194.105) (-1191.408) -- 0:00:26
573000 -- [-1192.769] (-1196.286) (-1191.551) (-1191.513) * [-1191.690] (-1190.881) (-1191.513) (-1192.041) -- 0:00:26
573500 -- (-1191.187) [-1194.870] (-1192.105) (-1190.532) * (-1190.779) (-1190.635) (-1191.672) [-1192.977] -- 0:00:26
574000 -- (-1192.869) (-1194.169) [-1192.665] (-1190.700) * [-1190.377] (-1191.208) (-1192.890) (-1192.718) -- 0:00:26
574500 -- [-1189.219] (-1193.003) (-1196.532) (-1190.057) * [-1190.852] (-1190.808) (-1197.263) (-1194.452) -- 0:00:26
575000 -- (-1190.643) (-1191.072) (-1194.889) [-1192.615] * [-1191.266] (-1191.289) (-1195.825) (-1197.834) -- 0:00:26
Average standard deviation of split frequencies: 0.007366
575500 -- (-1190.324) [-1190.728] (-1193.063) (-1192.467) * (-1194.238) (-1191.223) (-1192.183) [-1191.135] -- 0:00:26
576000 -- (-1193.036) (-1191.622) [-1190.431] (-1191.461) * (-1193.174) (-1191.477) [-1192.641] (-1191.097) -- 0:00:26
576500 -- (-1191.333) (-1193.089) (-1189.651) [-1190.292] * [-1192.685] (-1192.356) (-1191.780) (-1191.317) -- 0:00:26
577000 -- (-1191.833) (-1195.762) [-1190.213] (-1195.625) * (-1189.144) (-1191.939) (-1196.565) [-1190.319] -- 0:00:26
577500 -- (-1192.819) [-1191.544] (-1191.637) (-1189.372) * (-1191.060) (-1191.521) (-1191.456) [-1192.664] -- 0:00:26
578000 -- (-1191.666) (-1189.929) (-1193.254) [-1189.421] * (-1191.212) [-1191.091] (-1193.786) (-1189.829) -- 0:00:26
578500 -- (-1190.311) (-1193.564) (-1191.326) [-1190.569] * (-1192.328) [-1190.536] (-1193.471) (-1189.141) -- 0:00:26
579000 -- (-1189.983) (-1191.277) [-1190.364] (-1192.624) * (-1192.354) (-1189.986) [-1192.586] (-1191.406) -- 0:00:26
579500 -- (-1191.038) (-1191.082) (-1189.922) [-1192.444] * (-1193.758) (-1192.143) [-1190.786] (-1191.251) -- 0:00:26
580000 -- (-1190.061) [-1190.117] (-1190.443) (-1190.258) * (-1193.575) [-1191.373] (-1192.336) (-1190.499) -- 0:00:26
Average standard deviation of split frequencies: 0.008010
580500 -- (-1190.209) [-1191.185] (-1190.319) (-1189.850) * [-1193.462] (-1190.204) (-1192.116) (-1192.035) -- 0:00:26
581000 -- (-1190.679) [-1191.917] (-1190.123) (-1194.694) * (-1193.603) (-1190.021) [-1192.554] (-1189.486) -- 0:00:25
581500 -- (-1189.476) (-1191.366) (-1189.498) [-1192.070] * [-1195.163] (-1190.898) (-1195.096) (-1193.869) -- 0:00:25
582000 -- (-1194.907) [-1190.364] (-1189.825) (-1190.757) * (-1190.662) (-1193.384) (-1192.585) [-1193.290] -- 0:00:25
582500 -- (-1197.633) (-1190.539) (-1189.810) [-1192.684] * [-1192.546] (-1196.584) (-1190.893) (-1190.262) -- 0:00:25
583000 -- (-1190.555) (-1194.870) (-1190.575) [-1193.737] * (-1190.571) (-1190.365) (-1196.972) [-1189.450] -- 0:00:25
583500 -- [-1192.500] (-1189.892) (-1190.006) (-1190.416) * (-1190.725) [-1191.463] (-1191.186) (-1189.666) -- 0:00:25
584000 -- [-1194.243] (-1189.797) (-1189.671) (-1191.059) * (-1190.786) (-1191.279) (-1197.390) [-1191.837] -- 0:00:25
584500 -- [-1192.887] (-1189.047) (-1192.340) (-1190.996) * (-1192.708) [-1192.296] (-1194.129) (-1193.545) -- 0:00:26
585000 -- [-1192.500] (-1191.838) (-1192.729) (-1190.644) * (-1193.481) [-1190.260] (-1195.756) (-1197.990) -- 0:00:26
Average standard deviation of split frequencies: 0.007562
585500 -- [-1191.203] (-1191.388) (-1191.093) (-1191.326) * (-1191.024) (-1192.532) (-1191.951) [-1190.554] -- 0:00:26
586000 -- (-1190.669) (-1194.164) (-1192.395) [-1189.312] * [-1192.179] (-1192.510) (-1190.365) (-1194.636) -- 0:00:26
586500 -- (-1191.662) (-1189.912) [-1192.963] (-1191.118) * (-1190.664) [-1192.773] (-1190.622) (-1190.656) -- 0:00:26
587000 -- (-1189.578) [-1189.698] (-1191.267) (-1194.394) * [-1193.000] (-1192.471) (-1190.891) (-1193.529) -- 0:00:26
587500 -- [-1189.431] (-1191.867) (-1193.261) (-1196.555) * (-1190.401) (-1194.053) (-1189.885) [-1198.724] -- 0:00:25
588000 -- [-1189.724] (-1194.171) (-1192.919) (-1198.433) * (-1190.545) (-1193.501) [-1190.843] (-1191.692) -- 0:00:25
588500 -- [-1189.291] (-1192.844) (-1191.719) (-1192.882) * (-1191.000) (-1193.107) [-1195.459] (-1191.906) -- 0:00:25
589000 -- [-1189.804] (-1200.361) (-1192.838) (-1190.744) * (-1193.931) [-1191.227] (-1192.304) (-1192.177) -- 0:00:25
589500 -- (-1191.830) (-1190.641) (-1189.747) [-1189.369] * [-1195.954] (-1191.643) (-1191.890) (-1190.798) -- 0:00:25
590000 -- (-1189.909) [-1193.655] (-1193.369) (-1189.240) * (-1195.315) [-1190.692] (-1192.403) (-1190.741) -- 0:00:25
Average standard deviation of split frequencies: 0.007768
590500 -- (-1190.480) (-1193.251) (-1193.898) [-1191.193] * [-1189.789] (-1192.613) (-1190.513) (-1190.323) -- 0:00:25
591000 -- (-1190.058) (-1191.940) (-1193.819) [-1192.078] * (-1193.840) [-1191.217] (-1189.969) (-1189.614) -- 0:00:25
591500 -- [-1190.912] (-1193.270) (-1191.518) (-1192.610) * (-1195.293) (-1191.190) (-1190.859) [-1193.278] -- 0:00:25
592000 -- (-1190.603) (-1195.010) [-1189.252] (-1192.277) * (-1189.975) (-1191.298) [-1191.193] (-1193.791) -- 0:00:25
592500 -- (-1193.187) [-1190.808] (-1191.976) (-1189.730) * [-1190.351] (-1191.497) (-1194.469) (-1193.096) -- 0:00:25
593000 -- (-1191.285) (-1192.045) [-1191.411] (-1190.368) * (-1191.297) [-1190.975] (-1192.644) (-1193.375) -- 0:00:25
593500 -- (-1189.942) (-1193.749) (-1192.681) [-1192.147] * (-1194.116) [-1192.427] (-1194.805) (-1194.872) -- 0:00:25
594000 -- (-1191.606) (-1192.933) [-1192.076] (-1189.905) * (-1191.498) (-1191.116) [-1191.277] (-1197.362) -- 0:00:25
594500 -- (-1191.324) (-1194.529) (-1192.172) [-1190.771] * (-1191.950) [-1190.514] (-1190.288) (-1193.301) -- 0:00:25
595000 -- [-1196.552] (-1194.469) (-1192.368) (-1189.681) * (-1192.016) [-1194.066] (-1189.457) (-1190.601) -- 0:00:25
Average standard deviation of split frequencies: 0.008279
595500 -- [-1191.227] (-1189.606) (-1189.805) (-1190.195) * (-1193.715) [-1191.593] (-1195.284) (-1191.555) -- 0:00:25
596000 -- (-1191.755) (-1190.569) [-1189.945] (-1192.401) * (-1190.073) (-1193.649) [-1195.400] (-1191.394) -- 0:00:25
596500 -- [-1191.120] (-1192.957) (-1192.063) (-1192.247) * (-1189.885) (-1199.736) [-1192.332] (-1189.993) -- 0:00:25
597000 -- [-1191.347] (-1189.546) (-1191.744) (-1195.503) * (-1189.247) (-1190.628) [-1191.691] (-1190.011) -- 0:00:24
597500 -- [-1190.870] (-1190.093) (-1191.394) (-1196.019) * (-1189.555) (-1190.581) [-1190.925] (-1191.441) -- 0:00:24
598000 -- (-1193.674) (-1191.570) [-1190.436] (-1191.341) * [-1191.917] (-1189.973) (-1190.164) (-1191.303) -- 0:00:24
598500 -- (-1193.208) [-1189.422] (-1190.741) (-1193.094) * (-1195.479) (-1190.531) (-1193.331) [-1190.274] -- 0:00:24
599000 -- (-1190.895) (-1189.937) (-1192.617) [-1190.240] * (-1195.745) (-1192.736) [-1193.388] (-1192.838) -- 0:00:24
599500 -- (-1190.501) [-1191.929] (-1191.659) (-1190.374) * (-1194.680) (-1197.768) [-1192.626] (-1190.202) -- 0:00:24
600000 -- [-1190.031] (-1190.677) (-1194.776) (-1191.656) * (-1193.594) (-1194.528) (-1192.573) [-1191.109] -- 0:00:24
Average standard deviation of split frequencies: 0.007796
600500 -- (-1190.197) [-1189.162] (-1195.520) (-1191.828) * (-1190.096) (-1193.805) (-1191.341) [-1192.248] -- 0:00:25
601000 -- [-1190.125] (-1190.484) (-1195.095) (-1191.248) * (-1193.339) (-1194.160) [-1190.883] (-1194.478) -- 0:00:25
601500 -- (-1190.402) (-1190.159) (-1192.756) [-1189.886] * (-1191.358) (-1193.825) [-1189.654] (-1190.501) -- 0:00:25
602000 -- (-1190.402) (-1191.980) (-1194.260) [-1191.299] * (-1192.341) (-1190.846) [-1190.412] (-1190.846) -- 0:00:25
602500 -- (-1190.416) [-1191.877] (-1192.058) (-1194.382) * (-1189.781) (-1189.607) (-1190.512) [-1196.406] -- 0:00:25
603000 -- (-1190.744) [-1191.786] (-1192.782) (-1191.195) * (-1196.561) (-1192.590) (-1193.174) [-1192.636] -- 0:00:25
603500 -- (-1190.792) [-1189.863] (-1189.934) (-1192.916) * [-1189.569] (-1195.377) (-1198.363) (-1192.720) -- 0:00:24
604000 -- (-1191.241) (-1190.911) (-1193.860) [-1191.577] * (-1190.380) (-1191.677) (-1194.052) [-1192.671] -- 0:00:24
604500 -- (-1189.969) (-1192.530) (-1196.025) [-1190.218] * (-1191.744) (-1195.912) (-1196.469) [-1192.517] -- 0:00:24
605000 -- (-1192.499) (-1191.229) (-1195.294) [-1189.857] * [-1191.942] (-1194.121) (-1193.207) (-1192.091) -- 0:00:24
Average standard deviation of split frequencies: 0.008090
605500 -- [-1191.646] (-1197.193) (-1191.060) (-1190.472) * [-1191.312] (-1190.849) (-1194.754) (-1193.899) -- 0:00:24
606000 -- [-1191.557] (-1191.353) (-1191.038) (-1193.583) * (-1192.070) [-1191.699] (-1191.406) (-1191.985) -- 0:00:24
606500 -- (-1192.642) [-1192.734] (-1195.241) (-1193.092) * (-1193.018) (-1192.628) (-1194.685) [-1194.083] -- 0:00:24
607000 -- (-1191.371) [-1190.743] (-1193.533) (-1190.833) * (-1190.407) (-1189.356) (-1189.943) [-1192.986] -- 0:00:24
607500 -- (-1190.375) [-1195.556] (-1191.395) (-1190.833) * [-1191.340] (-1189.550) (-1190.197) (-1189.449) -- 0:00:24
608000 -- (-1189.629) (-1196.592) [-1192.500] (-1192.053) * (-1192.130) (-1190.113) (-1192.263) [-1190.630] -- 0:00:24
608500 -- [-1191.058] (-1191.376) (-1189.285) (-1191.856) * [-1190.189] (-1190.670) (-1190.138) (-1194.142) -- 0:00:24
609000 -- (-1193.304) (-1192.774) (-1191.877) [-1189.795] * (-1190.205) [-1196.318] (-1191.850) (-1190.426) -- 0:00:24
609500 -- (-1195.223) (-1190.312) [-1192.229] (-1191.924) * (-1195.706) (-1190.860) (-1191.759) [-1190.171] -- 0:00:24
610000 -- (-1195.248) (-1191.450) (-1190.797) [-1189.543] * (-1192.165) [-1190.903] (-1191.264) (-1190.687) -- 0:00:24
Average standard deviation of split frequencies: 0.008080
610500 -- (-1193.625) [-1195.737] (-1190.796) (-1190.219) * (-1191.131) (-1196.227) [-1190.502] (-1190.871) -- 0:00:24
611000 -- (-1189.448) [-1189.580] (-1189.684) (-1191.582) * (-1190.927) [-1190.362] (-1192.882) (-1192.378) -- 0:00:24
611500 -- (-1189.907) [-1190.587] (-1190.778) (-1190.025) * (-1191.875) [-1189.444] (-1199.233) (-1191.427) -- 0:00:24
612000 -- (-1193.676) (-1192.744) (-1189.905) [-1192.891] * [-1189.857] (-1193.091) (-1190.523) (-1192.164) -- 0:00:24
612500 -- [-1192.713] (-1189.592) (-1194.246) (-1195.220) * (-1189.304) (-1191.938) [-1191.750] (-1190.652) -- 0:00:24
613000 -- (-1192.949) [-1191.288] (-1191.622) (-1198.169) * (-1191.805) (-1189.147) [-1194.080] (-1190.666) -- 0:00:23
613500 -- (-1193.333) (-1195.039) (-1190.567) [-1198.056] * (-1194.268) [-1190.469] (-1192.256) (-1189.340) -- 0:00:23
614000 -- (-1189.607) [-1191.803] (-1191.180) (-1190.780) * (-1192.560) (-1189.463) [-1193.300] (-1189.551) -- 0:00:23
614500 -- (-1191.474) (-1192.931) [-1189.931] (-1190.720) * (-1193.615) [-1189.460] (-1190.325) (-1191.939) -- 0:00:23
615000 -- (-1191.380) [-1190.008] (-1192.311) (-1190.796) * (-1190.973) (-1189.694) [-1190.058] (-1190.990) -- 0:00:23
Average standard deviation of split frequencies: 0.008520
615500 -- [-1194.331] (-1189.595) (-1190.080) (-1191.992) * (-1190.772) [-1190.422] (-1190.794) (-1190.933) -- 0:00:23
616000 -- (-1198.342) [-1191.150] (-1190.068) (-1192.147) * [-1191.929] (-1193.583) (-1192.506) (-1193.522) -- 0:00:23
616500 -- [-1193.961] (-1190.343) (-1191.843) (-1192.260) * (-1193.316) [-1190.774] (-1192.423) (-1193.065) -- 0:00:24
617000 -- (-1191.596) (-1189.690) [-1190.990] (-1190.934) * [-1190.353] (-1191.046) (-1192.012) (-1193.151) -- 0:00:24
617500 -- (-1190.945) (-1190.324) [-1190.163] (-1191.943) * [-1190.051] (-1190.519) (-1191.372) (-1193.340) -- 0:00:24
618000 -- (-1190.039) [-1189.768] (-1195.559) (-1191.857) * (-1189.894) (-1191.254) [-1192.116] (-1191.904) -- 0:00:24
618500 -- [-1189.875] (-1191.527) (-1193.524) (-1190.481) * (-1192.830) [-1191.841] (-1190.833) (-1196.679) -- 0:00:24
619000 -- (-1190.654) [-1191.079] (-1192.109) (-1189.909) * (-1191.004) (-1190.368) [-1189.579] (-1189.265) -- 0:00:24
619500 -- (-1190.205) (-1190.509) [-1193.342] (-1189.332) * (-1191.282) (-1192.355) [-1189.505] (-1190.054) -- 0:00:23
620000 -- [-1189.647] (-1192.104) (-1196.350) (-1190.189) * [-1190.249] (-1190.600) (-1190.797) (-1190.836) -- 0:00:23
Average standard deviation of split frequencies: 0.008355
620500 -- (-1189.643) [-1192.609] (-1197.042) (-1191.336) * [-1190.670] (-1195.377) (-1191.197) (-1191.691) -- 0:00:23
621000 -- [-1189.690] (-1193.477) (-1195.491) (-1193.469) * (-1189.820) [-1193.160] (-1191.095) (-1192.412) -- 0:00:23
621500 -- (-1189.534) [-1192.351] (-1193.733) (-1191.758) * (-1193.783) [-1190.773] (-1189.995) (-1192.974) -- 0:00:23
622000 -- (-1191.635) (-1195.438) (-1189.769) [-1192.507] * [-1191.203] (-1190.394) (-1190.210) (-1194.544) -- 0:00:23
622500 -- (-1191.139) (-1190.915) [-1189.978] (-1190.661) * (-1193.446) (-1190.243) (-1189.545) [-1190.454] -- 0:00:23
623000 -- (-1191.665) (-1190.753) (-1189.773) [-1190.100] * (-1193.046) (-1189.506) (-1190.776) [-1190.637] -- 0:00:23
623500 -- (-1189.952) (-1192.210) [-1190.407] (-1191.052) * (-1191.586) (-1189.404) (-1189.994) [-1192.188] -- 0:00:23
624000 -- [-1190.578] (-1193.283) (-1189.901) (-1194.493) * (-1194.401) (-1192.482) [-1189.356] (-1191.263) -- 0:00:23
624500 -- (-1189.963) (-1194.272) [-1189.369] (-1189.708) * (-1191.969) (-1192.352) (-1191.764) [-1191.309] -- 0:00:23
625000 -- [-1191.868] (-1192.478) (-1189.368) (-1191.070) * (-1193.400) (-1191.021) [-1192.142] (-1192.156) -- 0:00:23
Average standard deviation of split frequencies: 0.008566
625500 -- (-1194.074) [-1194.608] (-1189.960) (-1191.838) * (-1192.630) (-1191.837) (-1195.106) [-1190.687] -- 0:00:23
626000 -- (-1192.557) [-1193.380] (-1190.993) (-1192.715) * (-1194.267) [-1192.300] (-1190.142) (-1189.248) -- 0:00:23
626500 -- (-1192.170) (-1189.161) [-1194.221] (-1195.477) * [-1192.506] (-1192.387) (-1190.258) (-1190.429) -- 0:00:23
627000 -- [-1191.078] (-1189.192) (-1192.886) (-1189.892) * (-1190.547) (-1191.780) [-1190.575] (-1190.356) -- 0:00:23
627500 -- (-1194.405) [-1193.730] (-1193.439) (-1194.787) * [-1189.155] (-1193.345) (-1191.318) (-1194.872) -- 0:00:23
628000 -- (-1193.295) (-1191.748) [-1193.818] (-1194.307) * [-1190.768] (-1190.932) (-1191.199) (-1191.977) -- 0:00:23
628500 -- (-1191.616) [-1189.566] (-1193.153) (-1194.542) * (-1190.909) (-1192.591) [-1190.490] (-1192.202) -- 0:00:23
629000 -- [-1189.352] (-1192.407) (-1192.956) (-1192.859) * [-1190.606] (-1194.297) (-1190.282) (-1193.483) -- 0:00:23
629500 -- (-1192.368) (-1190.303) [-1192.065] (-1192.452) * (-1192.840) (-1191.435) [-1190.545] (-1190.924) -- 0:00:22
630000 -- (-1192.991) (-1190.811) [-1193.306] (-1191.604) * (-1189.352) [-1189.737] (-1190.092) (-1191.002) -- 0:00:22
Average standard deviation of split frequencies: 0.008829
630500 -- (-1196.780) (-1190.312) [-1195.424] (-1193.389) * (-1190.000) (-1189.311) (-1191.513) [-1190.665] -- 0:00:22
631000 -- [-1197.134] (-1196.430) (-1197.551) (-1190.417) * [-1192.288] (-1192.878) (-1190.066) (-1190.678) -- 0:00:22
631500 -- (-1191.473) [-1193.157] (-1189.703) (-1194.253) * (-1195.566) [-1191.059] (-1192.110) (-1191.848) -- 0:00:22
632000 -- (-1193.231) [-1191.778] (-1189.301) (-1190.857) * [-1190.334] (-1193.248) (-1192.542) (-1190.970) -- 0:00:22
632500 -- [-1192.538] (-1190.078) (-1189.645) (-1193.115) * [-1193.710] (-1195.642) (-1190.861) (-1191.927) -- 0:00:23
633000 -- [-1193.304] (-1191.873) (-1189.408) (-1192.833) * (-1196.769) (-1191.321) [-1190.970] (-1193.467) -- 0:00:23
633500 -- (-1191.159) (-1190.838) (-1190.033) [-1194.832] * (-1191.384) (-1190.466) (-1193.551) [-1193.240] -- 0:00:23
634000 -- (-1190.145) [-1192.302] (-1192.365) (-1190.392) * (-1190.188) (-1195.161) (-1192.759) [-1189.160] -- 0:00:23
634500 -- (-1191.168) (-1191.909) [-1191.525] (-1189.683) * (-1191.841) (-1190.597) [-1191.661] (-1190.138) -- 0:00:23
635000 -- (-1199.046) (-1193.101) (-1190.866) [-1190.229] * (-1191.969) [-1189.439] (-1190.281) (-1190.242) -- 0:00:22
Average standard deviation of split frequencies: 0.008499
635500 -- (-1189.688) [-1191.180] (-1189.782) (-1190.518) * [-1194.525] (-1190.343) (-1189.843) (-1190.739) -- 0:00:22
636000 -- (-1194.727) [-1189.876] (-1190.399) (-1192.273) * [-1191.450] (-1190.714) (-1189.962) (-1191.331) -- 0:00:22
636500 -- [-1192.645] (-1191.219) (-1189.460) (-1192.766) * (-1189.559) [-1189.963] (-1191.474) (-1191.493) -- 0:00:22
637000 -- (-1196.960) (-1192.249) (-1189.488) [-1189.891] * (-1190.696) (-1193.451) [-1192.769] (-1192.872) -- 0:00:22
637500 -- (-1191.376) (-1190.616) (-1189.987) [-1194.308] * (-1196.071) (-1191.163) [-1192.604] (-1190.603) -- 0:00:22
638000 -- (-1190.867) [-1191.746] (-1191.775) (-1192.165) * (-1192.935) (-1192.042) [-1190.302] (-1193.594) -- 0:00:22
638500 -- (-1191.124) (-1190.910) (-1190.076) [-1190.163] * [-1191.599] (-1193.119) (-1189.846) (-1190.541) -- 0:00:22
639000 -- (-1190.112) (-1189.681) (-1189.703) [-1191.710] * (-1192.299) (-1193.601) (-1189.700) [-1190.684] -- 0:00:22
639500 -- [-1191.882] (-1190.227) (-1190.724) (-1190.053) * (-1201.150) (-1191.915) (-1191.846) [-1192.376] -- 0:00:22
640000 -- (-1196.617) (-1189.532) [-1191.075] (-1190.538) * (-1196.775) [-1191.652] (-1190.202) (-1192.173) -- 0:00:22
Average standard deviation of split frequencies: 0.008339
640500 -- (-1191.744) (-1190.970) [-1194.079] (-1189.939) * (-1193.479) (-1192.095) [-1189.748] (-1190.666) -- 0:00:22
641000 -- [-1191.584] (-1190.521) (-1193.868) (-1190.609) * (-1190.621) (-1190.298) (-1191.110) [-1190.734] -- 0:00:22
641500 -- (-1191.457) (-1192.597) [-1190.960] (-1192.597) * [-1190.012] (-1191.332) (-1191.172) (-1192.117) -- 0:00:22
642000 -- [-1191.811] (-1190.019) (-1193.571) (-1192.878) * (-1190.373) (-1190.944) (-1196.742) [-1190.103] -- 0:00:22
642500 -- (-1193.155) (-1189.660) [-1190.230] (-1189.767) * [-1191.218] (-1191.996) (-1192.691) (-1189.498) -- 0:00:22
643000 -- (-1193.664) (-1191.560) [-1191.965] (-1190.804) * (-1192.420) (-1193.709) (-1190.359) [-1192.410] -- 0:00:22
643500 -- (-1193.004) (-1191.715) (-1190.923) [-1191.288] * [-1191.898] (-1190.906) (-1190.148) (-1192.144) -- 0:00:22
644000 -- (-1194.197) (-1192.683) [-1190.352] (-1192.094) * [-1189.982] (-1191.641) (-1190.063) (-1190.600) -- 0:00:22
644500 -- (-1195.439) [-1191.554] (-1192.355) (-1191.046) * (-1190.162) (-1193.178) [-1189.684] (-1194.675) -- 0:00:22
645000 -- (-1194.134) (-1191.947) (-1190.123) [-1190.225] * [-1193.321] (-1190.498) (-1193.104) (-1195.811) -- 0:00:22
Average standard deviation of split frequencies: 0.008708
645500 -- (-1193.242) (-1196.518) (-1190.539) [-1193.720] * (-1190.221) (-1193.320) (-1191.367) [-1193.169] -- 0:00:21
646000 -- (-1193.105) (-1191.606) [-1192.261] (-1192.890) * [-1190.278] (-1193.426) (-1191.933) (-1190.485) -- 0:00:21
646500 -- (-1191.760) (-1192.197) [-1191.536] (-1191.200) * (-1191.186) (-1192.959) [-1193.541] (-1189.538) -- 0:00:21
647000 -- (-1192.435) (-1194.389) [-1195.122] (-1193.525) * (-1192.166) [-1190.615] (-1192.379) (-1191.264) -- 0:00:21
647500 -- (-1190.955) (-1193.258) [-1191.022] (-1192.143) * [-1191.164] (-1192.451) (-1195.442) (-1196.821) -- 0:00:21
648000 -- (-1190.964) (-1192.371) [-1193.793] (-1189.934) * [-1195.550] (-1190.038) (-1190.811) (-1193.341) -- 0:00:21
648500 -- (-1191.281) (-1193.112) (-1191.421) [-1189.728] * [-1189.554] (-1191.863) (-1190.428) (-1192.119) -- 0:00:21
649000 -- (-1191.236) (-1191.331) [-1190.946] (-1191.777) * [-1190.196] (-1191.524) (-1191.606) (-1192.324) -- 0:00:22
649500 -- (-1189.250) (-1192.201) [-1190.947] (-1189.641) * (-1190.865) [-1191.604] (-1190.619) (-1192.003) -- 0:00:22
650000 -- (-1189.643) [-1189.232] (-1191.432) (-1190.168) * (-1192.192) (-1193.238) [-1190.089] (-1192.325) -- 0:00:22
Average standard deviation of split frequencies: 0.008018
650500 -- (-1194.999) [-1189.571] (-1199.377) (-1191.549) * (-1195.126) (-1192.070) (-1190.795) [-1191.214] -- 0:00:22
651000 -- (-1193.095) (-1190.431) [-1189.910] (-1192.750) * (-1189.645) (-1192.222) [-1189.800] (-1191.549) -- 0:00:21
651500 -- [-1191.726] (-1191.827) (-1191.242) (-1192.242) * [-1191.638] (-1189.856) (-1189.290) (-1190.068) -- 0:00:21
652000 -- (-1189.468) (-1190.951) (-1190.075) [-1193.374] * (-1191.192) (-1192.450) (-1190.632) [-1189.277] -- 0:00:21
652500 -- (-1190.895) [-1190.712] (-1190.255) (-1196.750) * (-1189.801) (-1191.373) (-1192.368) [-1190.041] -- 0:00:21
653000 -- [-1189.204] (-1190.365) (-1189.399) (-1189.478) * (-1192.935) (-1192.252) [-1191.771] (-1192.564) -- 0:00:21
653500 -- (-1190.464) (-1191.190) [-1189.445] (-1195.844) * (-1190.292) (-1192.261) (-1192.662) [-1192.586] -- 0:00:21
654000 -- (-1190.483) (-1197.249) [-1189.863] (-1190.406) * [-1192.184] (-1191.725) (-1190.465) (-1191.111) -- 0:00:21
654500 -- (-1189.812) (-1193.407) (-1195.343) [-1190.349] * (-1194.040) [-1194.486] (-1189.493) (-1191.375) -- 0:00:21
655000 -- (-1193.282) [-1189.773] (-1196.993) (-1191.911) * [-1196.070] (-1191.692) (-1189.468) (-1190.707) -- 0:00:21
Average standard deviation of split frequencies: 0.008384
655500 -- (-1193.309) (-1194.195) (-1189.760) [-1191.972] * [-1191.868] (-1192.105) (-1189.793) (-1190.022) -- 0:00:21
656000 -- (-1192.546) (-1190.891) (-1189.720) [-1193.871] * [-1190.115] (-1191.836) (-1191.166) (-1191.265) -- 0:00:21
656500 -- (-1193.209) (-1192.595) (-1192.592) [-1195.286] * (-1189.599) (-1191.120) [-1191.945] (-1192.165) -- 0:00:21
657000 -- (-1192.578) (-1192.261) [-1191.472] (-1192.331) * [-1191.883] (-1192.383) (-1193.522) (-1191.378) -- 0:00:21
657500 -- (-1191.969) (-1190.824) (-1190.033) [-1195.179] * [-1189.663] (-1190.952) (-1195.503) (-1190.988) -- 0:00:21
658000 -- (-1194.139) [-1192.830] (-1191.723) (-1192.038) * (-1190.761) (-1190.189) [-1192.359] (-1191.710) -- 0:00:21
658500 -- (-1192.870) (-1194.264) [-1192.033] (-1191.247) * (-1192.330) (-1191.397) (-1190.541) [-1193.560] -- 0:00:21
659000 -- (-1191.307) (-1190.903) (-1193.850) [-1192.837] * (-1189.151) (-1193.555) [-1190.707] (-1193.585) -- 0:00:21
659500 -- [-1192.498] (-1192.392) (-1203.991) (-1194.287) * [-1189.667] (-1191.533) (-1189.099) (-1194.818) -- 0:00:21
660000 -- (-1190.965) [-1191.359] (-1191.141) (-1195.793) * (-1191.407) [-1191.327] (-1193.684) (-1192.727) -- 0:00:21
Average standard deviation of split frequencies: 0.008990
660500 -- (-1191.139) (-1192.187) (-1190.608) [-1192.269] * (-1189.597) [-1196.539] (-1194.168) (-1190.962) -- 0:00:21
661000 -- (-1190.297) [-1190.148] (-1194.665) (-1191.648) * (-1193.531) [-1193.381] (-1192.588) (-1191.126) -- 0:00:21
661500 -- (-1190.008) (-1189.639) (-1190.770) [-1190.020] * (-1196.521) (-1189.676) (-1192.307) [-1190.795] -- 0:00:20
662000 -- (-1192.691) (-1189.745) (-1191.765) [-1190.090] * (-1196.234) (-1190.718) [-1189.773] (-1195.072) -- 0:00:20
662500 -- (-1190.530) (-1192.940) (-1191.450) [-1190.274] * [-1191.380] (-1190.044) (-1197.797) (-1192.097) -- 0:00:20
663000 -- (-1193.353) (-1195.820) (-1191.629) [-1192.698] * (-1193.023) (-1191.407) (-1191.267) [-1192.932] -- 0:00:20
663500 -- (-1191.692) (-1193.809) [-1193.819] (-1192.828) * (-1190.406) (-1191.192) [-1191.067] (-1193.304) -- 0:00:20
664000 -- [-1191.695] (-1189.207) (-1193.206) (-1193.531) * (-1191.721) (-1189.694) (-1190.536) [-1191.309] -- 0:00:20
664500 -- (-1193.648) [-1193.587] (-1194.793) (-1192.140) * (-1192.222) [-1192.007] (-1191.674) (-1191.362) -- 0:00:20
665000 -- (-1190.624) [-1191.075] (-1191.998) (-1194.679) * [-1189.544] (-1193.551) (-1191.730) (-1190.873) -- 0:00:21
Average standard deviation of split frequencies: 0.008966
665500 -- [-1191.517] (-1191.580) (-1193.511) (-1193.467) * [-1192.472] (-1190.188) (-1191.446) (-1191.037) -- 0:00:21
666000 -- (-1189.277) (-1190.784) [-1194.259] (-1190.395) * (-1190.204) (-1189.316) [-1191.082] (-1190.281) -- 0:00:21
666500 -- (-1190.532) (-1190.259) (-1193.476) [-1195.652] * (-1190.215) (-1191.832) [-1190.639] (-1189.417) -- 0:00:21
667000 -- [-1189.541] (-1190.388) (-1192.315) (-1191.535) * (-1190.635) (-1191.003) [-1190.480] (-1190.627) -- 0:00:20
667500 -- (-1190.637) (-1190.389) (-1191.994) [-1190.442] * (-1189.836) (-1190.584) [-1191.444] (-1190.410) -- 0:00:20
668000 -- [-1190.248] (-1192.827) (-1191.860) (-1191.216) * [-1191.932] (-1191.016) (-1193.461) (-1192.004) -- 0:00:20
668500 -- [-1189.405] (-1193.889) (-1190.385) (-1190.938) * [-1192.630] (-1193.432) (-1192.784) (-1190.608) -- 0:00:20
669000 -- (-1192.219) (-1194.931) [-1189.832] (-1191.425) * (-1191.888) (-1192.547) (-1192.063) [-1191.374] -- 0:00:20
669500 -- (-1192.205) (-1193.748) [-1189.981] (-1192.390) * [-1194.041] (-1193.727) (-1193.796) (-1191.034) -- 0:00:20
670000 -- (-1190.461) [-1190.588] (-1195.875) (-1191.744) * (-1189.702) (-1193.900) [-1190.671] (-1192.643) -- 0:00:20
Average standard deviation of split frequencies: 0.008716
670500 -- (-1192.539) [-1191.055] (-1192.181) (-1192.017) * (-1189.628) [-1194.753] (-1190.698) (-1193.493) -- 0:00:20
671000 -- [-1190.543] (-1190.872) (-1193.728) (-1191.620) * (-1190.891) [-1190.821] (-1193.174) (-1193.738) -- 0:00:20
671500 -- (-1191.671) (-1190.188) [-1191.240] (-1193.083) * (-1191.777) (-1189.685) (-1189.591) [-1190.163] -- 0:00:20
672000 -- (-1190.875) (-1189.938) [-1189.793] (-1192.428) * (-1189.973) [-1190.546] (-1191.812) (-1193.308) -- 0:00:20
672500 -- (-1193.378) [-1189.635] (-1195.023) (-1190.720) * [-1191.963] (-1193.690) (-1191.086) (-1189.651) -- 0:00:20
673000 -- [-1192.729] (-1190.363) (-1191.222) (-1190.817) * [-1195.716] (-1190.345) (-1190.333) (-1192.618) -- 0:00:20
673500 -- (-1193.530) (-1190.153) (-1194.869) [-1192.160] * (-1191.832) (-1191.748) (-1189.872) [-1190.667] -- 0:00:20
674000 -- (-1190.078) (-1189.536) (-1189.813) [-1189.943] * (-1193.509) (-1190.230) (-1189.376) [-1194.355] -- 0:00:20
674500 -- (-1189.530) (-1192.359) (-1196.919) [-1190.019] * (-1192.298) (-1190.532) [-1189.410] (-1192.138) -- 0:00:20
675000 -- (-1191.993) [-1193.730] (-1194.782) (-1195.456) * (-1194.414) (-1192.139) (-1192.518) [-1192.847] -- 0:00:20
Average standard deviation of split frequencies: 0.009065
675500 -- (-1192.512) [-1191.524] (-1192.232) (-1192.559) * (-1196.179) (-1192.442) [-1194.948] (-1194.427) -- 0:00:20
676000 -- (-1190.343) (-1190.271) [-1194.411] (-1190.020) * (-1191.674) (-1191.293) (-1197.988) [-1194.778] -- 0:00:20
676500 -- [-1190.333] (-1193.608) (-1194.360) (-1190.761) * (-1191.405) (-1192.666) [-1192.910] (-1194.810) -- 0:00:20
677000 -- [-1189.643] (-1192.245) (-1192.162) (-1189.800) * (-1189.402) [-1190.557] (-1196.921) (-1191.607) -- 0:00:20
677500 -- [-1190.736] (-1191.695) (-1196.710) (-1190.062) * (-1189.376) [-1192.056] (-1193.890) (-1190.478) -- 0:00:19
678000 -- (-1191.895) [-1192.029] (-1192.228) (-1189.897) * (-1190.004) (-1191.426) (-1190.902) [-1191.298] -- 0:00:19
678500 -- (-1194.872) (-1190.286) (-1191.372) [-1190.388] * (-1194.387) [-1194.055] (-1193.301) (-1193.465) -- 0:00:19
679000 -- (-1194.634) [-1192.787] (-1189.548) (-1190.657) * [-1190.331] (-1191.090) (-1189.684) (-1192.104) -- 0:00:19
679500 -- [-1189.410] (-1194.354) (-1197.633) (-1189.970) * (-1193.952) (-1194.677) (-1190.193) [-1191.407] -- 0:00:19
680000 -- (-1189.382) (-1191.198) (-1189.412) [-1196.002] * [-1194.491] (-1195.265) (-1192.406) (-1194.076) -- 0:00:19
Average standard deviation of split frequencies: 0.008819
680500 -- (-1190.123) (-1190.572) (-1189.761) [-1192.128] * [-1190.062] (-1191.360) (-1191.227) (-1195.470) -- 0:00:19
681000 -- [-1190.357] (-1191.803) (-1190.567) (-1191.667) * (-1191.519) (-1191.749) (-1190.391) [-1193.639] -- 0:00:20
681500 -- [-1191.956] (-1193.280) (-1192.766) (-1191.336) * (-1190.770) [-1192.772] (-1192.478) (-1193.489) -- 0:00:20
682000 -- (-1191.259) (-1197.289) (-1191.302) [-1191.968] * (-1193.145) [-1190.978] (-1191.532) (-1194.440) -- 0:00:20
682500 -- (-1191.859) (-1202.207) [-1192.181] (-1191.953) * [-1190.109] (-1191.454) (-1189.934) (-1192.434) -- 0:00:20
683000 -- (-1190.346) (-1191.948) (-1190.716) [-1191.872] * (-1190.043) (-1192.046) [-1190.040] (-1191.377) -- 0:00:19
683500 -- (-1191.127) [-1190.749] (-1191.555) (-1191.413) * [-1191.180] (-1192.080) (-1189.651) (-1191.918) -- 0:00:19
684000 -- (-1195.310) [-1190.562] (-1189.931) (-1193.077) * [-1189.699] (-1191.839) (-1191.666) (-1190.132) -- 0:00:19
684500 -- (-1191.485) (-1191.230) (-1191.400) [-1190.183] * (-1197.081) [-1192.606] (-1192.873) (-1193.541) -- 0:00:19
685000 -- (-1189.682) [-1191.337] (-1189.728) (-1190.210) * (-1191.681) (-1194.466) [-1189.911] (-1192.753) -- 0:00:19
Average standard deviation of split frequencies: 0.008933
685500 -- [-1189.692] (-1191.891) (-1189.786) (-1189.835) * [-1191.726] (-1190.393) (-1192.616) (-1192.195) -- 0:00:19
686000 -- [-1192.924] (-1189.939) (-1192.970) (-1192.344) * [-1193.234] (-1190.396) (-1189.755) (-1195.028) -- 0:00:19
686500 -- (-1192.645) (-1192.119) [-1190.149] (-1192.144) * (-1191.153) (-1190.535) [-1190.376] (-1193.875) -- 0:00:19
687000 -- (-1189.876) (-1191.731) [-1194.367] (-1194.025) * (-1192.917) (-1190.737) (-1192.263) [-1192.337] -- 0:00:19
687500 -- (-1195.591) [-1192.491] (-1192.329) (-1192.924) * [-1190.908] (-1190.235) (-1191.351) (-1191.782) -- 0:00:19
688000 -- [-1190.780] (-1190.362) (-1191.229) (-1189.721) * [-1191.132] (-1190.547) (-1190.259) (-1194.491) -- 0:00:19
688500 -- (-1190.215) (-1189.650) [-1192.749] (-1190.702) * [-1191.775] (-1190.883) (-1190.115) (-1194.669) -- 0:00:19
689000 -- (-1190.459) (-1190.714) (-1190.562) [-1191.796] * [-1189.418] (-1191.943) (-1190.116) (-1191.559) -- 0:00:19
689500 -- (-1189.697) [-1189.617] (-1189.365) (-1192.706) * (-1191.950) (-1191.076) [-1191.043] (-1192.579) -- 0:00:19
690000 -- [-1191.047] (-1190.228) (-1189.405) (-1195.769) * (-1189.703) (-1194.183) (-1191.908) [-1192.104] -- 0:00:19
Average standard deviation of split frequencies: 0.008236
690500 -- (-1192.727) [-1191.260] (-1192.913) (-1190.456) * (-1193.882) (-1193.841) [-1191.987] (-1190.336) -- 0:00:19
691000 -- (-1193.642) [-1190.822] (-1196.169) (-1190.213) * [-1192.218] (-1191.387) (-1192.738) (-1191.131) -- 0:00:19
691500 -- [-1191.317] (-1189.286) (-1189.772) (-1193.559) * (-1190.782) [-1189.411] (-1193.086) (-1190.789) -- 0:00:19
692000 -- (-1192.405) (-1189.287) [-1189.864] (-1193.941) * (-1193.804) [-1190.329] (-1189.595) (-1190.141) -- 0:00:19
692500 -- (-1192.623) (-1192.093) (-1190.075) [-1192.695] * (-1195.521) [-1189.789] (-1189.876) (-1190.575) -- 0:00:19
693000 -- (-1190.060) (-1190.431) [-1189.577] (-1193.002) * (-1193.930) [-1190.212] (-1189.418) (-1190.084) -- 0:00:19
693500 -- (-1195.356) [-1190.268] (-1192.189) (-1190.002) * [-1189.818] (-1190.473) (-1191.010) (-1190.057) -- 0:00:19
694000 -- (-1195.165) (-1189.330) (-1191.677) [-1190.039] * (-1189.489) (-1191.349) [-1191.376] (-1191.821) -- 0:00:18
694500 -- (-1192.327) (-1192.946) (-1194.375) [-1191.581] * (-1193.275) (-1191.944) [-1189.946] (-1191.547) -- 0:00:18
695000 -- (-1192.486) (-1192.234) [-1190.014] (-1192.012) * (-1189.832) (-1190.442) [-1189.627] (-1192.994) -- 0:00:18
Average standard deviation of split frequencies: 0.008083
695500 -- (-1190.888) (-1195.560) (-1195.993) [-1192.723] * (-1193.825) (-1190.034) (-1190.743) [-1197.742] -- 0:00:18
696000 -- (-1190.515) (-1191.100) [-1190.143] (-1194.267) * (-1191.437) (-1193.405) [-1191.476] (-1190.357) -- 0:00:18
696500 -- (-1189.779) [-1192.025] (-1191.782) (-1192.652) * (-1190.321) (-1191.177) (-1190.454) [-1190.339] -- 0:00:18
697000 -- [-1189.831] (-1189.793) (-1193.573) (-1189.680) * (-1189.710) (-1191.059) (-1190.971) [-1189.055] -- 0:00:19
697500 -- (-1190.960) (-1191.093) [-1191.388] (-1191.071) * (-1192.679) [-1190.667] (-1192.388) (-1190.199) -- 0:00:19
698000 -- (-1190.219) (-1191.455) (-1190.993) [-1190.552] * (-1192.567) [-1193.028] (-1194.808) (-1191.803) -- 0:00:19
698500 -- (-1192.744) (-1192.252) [-1191.155] (-1190.543) * (-1191.106) (-1190.518) (-1191.613) [-1192.549] -- 0:00:18
699000 -- [-1192.405] (-1193.049) (-1190.325) (-1190.806) * (-1189.800) (-1190.049) [-1192.873] (-1191.631) -- 0:00:18
699500 -- (-1192.170) (-1193.306) [-1192.300] (-1193.283) * (-1192.864) (-1191.932) (-1190.072) [-1192.926] -- 0:00:18
700000 -- (-1195.294) [-1191.268] (-1190.867) (-1189.782) * [-1192.376] (-1192.435) (-1189.923) (-1191.915) -- 0:00:18
Average standard deviation of split frequencies: 0.008567
700500 -- (-1192.420) (-1192.989) [-1192.504] (-1190.061) * (-1193.155) (-1192.232) (-1189.688) [-1191.707] -- 0:00:18
701000 -- [-1189.877] (-1192.622) (-1191.863) (-1190.570) * [-1193.878] (-1192.137) (-1192.153) (-1190.126) -- 0:00:18
701500 -- [-1190.544] (-1189.814) (-1195.355) (-1189.665) * (-1192.041) [-1190.262] (-1192.645) (-1190.927) -- 0:00:18
702000 -- (-1196.441) [-1190.180] (-1192.664) (-1190.510) * (-1190.337) [-1189.505] (-1190.839) (-1192.969) -- 0:00:18
702500 -- (-1192.056) [-1189.845] (-1190.228) (-1191.091) * (-1193.442) (-1189.826) [-1191.851] (-1191.201) -- 0:00:18
703000 -- (-1191.983) (-1190.791) [-1189.503] (-1191.299) * (-1193.203) (-1190.078) [-1191.689] (-1191.893) -- 0:00:18
703500 -- (-1190.130) [-1191.495] (-1192.406) (-1191.937) * (-1192.017) (-1191.236) [-1190.523] (-1191.266) -- 0:00:18
704000 -- (-1192.466) (-1194.161) [-1190.860] (-1190.113) * [-1191.530] (-1190.562) (-1190.523) (-1191.078) -- 0:00:18
704500 -- (-1191.508) (-1191.412) (-1191.039) [-1193.795] * (-1193.654) (-1192.516) [-1191.220] (-1191.373) -- 0:00:18
705000 -- (-1190.682) [-1191.190] (-1190.388) (-1193.119) * (-1191.040) (-1190.762) (-1189.602) [-1189.956] -- 0:00:18
Average standard deviation of split frequencies: 0.008369
705500 -- (-1190.190) (-1192.966) (-1192.490) [-1192.031] * [-1191.214] (-1190.761) (-1191.003) (-1189.807) -- 0:00:18
706000 -- [-1192.338] (-1193.106) (-1191.674) (-1190.718) * (-1191.870) [-1190.216] (-1190.842) (-1190.970) -- 0:00:18
706500 -- (-1189.554) [-1190.025] (-1193.004) (-1193.930) * (-1189.733) [-1189.505] (-1189.893) (-1193.056) -- 0:00:18
707000 -- (-1189.922) [-1190.953] (-1192.056) (-1192.838) * (-1189.635) (-1189.624) (-1190.544) [-1192.847] -- 0:00:18
707500 -- (-1190.284) (-1192.463) [-1192.678] (-1193.977) * (-1191.062) (-1191.320) [-1191.395] (-1191.109) -- 0:00:18
708000 -- (-1189.547) [-1193.812] (-1189.801) (-1192.123) * (-1191.508) [-1189.706] (-1192.045) (-1191.423) -- 0:00:18
708500 -- [-1194.151] (-1194.183) (-1190.299) (-1189.563) * (-1192.512) (-1190.418) [-1192.287] (-1191.742) -- 0:00:18
709000 -- (-1191.179) (-1190.794) [-1189.469] (-1191.353) * [-1191.125] (-1190.107) (-1191.437) (-1189.253) -- 0:00:18
709500 -- (-1190.005) [-1190.049] (-1189.635) (-1190.512) * (-1193.404) [-1190.918] (-1193.400) (-1189.482) -- 0:00:18
710000 -- (-1190.857) (-1189.700) [-1189.632] (-1192.221) * (-1190.493) (-1191.599) (-1191.334) [-1191.209] -- 0:00:17
Average standard deviation of split frequencies: 0.007871
710500 -- [-1190.079] (-1189.172) (-1191.903) (-1193.166) * [-1189.791] (-1190.439) (-1193.761) (-1189.784) -- 0:00:17
711000 -- (-1189.839) (-1189.172) [-1196.509] (-1190.806) * (-1191.605) [-1190.989] (-1193.709) (-1190.102) -- 0:00:17
711500 -- (-1190.888) [-1192.235] (-1191.455) (-1191.516) * (-1193.989) (-1191.298) [-1190.683] (-1190.129) -- 0:00:17
712000 -- (-1190.820) (-1189.723) (-1192.113) [-1189.466] * (-1189.733) (-1192.098) [-1192.279] (-1189.589) -- 0:00:17
712500 -- (-1191.690) [-1189.784] (-1191.810) (-1190.777) * [-1189.736] (-1191.443) (-1189.729) (-1189.574) -- 0:00:17
713000 -- (-1192.216) [-1190.559] (-1191.142) (-1189.974) * [-1189.695] (-1189.698) (-1191.655) (-1189.616) -- 0:00:18
713500 -- (-1190.250) [-1190.175] (-1190.065) (-1191.016) * [-1190.351] (-1189.455) (-1189.637) (-1190.847) -- 0:00:18
714000 -- (-1191.152) (-1193.051) [-1193.670] (-1190.528) * (-1192.808) (-1191.665) [-1189.535] (-1190.869) -- 0:00:18
714500 -- (-1191.081) (-1189.701) [-1191.736] (-1189.678) * [-1191.565] (-1189.470) (-1192.476) (-1191.047) -- 0:00:17
715000 -- (-1191.294) (-1190.323) (-1191.583) [-1190.595] * (-1195.979) [-1191.480] (-1192.319) (-1190.215) -- 0:00:17
Average standard deviation of split frequencies: 0.007857
715500 -- (-1192.305) (-1189.814) [-1193.363] (-1191.604) * (-1196.400) [-1192.372] (-1190.109) (-1189.997) -- 0:00:17
716000 -- [-1190.552] (-1191.951) (-1191.436) (-1190.667) * (-1197.086) (-1192.571) (-1189.469) [-1190.322] -- 0:00:17
716500 -- (-1190.926) [-1190.218] (-1190.268) (-1189.769) * (-1191.531) (-1193.367) (-1190.902) [-1190.483] -- 0:00:17
717000 -- (-1192.163) (-1189.817) [-1189.935] (-1191.952) * (-1193.260) [-1191.003] (-1189.615) (-1191.750) -- 0:00:17
717500 -- (-1193.531) (-1190.245) [-1191.727] (-1193.873) * (-1189.601) [-1192.438] (-1192.251) (-1190.235) -- 0:00:17
718000 -- [-1189.482] (-1191.122) (-1191.349) (-1193.068) * (-1190.001) [-1191.098] (-1191.888) (-1191.467) -- 0:00:17
718500 -- [-1192.905] (-1190.128) (-1190.415) (-1192.499) * [-1191.439] (-1190.332) (-1190.378) (-1193.838) -- 0:00:17
719000 -- (-1191.297) (-1191.614) [-1190.763] (-1190.766) * (-1193.296) (-1190.699) [-1190.271] (-1193.480) -- 0:00:17
719500 -- [-1191.486] (-1191.857) (-1191.861) (-1190.150) * (-1190.048) (-1191.255) (-1192.010) [-1192.098] -- 0:00:17
720000 -- (-1191.958) [-1192.114] (-1193.809) (-1191.469) * (-1195.277) (-1193.063) (-1190.083) [-1193.985] -- 0:00:17
Average standard deviation of split frequencies: 0.008678
720500 -- [-1191.203] (-1189.562) (-1189.327) (-1190.489) * (-1192.154) [-1192.595] (-1191.602) (-1195.704) -- 0:00:17
721000 -- (-1191.688) (-1192.089) (-1190.081) [-1189.842] * (-1191.088) (-1192.578) (-1191.552) [-1190.006] -- 0:00:17
721500 -- (-1190.841) (-1192.460) [-1194.474] (-1193.260) * (-1189.530) [-1191.815] (-1191.432) (-1195.128) -- 0:00:17
722000 -- [-1190.513] (-1190.491) (-1195.023) (-1196.886) * (-1190.888) (-1193.734) (-1191.485) [-1189.984] -- 0:00:17
722500 -- (-1192.461) [-1191.865] (-1193.813) (-1197.031) * [-1189.613] (-1190.904) (-1190.219) (-1189.364) -- 0:00:17
723000 -- [-1192.316] (-1192.772) (-1191.896) (-1195.681) * [-1193.002] (-1190.406) (-1191.618) (-1189.954) -- 0:00:17
723500 -- (-1192.453) [-1190.732] (-1193.653) (-1192.022) * [-1192.246] (-1190.314) (-1191.300) (-1190.147) -- 0:00:17
724000 -- (-1192.544) (-1189.449) [-1190.446] (-1189.801) * (-1191.129) (-1189.982) (-1190.322) [-1189.580] -- 0:00:17
724500 -- (-1192.922) (-1189.631) (-1190.646) [-1190.842] * (-1190.961) (-1189.899) (-1191.308) [-1189.838] -- 0:00:17
725000 -- [-1190.074] (-1192.443) (-1189.537) (-1190.831) * (-1189.530) (-1192.308) [-1191.141] (-1190.497) -- 0:00:17
Average standard deviation of split frequencies: 0.008787
725500 -- (-1191.074) (-1191.100) (-1189.635) [-1192.592] * [-1192.068] (-1190.227) (-1191.930) (-1190.522) -- 0:00:17
726000 -- (-1190.505) [-1190.915] (-1190.125) (-1190.776) * [-1191.264] (-1194.352) (-1191.144) (-1190.378) -- 0:00:16
726500 -- (-1189.906) [-1193.887] (-1193.110) (-1192.530) * (-1190.864) [-1189.781] (-1195.171) (-1190.919) -- 0:00:16
727000 -- (-1190.610) (-1192.516) [-1191.637] (-1192.739) * (-1190.292) (-1191.676) [-1194.153] (-1195.529) -- 0:00:16
727500 -- (-1191.399) [-1195.627] (-1193.913) (-1190.294) * [-1191.522] (-1191.870) (-1191.471) (-1195.213) -- 0:00:16
728000 -- (-1190.208) (-1197.361) (-1193.928) [-1190.889] * [-1192.060] (-1189.888) (-1191.207) (-1190.743) -- 0:00:16
728500 -- (-1189.354) (-1190.922) (-1192.921) [-1191.650] * (-1191.525) (-1190.890) (-1191.999) [-1190.788] -- 0:00:16
729000 -- (-1192.293) (-1189.766) (-1194.410) [-1191.927] * (-1190.696) [-1191.113] (-1198.686) (-1192.663) -- 0:00:17
729500 -- (-1195.853) (-1189.102) [-1191.624] (-1197.537) * [-1190.116] (-1189.511) (-1192.878) (-1193.303) -- 0:00:17
730000 -- (-1192.016) [-1194.352] (-1189.998) (-1198.698) * [-1189.707] (-1189.479) (-1193.181) (-1190.472) -- 0:00:17
Average standard deviation of split frequencies: 0.008989
730500 -- (-1189.980) (-1191.705) [-1193.554] (-1191.144) * [-1190.483] (-1191.341) (-1191.462) (-1193.717) -- 0:00:16
731000 -- (-1193.503) [-1189.946] (-1195.176) (-1191.397) * (-1191.643) (-1191.412) (-1190.537) [-1195.733] -- 0:00:16
731500 -- [-1193.098] (-1189.257) (-1193.372) (-1192.417) * (-1190.094) (-1189.921) (-1191.065) [-1191.328] -- 0:00:16
732000 -- (-1190.917) (-1197.693) (-1197.045) [-1192.710] * (-1194.873) (-1190.076) [-1191.329] (-1190.469) -- 0:00:16
732500 -- (-1191.860) [-1193.582] (-1191.053) (-1190.311) * (-1193.210) (-1193.902) [-1194.469] (-1191.050) -- 0:00:16
733000 -- (-1190.559) (-1196.625) [-1191.400] (-1191.361) * (-1194.705) (-1189.721) (-1195.562) [-1195.726] -- 0:00:16
733500 -- (-1197.621) (-1190.208) [-1191.131] (-1189.765) * (-1190.442) (-1191.096) (-1191.937) [-1191.933] -- 0:00:16
734000 -- (-1191.810) (-1191.264) (-1189.632) [-1189.530] * (-1191.835) (-1191.282) (-1191.747) [-1195.904] -- 0:00:16
734500 -- (-1189.837) [-1190.257] (-1189.918) (-1189.690) * (-1193.032) (-1190.841) (-1190.832) [-1191.134] -- 0:00:16
735000 -- (-1190.686) (-1194.735) [-1189.924] (-1190.762) * (-1192.909) (-1192.155) (-1190.848) [-1193.278] -- 0:00:16
Average standard deviation of split frequencies: 0.008668
735500 -- (-1191.237) [-1190.307] (-1191.093) (-1190.577) * [-1190.725] (-1190.981) (-1189.512) (-1191.489) -- 0:00:16
736000 -- (-1190.451) (-1192.073) (-1192.076) [-1189.349] * [-1192.340] (-1190.240) (-1198.644) (-1191.348) -- 0:00:16
736500 -- [-1191.781] (-1192.619) (-1192.363) (-1189.321) * [-1191.945] (-1190.342) (-1190.239) (-1189.976) -- 0:00:16
737000 -- (-1192.307) [-1192.679] (-1192.083) (-1190.186) * (-1191.804) (-1191.481) [-1192.620] (-1192.459) -- 0:00:16
737500 -- (-1194.355) (-1192.229) (-1189.644) [-1189.903] * (-1190.161) [-1190.845] (-1192.153) (-1191.490) -- 0:00:16
738000 -- (-1193.464) (-1191.220) (-1193.519) [-1194.676] * (-1190.528) (-1191.906) [-1191.407] (-1191.310) -- 0:00:16
738500 -- [-1190.002] (-1190.669) (-1195.708) (-1191.948) * [-1190.578] (-1191.351) (-1192.786) (-1191.898) -- 0:00:16
739000 -- (-1190.561) [-1193.550] (-1190.843) (-1194.205) * (-1190.860) [-1189.824] (-1192.631) (-1190.900) -- 0:00:16
739500 -- [-1190.733] (-1191.046) (-1193.233) (-1191.077) * (-1190.878) [-1191.903] (-1190.021) (-1191.545) -- 0:00:16
740000 -- (-1193.758) (-1191.413) [-1194.038] (-1192.306) * (-1189.649) (-1191.209) [-1191.095] (-1190.476) -- 0:00:16
Average standard deviation of split frequencies: 0.008529
740500 -- (-1190.905) (-1190.504) [-1190.972] (-1189.621) * [-1189.610] (-1190.921) (-1190.640) (-1191.009) -- 0:00:16
741000 -- (-1191.483) (-1190.339) (-1193.645) [-1192.025] * (-1190.420) [-1191.391] (-1191.391) (-1190.570) -- 0:00:16
741500 -- (-1189.751) (-1190.373) [-1189.482] (-1191.376) * [-1191.322] (-1191.837) (-1193.356) (-1191.992) -- 0:00:16
742000 -- (-1192.599) (-1190.179) [-1189.929] (-1194.262) * [-1190.998] (-1191.540) (-1192.713) (-1192.484) -- 0:00:15
742500 -- (-1191.213) (-1191.382) [-1189.811] (-1191.547) * [-1192.938] (-1191.238) (-1194.961) (-1192.345) -- 0:00:15
743000 -- (-1191.624) (-1190.077) (-1190.645) [-1191.392] * [-1190.345] (-1192.626) (-1194.795) (-1189.539) -- 0:00:15
743500 -- (-1194.204) (-1197.484) (-1193.246) [-1192.556] * (-1193.797) (-1191.548) [-1196.613] (-1190.182) -- 0:00:15
744000 -- [-1193.887] (-1192.504) (-1190.099) (-1192.851) * [-1191.900] (-1193.312) (-1198.657) (-1199.918) -- 0:00:15
744500 -- (-1191.484) (-1192.121) (-1189.990) [-1192.585] * (-1192.739) [-1193.325] (-1190.402) (-1200.668) -- 0:00:15
745000 -- (-1190.964) (-1191.566) (-1190.062) [-1190.894] * [-1191.383] (-1190.722) (-1190.846) (-1194.599) -- 0:00:16
Average standard deviation of split frequencies: 0.008299
745500 -- (-1190.823) (-1190.372) (-1190.782) [-1189.974] * (-1193.604) (-1190.391) (-1193.505) [-1190.684] -- 0:00:16
746000 -- (-1192.650) (-1191.658) [-1190.859] (-1193.460) * (-1195.945) [-1192.813] (-1190.993) (-1191.253) -- 0:00:16
746500 -- (-1190.621) (-1193.293) (-1193.001) [-1193.517] * (-1190.620) [-1192.433] (-1192.008) (-1192.240) -- 0:00:15
747000 -- [-1190.854] (-1190.181) (-1192.734) (-1197.249) * (-1189.827) (-1192.787) [-1193.462] (-1190.228) -- 0:00:15
747500 -- (-1191.334) (-1190.964) (-1191.532) [-1190.399] * [-1190.382] (-1197.133) (-1192.438) (-1191.380) -- 0:00:15
748000 -- (-1190.263) [-1192.067] (-1193.186) (-1193.030) * (-1190.833) (-1195.567) [-1190.346] (-1192.266) -- 0:00:15
748500 -- [-1190.752] (-1192.745) (-1190.597) (-1193.305) * [-1191.285] (-1201.797) (-1190.520) (-1197.461) -- 0:00:15
749000 -- (-1189.639) [-1191.597] (-1193.731) (-1189.411) * (-1193.213) (-1192.507) (-1190.966) [-1195.562] -- 0:00:15
749500 -- (-1190.343) (-1191.327) (-1192.311) [-1189.628] * [-1193.230] (-1191.253) (-1189.763) (-1194.559) -- 0:00:15
750000 -- (-1190.820) (-1191.854) [-1190.856] (-1189.934) * (-1191.340) (-1196.335) [-1190.663] (-1191.804) -- 0:00:15
Average standard deviation of split frequencies: 0.008541
750500 -- [-1192.164] (-1190.984) (-1189.678) (-1192.558) * (-1194.061) (-1192.539) [-1192.753] (-1192.786) -- 0:00:15
751000 -- [-1196.149] (-1190.964) (-1194.289) (-1190.583) * (-1192.498) [-1190.098] (-1190.953) (-1193.031) -- 0:00:15
751500 -- (-1193.685) (-1190.390) [-1191.648] (-1192.198) * (-1191.883) (-1189.967) [-1189.941] (-1189.854) -- 0:00:15
752000 -- (-1190.736) (-1190.100) [-1193.593] (-1194.260) * (-1189.713) (-1190.508) [-1189.917] (-1190.849) -- 0:00:15
752500 -- (-1190.936) [-1190.296] (-1190.784) (-1191.262) * (-1190.834) (-1189.904) (-1193.458) [-1190.894] -- 0:00:15
753000 -- (-1191.354) [-1190.171] (-1194.111) (-1191.646) * (-1191.447) (-1190.241) (-1192.704) [-1189.934] -- 0:00:15
753500 -- [-1189.461] (-1191.885) (-1193.690) (-1193.050) * (-1189.830) (-1193.877) [-1191.979] (-1194.970) -- 0:00:15
754000 -- (-1190.785) [-1189.743] (-1192.080) (-1190.877) * [-1189.617] (-1196.579) (-1190.953) (-1196.202) -- 0:00:15
754500 -- (-1191.057) [-1191.224] (-1193.433) (-1192.670) * (-1189.838) (-1192.222) [-1191.048] (-1192.110) -- 0:00:15
755000 -- (-1191.075) (-1191.063) [-1192.409] (-1189.412) * (-1191.377) [-1189.641] (-1190.874) (-1190.973) -- 0:00:15
Average standard deviation of split frequencies: 0.008231
755500 -- [-1191.279] (-1190.340) (-1189.376) (-1196.887) * (-1191.160) (-1193.739) [-1192.984] (-1189.132) -- 0:00:15
756000 -- (-1191.758) [-1190.016] (-1191.075) (-1192.004) * (-1192.543) [-1189.862] (-1191.548) (-1191.644) -- 0:00:15
756500 -- (-1190.673) (-1190.032) [-1191.479] (-1192.114) * (-1193.191) (-1189.559) (-1192.963) [-1190.526] -- 0:00:15
757000 -- (-1190.546) [-1191.909] (-1190.378) (-1195.354) * (-1189.768) (-1189.593) [-1190.495] (-1189.843) -- 0:00:15
757500 -- (-1190.219) (-1192.626) (-1189.760) [-1195.268] * (-1190.456) [-1191.963] (-1190.386) (-1189.322) -- 0:00:15
758000 -- (-1190.530) (-1193.097) (-1192.217) [-1190.573] * (-1189.736) (-1192.920) [-1193.958] (-1190.064) -- 0:00:15
758500 -- (-1190.548) [-1194.796] (-1193.545) (-1191.674) * (-1189.735) [-1191.316] (-1191.166) (-1190.948) -- 0:00:14
759000 -- (-1191.319) (-1195.253) [-1191.055] (-1191.055) * (-1190.547) [-1191.467] (-1191.013) (-1191.119) -- 0:00:14
759500 -- [-1190.530] (-1191.130) (-1190.503) (-1190.734) * (-1190.858) (-1191.097) [-1191.088] (-1190.340) -- 0:00:14
760000 -- (-1191.029) (-1191.714) (-1190.089) [-1189.567] * (-1192.698) [-1192.491] (-1189.445) (-1190.294) -- 0:00:14
Average standard deviation of split frequencies: 0.008552
760500 -- (-1192.077) (-1189.158) [-1191.761] (-1195.471) * [-1193.249] (-1192.635) (-1193.139) (-1190.632) -- 0:00:14
761000 -- (-1197.634) (-1191.577) [-1192.262] (-1191.169) * (-1190.630) (-1189.786) [-1191.795] (-1190.714) -- 0:00:15
761500 -- (-1193.895) (-1192.145) (-1192.211) [-1189.335] * [-1190.952] (-1192.189) (-1190.312) (-1190.579) -- 0:00:15
762000 -- (-1191.262) [-1189.863] (-1192.563) (-1192.079) * (-1190.412) [-1191.556] (-1191.248) (-1189.848) -- 0:00:14
762500 -- (-1193.159) (-1192.412) [-1190.524] (-1194.531) * [-1190.287] (-1195.874) (-1191.798) (-1192.681) -- 0:00:14
763000 -- (-1192.596) (-1190.741) [-1189.947] (-1191.498) * (-1191.868) (-1192.865) (-1192.199) [-1193.121] -- 0:00:14
763500 -- (-1191.293) [-1190.231] (-1190.812) (-1195.505) * (-1191.661) (-1193.176) [-1193.929] (-1191.307) -- 0:00:14
764000 -- [-1190.168] (-1190.949) (-1191.287) (-1193.434) * (-1191.923) (-1191.799) (-1194.916) [-1189.861] -- 0:00:14
764500 -- (-1192.171) [-1189.970] (-1190.037) (-1192.013) * (-1190.295) [-1192.171] (-1192.564) (-1190.356) -- 0:00:14
765000 -- (-1191.789) (-1190.674) (-1191.038) [-1191.330] * [-1190.503] (-1190.430) (-1192.492) (-1191.000) -- 0:00:14
Average standard deviation of split frequencies: 0.008247
765500 -- (-1189.952) [-1190.106] (-1190.322) (-1191.185) * (-1191.972) [-1193.241] (-1190.955) (-1194.389) -- 0:00:14
766000 -- (-1190.664) [-1189.770] (-1190.030) (-1191.860) * (-1191.124) [-1192.377] (-1191.621) (-1194.323) -- 0:00:14
766500 -- (-1193.115) (-1192.926) (-1192.351) [-1189.671] * (-1190.773) [-1189.467] (-1190.285) (-1192.862) -- 0:00:14
767000 -- (-1193.293) (-1191.097) (-1191.688) [-1189.518] * (-1191.253) (-1189.524) (-1192.349) [-1190.141] -- 0:00:14
767500 -- (-1193.452) (-1190.191) (-1190.059) [-1189.235] * (-1192.008) [-1190.622] (-1190.241) (-1191.117) -- 0:00:14
768000 -- (-1193.644) (-1191.434) [-1192.422] (-1190.669) * (-1193.761) (-1194.178) (-1191.857) [-1190.364] -- 0:00:14
768500 -- (-1192.590) (-1190.970) (-1189.854) [-1189.933] * (-1193.630) (-1196.388) (-1193.522) [-1190.677] -- 0:00:14
769000 -- (-1191.262) (-1192.823) [-1190.945] (-1191.270) * (-1192.246) (-1192.978) [-1190.761] (-1189.541) -- 0:00:14
769500 -- (-1190.871) (-1190.849) [-1190.116] (-1189.962) * (-1189.561) [-1191.959] (-1189.717) (-1192.041) -- 0:00:14
770000 -- [-1189.777] (-1193.620) (-1189.413) (-1190.068) * (-1190.006) [-1190.832] (-1190.158) (-1196.506) -- 0:00:14
Average standard deviation of split frequencies: 0.008360
770500 -- [-1193.862] (-1190.996) (-1189.961) (-1190.799) * (-1193.110) (-1194.350) [-1189.966] (-1192.952) -- 0:00:14
771000 -- (-1191.173) (-1189.647) (-1189.901) [-1190.806] * (-1191.876) [-1190.255] (-1195.098) (-1196.565) -- 0:00:14
771500 -- (-1194.673) (-1189.647) [-1190.486] (-1194.168) * (-1196.012) (-1190.919) (-1189.700) [-1193.221] -- 0:00:14
772000 -- (-1190.732) [-1190.093] (-1194.868) (-1191.693) * (-1194.297) [-1193.596] (-1189.700) (-1194.909) -- 0:00:14
772500 -- [-1190.386] (-1190.110) (-1190.808) (-1196.058) * (-1192.519) [-1191.079] (-1190.212) (-1190.861) -- 0:00:14
773000 -- (-1189.614) (-1191.447) (-1189.723) [-1191.051] * (-1195.757) (-1191.740) [-1191.571] (-1191.202) -- 0:00:14
773500 -- (-1189.436) [-1191.087] (-1189.980) (-1193.828) * (-1194.022) (-1191.311) [-1191.425] (-1191.027) -- 0:00:14
774000 -- [-1190.938] (-1196.918) (-1191.569) (-1191.787) * [-1189.999] (-1189.604) (-1190.118) (-1192.121) -- 0:00:14
774500 -- (-1189.383) (-1196.365) [-1191.280] (-1190.998) * (-1190.857) (-1190.757) (-1189.467) [-1191.014] -- 0:00:13
775000 -- (-1190.246) (-1195.478) (-1190.761) [-1190.070] * [-1189.565] (-1190.915) (-1190.646) (-1192.939) -- 0:00:13
Average standard deviation of split frequencies: 0.008910
775500 -- (-1190.398) [-1190.643] (-1195.482) (-1191.033) * (-1194.285) (-1189.714) (-1189.331) [-1189.162] -- 0:00:13
776000 -- (-1190.122) (-1190.872) (-1192.778) [-1190.054] * (-1192.508) (-1192.161) (-1191.343) [-1192.484] -- 0:00:13
776500 -- [-1190.012] (-1194.259) (-1191.054) (-1192.333) * [-1189.760] (-1196.153) (-1190.970) (-1192.938) -- 0:00:13
777000 -- (-1194.426) (-1194.150) [-1189.338] (-1190.077) * (-1189.936) (-1195.427) (-1192.514) [-1191.684] -- 0:00:14
777500 -- (-1190.195) [-1191.245] (-1192.777) (-1191.362) * [-1191.319] (-1190.867) (-1192.751) (-1190.362) -- 0:00:14
778000 -- (-1191.087) [-1193.575] (-1190.767) (-1191.636) * (-1190.994) (-1193.459) [-1193.995] (-1190.697) -- 0:00:13
778500 -- (-1193.516) [-1190.705] (-1196.527) (-1193.272) * [-1191.998] (-1193.130) (-1190.603) (-1193.853) -- 0:00:13
779000 -- (-1191.969) (-1191.227) (-1192.253) [-1190.773] * (-1192.213) (-1191.937) (-1195.238) [-1191.533] -- 0:00:13
779500 -- (-1193.737) (-1191.948) [-1190.187] (-1192.049) * (-1192.018) [-1192.030] (-1191.057) (-1189.935) -- 0:00:13
780000 -- [-1189.777] (-1193.453) (-1190.813) (-1190.061) * (-1190.713) (-1195.775) (-1192.019) [-1190.906] -- 0:00:13
Average standard deviation of split frequencies: 0.009219
780500 -- [-1189.754] (-1195.388) (-1193.334) (-1195.631) * [-1189.091] (-1191.356) (-1190.317) (-1192.436) -- 0:00:13
781000 -- (-1190.664) [-1190.967] (-1190.385) (-1194.919) * [-1189.190] (-1193.141) (-1193.516) (-1192.037) -- 0:00:13
781500 -- (-1192.131) (-1191.009) (-1191.359) [-1191.697] * (-1194.448) [-1192.958] (-1191.072) (-1189.978) -- 0:00:13
782000 -- (-1194.194) (-1189.845) (-1191.779) [-1191.715] * (-1193.771) [-1190.366] (-1191.504) (-1192.975) -- 0:00:13
782500 -- (-1192.588) [-1191.655] (-1193.825) (-1190.927) * (-1190.807) [-1190.090] (-1192.215) (-1194.397) -- 0:00:13
783000 -- (-1190.656) [-1192.394] (-1196.477) (-1192.460) * (-1191.642) (-1193.534) [-1190.926] (-1191.173) -- 0:00:13
783500 -- (-1191.421) [-1191.906] (-1200.074) (-1191.231) * [-1190.059] (-1196.676) (-1194.375) (-1195.124) -- 0:00:13
784000 -- [-1191.596] (-1192.175) (-1191.887) (-1189.521) * (-1191.198) (-1190.613) (-1191.537) [-1191.086] -- 0:00:13
784500 -- (-1190.163) [-1190.952] (-1192.039) (-1189.475) * (-1190.863) (-1191.644) (-1193.676) [-1191.154] -- 0:00:13
785000 -- (-1191.176) [-1192.601] (-1191.082) (-1189.697) * [-1190.388] (-1194.236) (-1193.140) (-1190.658) -- 0:00:13
Average standard deviation of split frequencies: 0.009036
785500 -- (-1189.786) [-1190.938] (-1191.198) (-1190.557) * [-1192.646] (-1193.035) (-1191.488) (-1189.408) -- 0:00:13
786000 -- (-1189.623) (-1190.791) (-1190.809) [-1193.202] * [-1192.503] (-1195.308) (-1191.443) (-1190.775) -- 0:00:13
786500 -- [-1189.861] (-1192.727) (-1190.809) (-1191.794) * (-1191.186) [-1190.598] (-1192.050) (-1191.132) -- 0:00:13
787000 -- (-1190.953) (-1189.876) [-1192.014] (-1192.505) * (-1190.046) [-1191.379] (-1193.030) (-1194.375) -- 0:00:13
787500 -- (-1189.428) [-1193.816] (-1192.262) (-1192.943) * (-1190.773) (-1192.011) [-1189.619] (-1189.824) -- 0:00:13
788000 -- (-1194.325) (-1193.380) [-1190.862] (-1190.340) * (-1190.919) [-1194.556] (-1190.073) (-1190.467) -- 0:00:13
788500 -- (-1194.318) (-1189.827) (-1190.047) [-1190.234] * (-1197.000) (-1192.713) (-1190.913) [-1189.946] -- 0:00:13
789000 -- [-1192.297] (-1192.013) (-1190.804) (-1190.064) * (-1194.728) [-1191.440] (-1197.130) (-1193.540) -- 0:00:13
789500 -- (-1191.184) (-1192.942) (-1191.280) [-1190.394] * (-1194.390) (-1189.981) (-1198.584) [-1192.323] -- 0:00:13
790000 -- (-1190.208) (-1191.777) (-1192.526) [-1190.659] * (-1196.715) [-1190.398] (-1192.422) (-1191.922) -- 0:00:13
Average standard deviation of split frequencies: 0.008903
790500 -- (-1189.627) (-1190.786) (-1191.510) [-1190.068] * (-1195.272) (-1191.341) [-1191.085] (-1193.780) -- 0:00:12
791000 -- (-1190.931) [-1195.567] (-1200.281) (-1193.139) * [-1191.547] (-1190.547) (-1190.373) (-1190.231) -- 0:00:12
791500 -- (-1191.576) (-1191.021) [-1190.830] (-1192.049) * (-1192.206) (-1191.724) [-1191.541] (-1192.653) -- 0:00:12
792000 -- [-1190.221] (-1191.592) (-1191.901) (-1192.852) * (-1191.471) [-1189.268] (-1190.973) (-1190.127) -- 0:00:12
792500 -- [-1192.014] (-1192.217) (-1189.974) (-1190.350) * [-1192.249] (-1190.926) (-1189.195) (-1189.380) -- 0:00:12
793000 -- (-1192.228) [-1191.657] (-1190.766) (-1190.969) * (-1189.685) (-1191.846) (-1191.268) [-1191.360] -- 0:00:12
793500 -- (-1190.717) (-1191.150) (-1192.743) [-1190.686] * (-1192.596) [-1189.820] (-1191.318) (-1189.164) -- 0:00:13
794000 -- (-1190.137) (-1191.283) [-1190.387] (-1194.592) * (-1196.155) (-1190.801) (-1193.234) [-1189.683] -- 0:00:12
794500 -- [-1190.948] (-1190.724) (-1189.697) (-1190.200) * (-1192.097) (-1194.838) [-1194.064] (-1192.395) -- 0:00:12
795000 -- (-1192.409) (-1190.900) (-1190.119) [-1189.776] * (-1193.094) (-1190.731) [-1191.796] (-1191.528) -- 0:00:12
Average standard deviation of split frequencies: 0.008962
795500 -- (-1191.470) (-1194.963) (-1192.340) [-1192.706] * (-1192.986) (-1190.852) [-1189.565] (-1190.753) -- 0:00:12
796000 -- [-1191.069] (-1192.991) (-1189.829) (-1193.011) * (-1195.781) [-1193.261] (-1190.146) (-1189.569) -- 0:00:12
796500 -- (-1190.512) [-1189.558] (-1192.351) (-1192.373) * (-1191.874) (-1192.960) (-1191.538) [-1190.462] -- 0:00:12
797000 -- (-1192.092) [-1190.778] (-1191.712) (-1191.105) * (-1191.140) (-1190.434) [-1191.866] (-1190.250) -- 0:00:12
797500 -- [-1190.806] (-1193.078) (-1192.943) (-1192.478) * [-1192.967] (-1190.174) (-1192.830) (-1189.836) -- 0:00:12
798000 -- (-1191.981) [-1191.010] (-1189.818) (-1190.952) * (-1191.399) [-1192.887] (-1191.542) (-1190.340) -- 0:00:12
798500 -- (-1190.306) [-1191.318] (-1190.186) (-1195.190) * [-1191.545] (-1191.747) (-1191.037) (-1196.237) -- 0:00:12
799000 -- (-1189.519) (-1194.451) (-1191.487) [-1192.278] * (-1195.055) [-1199.251] (-1192.240) (-1191.461) -- 0:00:12
799500 -- (-1190.345) (-1189.982) [-1189.951] (-1189.700) * (-1193.376) [-1189.925] (-1191.005) (-1196.038) -- 0:00:12
800000 -- (-1189.965) (-1190.578) (-1190.873) [-1191.486] * (-1192.428) [-1190.782] (-1193.381) (-1191.411) -- 0:00:12
Average standard deviation of split frequencies: 0.009067
800500 -- (-1190.202) (-1199.282) [-1190.544] (-1192.360) * (-1191.044) (-1190.409) (-1196.101) [-1191.661] -- 0:00:12
801000 -- [-1190.130] (-1195.218) (-1194.619) (-1192.540) * (-1193.325) (-1190.665) (-1192.492) [-1190.302] -- 0:00:12
801500 -- [-1190.794] (-1198.534) (-1192.456) (-1189.978) * (-1190.652) (-1190.250) (-1189.303) [-1189.774] -- 0:00:12
802000 -- (-1189.116) [-1192.653] (-1191.082) (-1192.715) * (-1191.265) (-1194.078) [-1191.181] (-1190.252) -- 0:00:12
802500 -- (-1191.275) (-1191.337) [-1190.386] (-1198.171) * (-1192.488) (-1191.807) [-1190.833] (-1191.913) -- 0:00:12
803000 -- (-1192.812) (-1191.449) [-1191.406] (-1192.348) * (-1191.053) [-1194.206] (-1192.800) (-1190.084) -- 0:00:12
803500 -- (-1191.731) [-1192.390] (-1189.806) (-1191.268) * (-1191.467) (-1193.871) (-1198.327) [-1193.927] -- 0:00:12
804000 -- [-1192.600] (-1197.196) (-1190.452) (-1190.626) * (-1191.710) [-1194.550] (-1193.156) (-1192.643) -- 0:00:12
804500 -- (-1190.549) (-1191.206) [-1194.258] (-1192.174) * (-1190.649) (-1196.224) (-1192.019) [-1189.677] -- 0:00:12
805000 -- (-1190.282) (-1189.043) [-1192.464] (-1191.808) * (-1195.449) (-1191.072) (-1191.591) [-1192.689] -- 0:00:12
Average standard deviation of split frequencies: 0.009436
805500 -- (-1189.511) [-1191.348] (-1192.084) (-1192.761) * (-1194.116) (-1193.104) [-1192.492] (-1191.904) -- 0:00:12
806000 -- (-1190.411) [-1192.806] (-1191.586) (-1194.106) * (-1193.367) [-1191.135] (-1192.488) (-1198.090) -- 0:00:12
806500 -- (-1192.885) [-1189.356] (-1192.804) (-1190.759) * (-1190.212) (-1191.292) [-1189.970] (-1193.446) -- 0:00:11
807000 -- (-1193.064) (-1191.216) [-1189.883] (-1190.732) * (-1191.202) (-1191.219) [-1190.461] (-1190.508) -- 0:00:11
807500 -- (-1190.804) [-1192.393] (-1189.637) (-1189.623) * (-1191.483) (-1191.312) (-1191.498) [-1193.840] -- 0:00:11
808000 -- (-1194.407) (-1189.766) [-1191.006] (-1192.421) * (-1191.250) (-1190.399) [-1190.808] (-1191.538) -- 0:00:11
808500 -- (-1192.467) (-1189.993) [-1191.865] (-1190.852) * [-1190.298] (-1193.731) (-1191.816) (-1192.634) -- 0:00:11
809000 -- [-1190.255] (-1194.040) (-1190.654) (-1191.243) * (-1190.849) (-1192.717) [-1191.388] (-1191.898) -- 0:00:11
809500 -- (-1197.569) (-1190.231) (-1192.989) [-1189.926] * (-1192.640) [-1190.287] (-1190.851) (-1191.137) -- 0:00:12
810000 -- (-1195.674) [-1191.237] (-1198.848) (-1189.827) * (-1192.030) (-1193.770) [-1190.483] (-1192.332) -- 0:00:11
Average standard deviation of split frequencies: 0.009188
810500 -- (-1196.512) (-1193.915) [-1190.212] (-1192.207) * (-1191.399) (-1192.756) (-1190.319) [-1189.899] -- 0:00:11
811000 -- (-1190.321) (-1193.440) (-1192.733) [-1191.711] * (-1190.659) (-1192.808) [-1189.208] (-1193.875) -- 0:00:11
811500 -- (-1189.340) (-1193.189) [-1189.584] (-1190.936) * (-1189.677) [-1191.754] (-1192.035) (-1193.318) -- 0:00:11
812000 -- (-1191.215) [-1194.939] (-1191.683) (-1190.007) * [-1194.300] (-1190.782) (-1191.591) (-1192.419) -- 0:00:11
812500 -- (-1192.569) [-1189.487] (-1191.163) (-1191.390) * (-1192.019) (-1190.807) (-1193.008) [-1191.421] -- 0:00:11
813000 -- (-1191.363) [-1191.454] (-1189.905) (-1190.638) * [-1191.021] (-1192.576) (-1193.635) (-1191.538) -- 0:00:11
813500 -- (-1193.839) (-1193.803) [-1189.997] (-1191.718) * [-1191.102] (-1190.197) (-1189.525) (-1191.319) -- 0:00:11
814000 -- (-1198.728) (-1190.674) [-1191.680] (-1191.052) * [-1194.517] (-1193.158) (-1190.541) (-1193.160) -- 0:00:11
814500 -- (-1196.859) (-1190.768) [-1191.846] (-1192.857) * (-1193.823) (-1193.950) (-1190.581) [-1195.459] -- 0:00:11
815000 -- [-1194.135] (-1189.860) (-1191.736) (-1190.040) * [-1191.855] (-1191.051) (-1190.646) (-1194.452) -- 0:00:11
Average standard deviation of split frequencies: 0.008820
815500 -- (-1191.067) (-1189.810) (-1192.374) [-1189.599] * [-1190.080] (-1190.805) (-1190.926) (-1196.633) -- 0:00:11
816000 -- (-1191.321) (-1190.264) [-1190.289] (-1189.822) * [-1191.924] (-1190.840) (-1190.340) (-1196.976) -- 0:00:11
816500 -- (-1191.591) (-1190.222) [-1189.674] (-1190.850) * [-1192.152] (-1192.387) (-1192.439) (-1193.484) -- 0:00:11
817000 -- (-1190.371) [-1192.897] (-1189.446) (-1189.636) * [-1191.057] (-1195.680) (-1193.371) (-1191.195) -- 0:00:11
817500 -- (-1191.996) [-1190.487] (-1189.080) (-1193.729) * (-1191.007) [-1193.079] (-1195.247) (-1191.198) -- 0:00:11
818000 -- (-1189.757) (-1191.246) (-1189.121) [-1193.180] * [-1191.796] (-1192.191) (-1194.038) (-1192.564) -- 0:00:11
818500 -- [-1192.772] (-1191.775) (-1191.904) (-1192.213) * (-1191.910) (-1193.201) (-1190.538) [-1192.853] -- 0:00:11
819000 -- (-1190.201) [-1192.351] (-1189.628) (-1191.464) * [-1194.757] (-1191.432) (-1191.487) (-1189.705) -- 0:00:11
819500 -- (-1194.364) (-1190.328) [-1190.001] (-1192.357) * (-1191.098) (-1190.677) (-1191.299) [-1191.648] -- 0:00:11
820000 -- (-1192.350) [-1190.663] (-1192.744) (-1191.042) * [-1191.638] (-1191.769) (-1190.242) (-1190.897) -- 0:00:11
Average standard deviation of split frequencies: 0.009344
820500 -- (-1192.859) (-1192.246) [-1189.850] (-1191.480) * (-1190.529) [-1191.441] (-1190.242) (-1190.688) -- 0:00:11
821000 -- (-1193.141) (-1189.207) (-1189.577) [-1192.802] * (-1192.185) (-1190.968) [-1193.169] (-1192.679) -- 0:00:11
821500 -- (-1193.776) (-1191.607) (-1190.976) [-1189.896] * (-1191.003) (-1191.012) (-1191.997) [-1190.938] -- 0:00:11
822000 -- (-1193.705) (-1192.042) [-1189.991] (-1190.631) * (-1192.220) (-1190.701) [-1191.113] (-1192.799) -- 0:00:11
822500 -- (-1193.015) (-1190.525) [-1190.512] (-1197.231) * (-1193.723) (-1191.101) [-1191.837] (-1192.342) -- 0:00:11
823000 -- (-1192.387) [-1191.180] (-1193.801) (-1190.783) * (-1191.958) (-1193.838) (-1190.873) [-1191.554] -- 0:00:10
823500 -- [-1193.578] (-1191.654) (-1190.048) (-1191.396) * (-1194.386) (-1190.246) (-1193.051) [-1190.413] -- 0:00:10
824000 -- (-1192.688) (-1193.732) [-1192.362] (-1192.633) * (-1193.644) (-1192.017) [-1191.834] (-1191.851) -- 0:00:10
824500 -- (-1192.274) [-1191.595] (-1191.433) (-1191.070) * (-1190.152) (-1195.614) (-1196.132) [-1190.253] -- 0:00:10
825000 -- (-1189.312) [-1192.326] (-1195.182) (-1189.371) * (-1189.809) (-1192.238) (-1194.989) [-1190.605] -- 0:00:10
Average standard deviation of split frequencies: 0.009322
825500 -- [-1191.426] (-1193.847) (-1193.004) (-1192.773) * [-1190.929] (-1189.814) (-1191.512) (-1194.669) -- 0:00:10
826000 -- (-1189.263) (-1193.571) [-1196.485] (-1192.527) * (-1193.670) (-1190.392) [-1193.444] (-1193.190) -- 0:00:10
826500 -- (-1189.308) (-1196.714) (-1193.495) [-1192.572] * [-1190.907] (-1193.759) (-1192.949) (-1192.498) -- 0:00:10
827000 -- (-1189.780) (-1195.472) (-1190.501) [-1191.070] * [-1191.262] (-1192.684) (-1190.301) (-1192.838) -- 0:00:10
827500 -- [-1190.391] (-1192.412) (-1193.023) (-1190.192) * (-1190.505) [-1191.452] (-1190.403) (-1192.590) -- 0:00:10
828000 -- (-1194.478) (-1192.091) (-1189.644) [-1192.882] * [-1190.531] (-1194.141) (-1193.948) (-1191.239) -- 0:00:10
828500 -- (-1195.885) (-1192.220) [-1189.531] (-1192.379) * (-1189.543) [-1190.972] (-1190.150) (-1194.144) -- 0:00:10
829000 -- [-1192.714] (-1190.173) (-1193.785) (-1191.351) * (-1192.325) [-1190.662] (-1190.791) (-1193.746) -- 0:00:10
829500 -- (-1191.953) (-1189.455) [-1191.160] (-1192.310) * (-1190.943) (-1189.590) (-1191.529) [-1192.888] -- 0:00:10
830000 -- (-1193.341) [-1188.986] (-1191.316) (-1190.530) * (-1189.910) (-1189.981) (-1191.707) [-1191.874] -- 0:00:10
Average standard deviation of split frequencies: 0.009610
830500 -- [-1194.124] (-1189.095) (-1192.721) (-1190.627) * (-1192.411) (-1191.194) [-1192.176] (-1192.797) -- 0:00:10
831000 -- (-1190.176) (-1191.115) [-1190.050] (-1190.644) * [-1190.397] (-1191.607) (-1190.257) (-1191.589) -- 0:00:10
831500 -- [-1190.266] (-1191.089) (-1192.572) (-1190.819) * (-1190.603) (-1191.071) (-1189.957) [-1190.702] -- 0:00:10
832000 -- (-1190.281) (-1192.132) (-1190.768) [-1191.907] * (-1189.536) (-1190.420) [-1191.014] (-1194.946) -- 0:00:10
832500 -- (-1196.240) [-1192.877] (-1190.946) (-1192.341) * (-1191.525) (-1191.178) [-1191.444] (-1194.442) -- 0:00:10
833000 -- (-1192.081) (-1190.792) [-1194.989] (-1192.848) * (-1189.636) (-1189.318) (-1192.501) [-1192.565] -- 0:00:10
833500 -- (-1191.097) [-1190.170] (-1197.542) (-1192.713) * [-1190.493] (-1192.312) (-1190.669) (-1193.920) -- 0:00:10
834000 -- (-1189.901) (-1190.738) (-1190.554) [-1192.490] * [-1191.304] (-1192.418) (-1190.491) (-1189.527) -- 0:00:10
834500 -- (-1192.266) [-1191.790] (-1194.089) (-1195.619) * (-1191.608) [-1189.256] (-1191.026) (-1191.059) -- 0:00:10
835000 -- (-1190.725) (-1192.889) [-1190.947] (-1190.449) * (-1192.103) (-1192.976) (-1190.505) [-1191.077] -- 0:00:10
Average standard deviation of split frequencies: 0.009699
835500 -- (-1191.293) (-1190.350) [-1190.147] (-1189.962) * [-1190.589] (-1191.118) (-1189.615) (-1191.277) -- 0:00:10
836000 -- (-1190.587) (-1189.603) [-1189.419] (-1192.297) * (-1189.741) (-1195.433) [-1190.972] (-1190.348) -- 0:00:10
836500 -- (-1191.334) (-1190.699) (-1189.226) [-1191.541] * (-1190.692) (-1197.357) (-1192.273) [-1190.119] -- 0:00:10
837000 -- (-1189.571) (-1191.449) (-1198.064) [-1191.702] * (-1190.862) (-1193.623) (-1190.681) [-1191.839] -- 0:00:10
837500 -- (-1189.394) (-1196.596) (-1193.303) [-1190.637] * (-1191.373) (-1189.609) (-1192.294) [-1190.850] -- 0:00:10
838000 -- (-1190.651) (-1192.800) (-1190.625) [-1190.385] * (-1190.076) (-1190.047) [-1194.190] (-1193.480) -- 0:00:10
838500 -- [-1192.661] (-1191.689) (-1189.866) (-1190.232) * (-1190.983) (-1190.070) [-1192.781] (-1198.210) -- 0:00:10
839000 -- (-1190.837) [-1191.080] (-1190.309) (-1190.266) * [-1190.087] (-1189.710) (-1190.091) (-1192.009) -- 0:00:09
839500 -- (-1191.899) (-1191.476) (-1191.546) [-1192.627] * (-1190.312) [-1192.164] (-1193.751) (-1190.806) -- 0:00:09
840000 -- (-1190.511) (-1191.341) (-1194.116) [-1189.785] * (-1191.324) [-1191.590] (-1192.576) (-1191.994) -- 0:00:09
Average standard deviation of split frequencies: 0.009570
840500 -- (-1190.908) [-1191.665] (-1191.602) (-1193.381) * (-1192.539) (-1191.035) (-1190.545) [-1190.775] -- 0:00:09
841000 -- (-1190.778) [-1189.145] (-1190.861) (-1193.694) * (-1190.508) [-1191.026] (-1192.131) (-1190.910) -- 0:00:09
841500 -- (-1189.911) (-1189.783) (-1190.597) [-1189.766] * [-1193.002] (-1193.460) (-1193.567) (-1193.624) -- 0:00:09
842000 -- (-1190.401) (-1189.493) [-1190.994] (-1193.675) * (-1190.570) (-1196.780) (-1194.242) [-1194.275] -- 0:00:09
842500 -- (-1192.162) (-1195.373) [-1192.917] (-1193.214) * (-1192.199) (-1190.400) [-1191.972] (-1192.821) -- 0:00:09
843000 -- [-1190.541] (-1190.141) (-1193.999) (-1192.044) * (-1192.476) [-1191.988] (-1189.500) (-1194.349) -- 0:00:09
843500 -- (-1189.839) [-1192.309] (-1195.746) (-1189.427) * (-1193.080) (-1190.365) [-1189.572] (-1191.859) -- 0:00:09
844000 -- (-1191.804) [-1190.783] (-1192.149) (-1190.290) * (-1189.380) [-1189.911] (-1193.373) (-1195.012) -- 0:00:09
844500 -- (-1190.610) (-1191.942) [-1191.876] (-1193.876) * (-1189.783) (-1191.231) (-1189.977) [-1193.964] -- 0:00:09
845000 -- (-1190.258) (-1189.426) (-1190.293) [-1189.927] * (-1191.245) (-1189.919) (-1191.840) [-1192.495] -- 0:00:09
Average standard deviation of split frequencies: 0.009621
845500 -- (-1190.855) (-1190.224) [-1190.614] (-1191.859) * [-1191.267] (-1189.389) (-1189.940) (-1195.589) -- 0:00:09
846000 -- (-1190.184) (-1192.130) (-1193.800) [-1191.320] * [-1189.997] (-1189.828) (-1189.563) (-1192.545) -- 0:00:09
846500 -- (-1189.394) (-1190.783) (-1193.000) [-1190.244] * (-1189.866) [-1189.739] (-1193.402) (-1190.439) -- 0:00:09
847000 -- [-1191.039] (-1190.211) (-1192.880) (-1194.566) * (-1194.366) (-1189.660) [-1190.056] (-1190.812) -- 0:00:09
847500 -- [-1192.031] (-1192.746) (-1189.395) (-1192.754) * (-1195.654) (-1190.024) (-1192.878) [-1190.983] -- 0:00:09
848000 -- (-1189.581) (-1194.184) (-1189.384) [-1193.369] * [-1190.880] (-1191.747) (-1191.729) (-1191.218) -- 0:00:09
848500 -- (-1189.991) (-1192.452) (-1189.813) [-1192.180] * (-1191.593) (-1191.761) [-1189.957] (-1189.409) -- 0:00:09
849000 -- (-1191.204) (-1191.432) [-1192.797] (-1191.369) * (-1191.985) (-1194.548) (-1192.061) [-1189.199] -- 0:00:09
849500 -- (-1190.513) (-1189.699) (-1196.479) [-1190.805] * (-1189.025) (-1190.465) (-1192.074) [-1191.340] -- 0:00:09
850000 -- (-1191.722) (-1191.008) [-1196.465] (-1189.956) * (-1190.712) [-1190.375] (-1194.546) (-1190.180) -- 0:00:09
Average standard deviation of split frequencies: 0.009347
850500 -- (-1190.317) [-1190.070] (-1193.203) (-1191.550) * [-1189.855] (-1190.831) (-1191.969) (-1189.047) -- 0:00:09
851000 -- (-1191.918) [-1194.007] (-1192.777) (-1190.748) * [-1191.310] (-1192.408) (-1191.623) (-1190.461) -- 0:00:09
851500 -- [-1191.265] (-1194.986) (-1189.849) (-1190.059) * (-1192.687) (-1190.497) [-1191.449] (-1190.430) -- 0:00:09
852000 -- (-1191.523) (-1192.872) [-1190.163] (-1193.372) * [-1189.253] (-1191.466) (-1191.460) (-1191.851) -- 0:00:09
852500 -- (-1194.205) (-1189.784) [-1193.296] (-1190.865) * [-1189.154] (-1191.618) (-1190.935) (-1192.099) -- 0:00:09
853000 -- [-1193.164] (-1189.970) (-1194.798) (-1191.941) * [-1189.019] (-1193.131) (-1193.969) (-1191.366) -- 0:00:09
853500 -- (-1190.818) (-1189.409) [-1189.855] (-1194.470) * (-1190.168) (-1190.387) (-1197.659) [-1192.996] -- 0:00:09
854000 -- (-1189.960) (-1198.083) [-1193.595] (-1190.077) * (-1193.155) [-1192.290] (-1193.767) (-1189.888) -- 0:00:09
854500 -- (-1191.587) (-1190.456) [-1191.460] (-1190.389) * [-1192.844] (-1192.858) (-1191.366) (-1191.120) -- 0:00:09
855000 -- (-1190.618) (-1190.825) [-1190.541] (-1193.211) * [-1191.033] (-1192.782) (-1192.558) (-1192.176) -- 0:00:08
Average standard deviation of split frequencies: 0.008995
855500 -- (-1192.882) (-1190.326) (-1191.804) [-1192.666] * (-1195.299) (-1194.304) (-1191.317) [-1191.302] -- 0:00:08
856000 -- (-1194.359) [-1192.916] (-1196.270) (-1196.092) * (-1196.279) [-1193.760] (-1192.310) (-1193.043) -- 0:00:08
856500 -- (-1193.025) (-1192.394) [-1192.032] (-1191.545) * [-1192.957] (-1190.407) (-1191.485) (-1192.203) -- 0:00:08
857000 -- [-1192.241] (-1191.422) (-1193.786) (-1191.939) * (-1193.628) (-1190.262) (-1190.989) [-1190.823] -- 0:00:08
857500 -- (-1190.120) [-1189.627] (-1194.447) (-1191.138) * (-1190.111) (-1192.268) [-1190.369] (-1191.015) -- 0:00:08
858000 -- (-1190.114) (-1190.809) [-1193.878] (-1192.685) * (-1190.280) (-1189.237) [-1189.826] (-1191.306) -- 0:00:08
858500 -- (-1189.443) (-1190.132) (-1199.163) [-1197.170] * (-1190.870) (-1190.814) (-1189.335) [-1193.282] -- 0:00:08
859000 -- [-1189.138] (-1189.331) (-1193.241) (-1198.303) * (-1191.453) (-1191.091) [-1190.729] (-1193.192) -- 0:00:08
859500 -- (-1190.390) (-1193.404) (-1194.025) [-1190.879] * (-1193.594) (-1191.894) [-1191.102] (-1191.546) -- 0:00:08
860000 -- [-1192.186] (-1190.338) (-1195.072) (-1190.643) * (-1190.417) (-1190.639) (-1191.569) [-1190.988] -- 0:00:08
Average standard deviation of split frequencies: 0.008873
860500 -- (-1190.897) [-1189.946] (-1189.833) (-1189.384) * (-1191.048) (-1191.285) [-1192.629] (-1190.416) -- 0:00:08
861000 -- (-1190.059) (-1192.738) [-1191.767] (-1190.195) * [-1189.796] (-1193.076) (-1190.753) (-1197.819) -- 0:00:08
861500 -- [-1191.668] (-1190.656) (-1190.576) (-1191.908) * (-1189.568) (-1194.901) [-1191.166] (-1191.158) -- 0:00:08
862000 -- (-1193.905) (-1192.005) (-1189.861) [-1189.178] * (-1190.437) [-1194.667] (-1190.270) (-1193.844) -- 0:00:08
862500 -- [-1191.426] (-1192.878) (-1189.453) (-1193.209) * (-1190.112) (-1192.498) (-1190.181) [-1191.465] -- 0:00:08
863000 -- [-1195.381] (-1191.731) (-1191.963) (-1191.320) * [-1191.043] (-1190.845) (-1190.475) (-1191.262) -- 0:00:08
863500 -- [-1192.820] (-1190.043) (-1193.300) (-1194.874) * (-1190.101) (-1190.047) [-1190.457] (-1191.284) -- 0:00:08
864000 -- [-1190.199] (-1189.148) (-1190.443) (-1190.345) * (-1190.383) (-1189.584) [-1193.826] (-1193.538) -- 0:00:08
864500 -- (-1190.337) (-1190.004) [-1190.788] (-1190.494) * (-1189.850) [-1191.066] (-1194.646) (-1193.067) -- 0:00:08
865000 -- (-1191.411) (-1192.766) [-1192.194] (-1191.960) * (-1193.500) (-1190.428) (-1192.806) [-1193.064] -- 0:00:08
Average standard deviation of split frequencies: 0.008855
865500 -- (-1190.315) (-1193.368) (-1189.253) [-1192.944] * (-1191.388) (-1189.706) [-1194.276] (-1191.125) -- 0:00:08
866000 -- [-1190.428] (-1189.779) (-1194.417) (-1192.218) * [-1190.038] (-1190.163) (-1190.352) (-1191.003) -- 0:00:08
866500 -- (-1190.653) (-1190.311) (-1194.935) [-1193.220] * (-1190.855) (-1190.650) (-1190.156) [-1189.581] -- 0:00:08
867000 -- (-1190.773) (-1191.554) [-1193.314] (-1190.565) * (-1191.992) (-1190.281) (-1190.683) [-1189.910] -- 0:00:08
867500 -- (-1190.633) (-1191.454) (-1200.273) [-1190.161] * (-1192.898) (-1190.045) (-1193.356) [-1191.507] -- 0:00:08
868000 -- [-1189.529] (-1190.542) (-1195.138) (-1193.537) * (-1192.131) [-1190.692] (-1195.311) (-1190.102) -- 0:00:08
868500 -- [-1190.248] (-1191.287) (-1191.516) (-1191.758) * (-1191.580) (-1192.984) [-1195.009] (-1192.204) -- 0:00:08
869000 -- [-1191.991] (-1190.517) (-1190.333) (-1190.061) * (-1192.622) (-1196.355) [-1191.698] (-1189.730) -- 0:00:08
869500 -- [-1192.826] (-1191.435) (-1193.010) (-1189.919) * [-1191.742] (-1193.741) (-1189.948) (-1189.257) -- 0:00:08
870000 -- [-1191.700] (-1193.116) (-1190.521) (-1189.942) * (-1190.730) (-1193.689) (-1191.832) [-1189.250] -- 0:00:08
Average standard deviation of split frequencies: 0.008627
870500 -- (-1193.658) (-1191.514) (-1189.615) [-1190.197] * [-1191.640] (-1191.473) (-1189.822) (-1191.098) -- 0:00:08
871000 -- (-1192.569) (-1189.624) [-1190.197] (-1193.737) * (-1195.223) [-1190.143] (-1194.513) (-1192.586) -- 0:00:07
871500 -- (-1192.292) (-1193.480) [-1190.459] (-1192.192) * [-1196.494] (-1189.935) (-1195.511) (-1190.048) -- 0:00:07
872000 -- (-1192.423) (-1190.327) [-1190.725] (-1192.368) * (-1191.751) (-1191.181) [-1194.492] (-1189.461) -- 0:00:07
872500 -- [-1191.630] (-1190.425) (-1191.388) (-1190.159) * (-1192.686) (-1192.024) [-1191.488] (-1189.564) -- 0:00:07
873000 -- (-1190.130) [-1192.103] (-1190.447) (-1191.328) * (-1190.106) (-1189.540) (-1193.009) [-1190.296] -- 0:00:07
873500 -- [-1190.329] (-1192.950) (-1195.339) (-1189.274) * (-1191.437) [-1189.595] (-1191.597) (-1190.894) -- 0:00:07
874000 -- (-1195.560) [-1190.242] (-1194.932) (-1193.509) * (-1194.124) (-1192.724) (-1192.228) [-1193.391] -- 0:00:07
874500 -- [-1194.144] (-1191.667) (-1189.814) (-1190.930) * (-1193.314) (-1189.984) (-1191.833) [-1193.014] -- 0:00:07
875000 -- (-1191.290) (-1191.356) [-1190.752] (-1191.056) * (-1189.844) (-1190.527) (-1193.581) [-1191.051] -- 0:00:07
Average standard deviation of split frequencies: 0.008395
875500 -- (-1191.395) (-1190.978) [-1190.266] (-1190.017) * (-1190.029) (-1196.514) (-1190.835) [-1191.139] -- 0:00:07
876000 -- (-1194.136) (-1191.320) (-1191.355) [-1190.494] * (-1194.158) [-1196.481] (-1191.738) (-1191.140) -- 0:00:07
876500 -- [-1191.138] (-1189.874) (-1193.734) (-1192.234) * (-1194.918) (-1191.330) (-1190.837) [-1190.758] -- 0:00:07
877000 -- (-1191.644) [-1190.906] (-1190.129) (-1191.529) * [-1191.879] (-1192.045) (-1190.379) (-1192.967) -- 0:00:07
877500 -- (-1191.768) [-1191.166] (-1189.969) (-1194.721) * (-1191.118) (-1191.555) (-1189.550) [-1190.579] -- 0:00:07
878000 -- (-1192.048) [-1189.534] (-1195.028) (-1191.048) * (-1191.962) (-1190.212) (-1190.265) [-1191.119] -- 0:00:07
878500 -- [-1192.086] (-1191.600) (-1190.421) (-1190.489) * [-1189.380] (-1191.692) (-1190.719) (-1194.663) -- 0:00:07
879000 -- (-1190.275) (-1193.300) (-1190.581) [-1190.165] * (-1189.026) [-1191.324] (-1190.987) (-1193.807) -- 0:00:07
879500 -- [-1190.537] (-1193.324) (-1190.659) (-1191.556) * (-1189.999) (-1197.919) [-1190.456] (-1194.661) -- 0:00:07
880000 -- [-1190.675] (-1192.345) (-1192.033) (-1191.125) * [-1189.800] (-1194.381) (-1190.669) (-1193.977) -- 0:00:07
Average standard deviation of split frequencies: 0.009064
880500 -- [-1192.544] (-1191.964) (-1191.869) (-1191.766) * (-1195.401) (-1192.522) (-1191.839) [-1191.607] -- 0:00:07
881000 -- (-1192.523) [-1190.883] (-1190.621) (-1192.022) * (-1192.749) (-1190.667) [-1189.692] (-1193.099) -- 0:00:07
881500 -- (-1192.811) (-1191.915) (-1191.162) [-1190.333] * (-1192.282) (-1194.478) (-1190.696) [-1190.991] -- 0:00:07
882000 -- (-1192.220) [-1189.935] (-1190.743) (-1190.514) * (-1191.764) (-1191.146) [-1192.362] (-1190.063) -- 0:00:07
882500 -- (-1192.514) (-1190.281) [-1190.120] (-1195.714) * (-1191.602) [-1190.165] (-1191.723) (-1193.744) -- 0:00:07
883000 -- (-1190.062) (-1192.131) (-1192.054) [-1192.093] * [-1192.037] (-1191.058) (-1190.954) (-1189.894) -- 0:00:07
883500 -- (-1190.230) (-1192.328) (-1193.553) [-1195.958] * (-1189.917) (-1191.943) (-1189.919) [-1189.675] -- 0:00:07
884000 -- (-1192.650) [-1192.202] (-1197.785) (-1197.167) * (-1191.004) (-1190.494) (-1189.279) [-1192.143] -- 0:00:07
884500 -- (-1192.048) [-1190.429] (-1193.114) (-1193.039) * (-1195.289) (-1192.777) [-1190.234] (-1190.748) -- 0:00:07
885000 -- [-1191.041] (-1191.770) (-1194.416) (-1189.990) * (-1190.349) (-1191.188) [-1189.839] (-1191.047) -- 0:00:07
Average standard deviation of split frequencies: 0.009151
885500 -- (-1189.330) (-1190.227) [-1191.133] (-1192.353) * (-1190.477) [-1195.228] (-1194.145) (-1189.630) -- 0:00:07
886000 -- (-1189.333) (-1189.191) [-1189.990] (-1192.589) * (-1190.672) [-1192.834] (-1195.735) (-1196.582) -- 0:00:07
886500 -- (-1189.388) [-1190.474] (-1190.016) (-1189.882) * [-1191.124] (-1191.869) (-1191.005) (-1192.019) -- 0:00:07
887000 -- [-1191.189] (-1189.914) (-1195.383) (-1189.902) * (-1192.689) [-1189.302] (-1190.469) (-1191.013) -- 0:00:07
887500 -- [-1191.409] (-1194.138) (-1191.799) (-1190.623) * (-1191.678) (-1191.550) (-1190.659) [-1191.243] -- 0:00:06
888000 -- (-1191.370) (-1193.788) (-1191.782) [-1192.000] * (-1191.893) (-1190.804) [-1189.547] (-1197.504) -- 0:00:06
888500 -- (-1193.794) (-1192.160) [-1194.390] (-1190.093) * (-1196.923) (-1191.404) [-1191.640] (-1191.941) -- 0:00:06
889000 -- [-1190.935] (-1194.941) (-1195.880) (-1189.940) * (-1194.632) (-1193.132) (-1190.157) [-1190.886] -- 0:00:06
889500 -- (-1191.977) (-1192.143) (-1192.282) [-1189.119] * (-1195.701) (-1191.429) [-1193.613] (-1190.695) -- 0:00:06
890000 -- (-1192.760) [-1191.407] (-1192.190) (-1191.269) * [-1191.835] (-1190.311) (-1193.142) (-1194.961) -- 0:00:06
Average standard deviation of split frequencies: 0.008927
890500 -- (-1191.047) (-1192.927) [-1191.788] (-1191.789) * (-1191.514) [-1189.948] (-1194.605) (-1190.384) -- 0:00:06
891000 -- (-1192.480) (-1189.919) (-1191.106) [-1191.496] * (-1196.463) (-1197.464) (-1189.710) [-1189.627] -- 0:00:06
891500 -- (-1190.660) (-1190.713) [-1190.473] (-1192.961) * [-1189.942] (-1190.853) (-1192.623) (-1189.342) -- 0:00:06
892000 -- (-1191.670) (-1190.713) (-1190.364) [-1190.665] * (-1191.565) (-1192.651) (-1190.400) [-1189.445] -- 0:00:06
892500 -- (-1192.143) (-1189.710) [-1192.859] (-1191.658) * (-1193.864) (-1190.204) [-1190.947] (-1189.671) -- 0:00:06
893000 -- [-1193.043] (-1191.266) (-1193.050) (-1191.228) * [-1191.965] (-1193.092) (-1191.909) (-1192.458) -- 0:00:06
893500 -- (-1194.593) (-1193.190) (-1193.143) [-1190.939] * (-1199.086) (-1191.319) (-1191.188) [-1189.866] -- 0:00:06
894000 -- (-1193.010) [-1192.612] (-1189.338) (-1189.883) * (-1190.457) (-1192.019) (-1190.352) [-1191.226] -- 0:00:06
894500 -- [-1194.176] (-1190.210) (-1190.414) (-1192.905) * (-1192.852) (-1189.425) [-1189.351] (-1190.820) -- 0:00:06
895000 -- (-1196.399) [-1190.275] (-1193.254) (-1193.237) * (-1191.429) (-1194.571) [-1191.232] (-1192.291) -- 0:00:06
Average standard deviation of split frequencies: 0.008979
895500 -- [-1196.465] (-1191.166) (-1190.213) (-1191.697) * (-1193.292) (-1194.784) (-1190.530) [-1192.585] -- 0:00:06
896000 -- (-1189.060) [-1190.339] (-1194.130) (-1196.084) * (-1190.090) (-1191.418) [-1190.695] (-1190.104) -- 0:00:06
896500 -- [-1189.007] (-1189.472) (-1191.611) (-1195.799) * (-1189.390) [-1189.428] (-1192.431) (-1192.570) -- 0:00:06
897000 -- [-1189.346] (-1190.922) (-1191.090) (-1194.665) * [-1190.571] (-1190.728) (-1189.740) (-1191.422) -- 0:00:06
897500 -- (-1189.874) (-1190.637) [-1190.157] (-1193.743) * (-1191.959) [-1191.130] (-1190.324) (-1193.166) -- 0:00:06
898000 -- (-1190.510) (-1189.822) (-1192.552) [-1192.419] * (-1193.578) (-1191.966) (-1190.625) [-1190.112] -- 0:00:06
898500 -- (-1192.911) [-1192.757] (-1190.382) (-1192.110) * [-1191.232] (-1192.084) (-1190.653) (-1191.352) -- 0:00:06
899000 -- (-1189.351) (-1194.395) (-1191.891) [-1192.156] * [-1190.075] (-1190.939) (-1192.426) (-1198.296) -- 0:00:06
899500 -- (-1189.571) (-1193.973) [-1191.813] (-1193.496) * (-1189.278) [-1191.486] (-1192.691) (-1192.819) -- 0:00:06
900000 -- (-1194.735) (-1192.565) (-1192.213) [-1196.467] * (-1191.794) (-1189.707) [-1192.776] (-1193.238) -- 0:00:06
Average standard deviation of split frequencies: 0.008968
900500 -- (-1197.603) (-1192.510) [-1193.660] (-1191.601) * [-1190.533] (-1191.266) (-1195.421) (-1193.348) -- 0:00:06
901000 -- [-1192.318] (-1190.807) (-1190.927) (-1190.677) * (-1192.651) (-1191.090) (-1193.590) [-1190.323] -- 0:00:06
901500 -- [-1190.675] (-1192.187) (-1191.110) (-1189.759) * (-1190.063) (-1189.348) [-1190.503] (-1191.505) -- 0:00:06
902000 -- (-1194.069) (-1193.127) [-1190.106] (-1189.940) * [-1189.702] (-1190.639) (-1191.917) (-1190.831) -- 0:00:06
902500 -- (-1191.983) (-1191.265) [-1189.702] (-1198.186) * [-1189.408] (-1190.364) (-1192.359) (-1191.864) -- 0:00:06
903000 -- (-1195.541) (-1191.169) [-1193.086] (-1194.001) * (-1190.800) (-1195.979) [-1191.058] (-1194.422) -- 0:00:06
903500 -- (-1191.821) [-1191.321] (-1192.470) (-1191.525) * (-1195.334) (-1191.149) [-1190.307] (-1191.816) -- 0:00:05
904000 -- [-1191.993] (-1190.557) (-1191.300) (-1190.429) * (-1191.326) [-1190.533] (-1192.088) (-1194.785) -- 0:00:05
904500 -- [-1190.031] (-1191.845) (-1192.712) (-1190.726) * (-1190.432) (-1189.498) (-1191.087) [-1192.852] -- 0:00:05
905000 -- (-1191.778) [-1191.071] (-1194.174) (-1192.919) * (-1189.382) [-1189.498] (-1191.074) (-1192.804) -- 0:00:05
Average standard deviation of split frequencies: 0.008845
905500 -- (-1191.713) [-1190.473] (-1194.965) (-1190.934) * (-1189.209) (-1189.890) (-1193.115) [-1192.324] -- 0:00:05
906000 -- (-1191.120) [-1190.219] (-1194.357) (-1189.804) * (-1190.187) (-1194.897) [-1190.890] (-1190.344) -- 0:00:05
906500 -- (-1191.466) [-1192.576] (-1197.235) (-1190.224) * (-1191.113) [-1190.373] (-1189.495) (-1189.657) -- 0:00:05
907000 -- [-1192.780] (-1190.991) (-1191.320) (-1189.683) * (-1190.936) (-1190.988) (-1190.779) [-1190.891] -- 0:00:05
907500 -- (-1192.527) (-1192.606) [-1189.391] (-1191.393) * (-1191.643) (-1190.883) (-1196.005) [-1190.928] -- 0:00:05
908000 -- (-1190.118) (-1192.453) (-1196.908) [-1189.818] * (-1190.402) (-1194.019) (-1193.243) [-1191.561] -- 0:00:05
908500 -- [-1190.797] (-1194.101) (-1193.693) (-1189.194) * (-1189.556) (-1196.588) [-1190.504] (-1189.679) -- 0:00:05
909000 -- (-1193.366) [-1191.553] (-1194.718) (-1192.135) * (-1190.279) (-1191.333) [-1191.097] (-1189.612) -- 0:00:05
909500 -- [-1192.420] (-1191.519) (-1193.932) (-1194.039) * [-1191.992] (-1190.008) (-1189.727) (-1189.612) -- 0:00:05
910000 -- (-1194.817) [-1191.568] (-1192.876) (-1196.216) * (-1191.475) (-1191.164) (-1191.058) [-1191.098] -- 0:00:05
Average standard deviation of split frequencies: 0.008904
910500 -- (-1193.125) (-1190.217) (-1192.448) [-1192.939] * (-1194.455) [-1190.018] (-1193.101) (-1190.904) -- 0:00:05
911000 -- (-1191.054) (-1191.916) [-1191.128] (-1193.803) * (-1190.793) [-1190.106] (-1190.319) (-1189.234) -- 0:00:05
911500 -- (-1194.043) [-1191.299] (-1191.123) (-1195.027) * (-1190.984) (-1190.727) (-1191.424) [-1191.292] -- 0:00:05
912000 -- (-1192.902) [-1189.987] (-1191.812) (-1194.444) * [-1190.061] (-1192.405) (-1190.661) (-1189.518) -- 0:00:05
912500 -- (-1196.720) (-1191.625) (-1190.727) [-1190.598] * (-1190.570) [-1191.329] (-1190.652) (-1192.727) -- 0:00:05
913000 -- (-1190.586) [-1192.684] (-1189.587) (-1189.367) * (-1190.255) [-1190.433] (-1190.057) (-1191.738) -- 0:00:05
913500 -- (-1191.974) (-1191.472) (-1192.782) [-1191.804] * (-1190.938) (-1192.282) (-1190.786) [-1191.613] -- 0:00:05
914000 -- [-1190.207] (-1191.874) (-1191.468) (-1190.778) * (-1191.053) [-1190.653] (-1192.839) (-1194.761) -- 0:00:05
914500 -- (-1194.052) (-1197.482) [-1189.208] (-1189.956) * (-1191.394) [-1189.285] (-1192.572) (-1190.597) -- 0:00:05
915000 -- (-1194.248) (-1192.090) [-1189.770] (-1190.143) * (-1191.063) [-1190.877] (-1192.792) (-1190.998) -- 0:00:05
Average standard deviation of split frequencies: 0.008989
915500 -- (-1194.243) (-1191.877) (-1190.083) [-1191.458] * (-1190.464) [-1190.216] (-1191.501) (-1194.120) -- 0:00:05
916000 -- (-1194.929) [-1191.505] (-1194.944) (-1194.537) * (-1193.309) (-1192.903) (-1192.241) [-1190.945] -- 0:00:05
916500 -- (-1189.838) (-1191.768) [-1191.324] (-1194.819) * (-1192.117) [-1191.087] (-1191.740) (-1191.403) -- 0:00:05
917000 -- (-1192.216) [-1193.131] (-1190.401) (-1190.964) * [-1191.073] (-1192.948) (-1191.982) (-1193.770) -- 0:00:05
917500 -- (-1192.321) (-1191.166) (-1192.160) [-1192.799] * (-1189.553) (-1191.408) (-1191.634) [-1199.065] -- 0:00:05
918000 -- (-1195.520) (-1193.574) [-1189.811] (-1193.756) * (-1189.183) (-1192.070) (-1194.334) [-1192.655] -- 0:00:05
918500 -- (-1192.145) (-1195.670) (-1193.935) [-1189.746] * (-1192.109) [-1190.398] (-1189.830) (-1192.130) -- 0:00:05
919000 -- (-1192.804) (-1191.768) (-1190.970) [-1189.915] * (-1194.128) [-1194.983] (-1192.483) (-1192.732) -- 0:00:05
919500 -- (-1190.762) [-1193.824] (-1190.156) (-1191.050) * (-1190.934) (-1192.097) (-1192.906) [-1191.137] -- 0:00:04
920000 -- (-1189.602) (-1189.642) (-1196.567) [-1189.388] * (-1191.249) (-1191.805) [-1192.762] (-1191.588) -- 0:00:04
Average standard deviation of split frequencies: 0.009319
920500 -- (-1192.923) (-1190.977) (-1194.621) [-1191.695] * [-1189.653] (-1191.406) (-1192.848) (-1191.123) -- 0:00:04
921000 -- (-1192.775) (-1193.723) (-1193.262) [-1190.890] * (-1195.928) (-1191.665) (-1190.190) [-1192.023] -- 0:00:04
921500 -- (-1190.126) (-1191.276) (-1191.015) [-1191.469] * [-1190.590] (-1196.283) (-1190.571) (-1190.285) -- 0:00:04
922000 -- (-1191.664) (-1190.695) [-1190.788] (-1190.442) * (-1190.148) (-1192.163) [-1190.462] (-1193.195) -- 0:00:04
922500 -- (-1191.541) (-1193.697) [-1190.090] (-1189.189) * [-1190.069] (-1190.824) (-1191.606) (-1191.225) -- 0:00:04
923000 -- [-1193.947] (-1190.618) (-1189.906) (-1189.212) * (-1191.293) [-1192.826] (-1191.981) (-1191.684) -- 0:00:04
923500 -- (-1193.906) [-1190.273] (-1189.565) (-1191.258) * [-1190.838] (-1193.887) (-1191.517) (-1192.825) -- 0:00:04
924000 -- (-1195.580) [-1190.465] (-1193.169) (-1196.384) * (-1191.078) (-1191.070) (-1191.118) [-1191.918] -- 0:00:04
924500 -- (-1194.754) [-1191.135] (-1191.563) (-1190.462) * (-1194.681) (-1195.318) [-1190.443] (-1194.664) -- 0:00:04
925000 -- (-1193.762) [-1191.599] (-1192.237) (-1190.222) * (-1195.254) (-1189.412) (-1191.322) [-1193.560] -- 0:00:04
Average standard deviation of split frequencies: 0.008485
925500 -- (-1193.871) (-1190.987) [-1193.995] (-1190.613) * (-1193.583) (-1189.124) [-1189.244] (-1194.581) -- 0:00:04
926000 -- (-1196.020) (-1192.765) (-1191.236) [-1191.241] * (-1192.392) (-1191.432) (-1191.319) [-1190.040] -- 0:00:04
926500 -- (-1192.376) (-1193.519) [-1193.500] (-1192.899) * (-1190.966) (-1189.954) [-1190.296] (-1189.653) -- 0:00:04
927000 -- [-1190.848] (-1193.347) (-1190.995) (-1191.723) * (-1190.386) (-1194.977) (-1195.858) [-1189.856] -- 0:00:04
927500 -- (-1190.250) [-1193.174] (-1191.566) (-1190.738) * [-1191.710] (-1193.624) (-1191.151) (-1190.868) -- 0:00:04
928000 -- (-1190.879) (-1192.778) [-1190.254] (-1193.318) * (-1192.539) (-1194.535) (-1190.997) [-1190.955] -- 0:00:04
928500 -- (-1190.947) [-1190.305] (-1192.713) (-1190.352) * [-1192.642] (-1192.245) (-1189.753) (-1191.530) -- 0:00:04
929000 -- [-1191.379] (-1196.166) (-1191.894) (-1191.639) * [-1190.289] (-1191.151) (-1191.121) (-1192.535) -- 0:00:04
929500 -- [-1190.308] (-1191.591) (-1192.152) (-1193.565) * (-1190.892) [-1190.419] (-1193.527) (-1192.928) -- 0:00:04
930000 -- [-1192.378] (-1191.787) (-1190.283) (-1192.900) * [-1192.188] (-1191.127) (-1191.025) (-1194.692) -- 0:00:04
Average standard deviation of split frequencies: 0.008510
930500 -- (-1191.911) (-1191.247) (-1190.216) [-1190.562] * (-1193.517) (-1189.969) [-1190.952] (-1190.938) -- 0:00:04
931000 -- [-1192.490] (-1193.428) (-1190.381) (-1191.622) * (-1191.187) [-1189.835] (-1191.784) (-1192.326) -- 0:00:04
931500 -- (-1192.378) (-1192.738) (-1191.302) [-1189.846] * [-1191.269] (-1189.547) (-1192.033) (-1189.722) -- 0:00:04
932000 -- (-1192.833) (-1193.515) (-1193.368) [-1192.492] * (-1192.370) (-1190.187) (-1191.763) [-1192.631] -- 0:00:04
932500 -- [-1194.079] (-1189.513) (-1196.167) (-1189.999) * (-1191.870) [-1190.534] (-1191.221) (-1193.681) -- 0:00:04
933000 -- (-1192.739) [-1189.825] (-1193.304) (-1189.409) * (-1190.296) (-1192.176) (-1191.042) [-1192.876] -- 0:00:04
933500 -- [-1192.987] (-1189.905) (-1192.250) (-1189.247) * (-1196.146) (-1194.112) (-1189.687) [-1191.269] -- 0:00:04
934000 -- (-1192.803) [-1190.304] (-1195.060) (-1190.555) * (-1191.683) [-1195.355] (-1190.117) (-1190.650) -- 0:00:04
934500 -- (-1190.530) (-1191.283) (-1197.574) [-1191.065] * (-1189.171) (-1190.907) (-1190.975) [-1193.659] -- 0:00:04
935000 -- (-1189.295) (-1191.465) (-1191.251) [-1192.285] * (-1189.305) (-1192.751) (-1191.674) [-1194.635] -- 0:00:04
Average standard deviation of split frequencies: 0.008260
935500 -- [-1189.154] (-1190.881) (-1191.488) (-1195.104) * (-1189.570) (-1191.660) [-1190.710] (-1196.876) -- 0:00:03
936000 -- (-1192.231) (-1189.247) [-1192.418] (-1196.118) * [-1189.765] (-1195.195) (-1189.544) (-1192.798) -- 0:00:03
936500 -- (-1190.878) (-1189.239) (-1194.766) [-1193.013] * (-1189.255) (-1190.809) [-1189.586] (-1195.583) -- 0:00:03
937000 -- [-1189.920] (-1191.764) (-1193.658) (-1193.839) * [-1190.189] (-1191.619) (-1189.469) (-1190.852) -- 0:00:03
937500 -- (-1189.958) [-1190.977] (-1196.340) (-1192.945) * (-1194.360) [-1191.958] (-1189.567) (-1189.327) -- 0:00:03
938000 -- (-1189.950) (-1191.272) [-1194.294] (-1192.892) * (-1193.232) (-1192.198) (-1192.092) [-1193.804] -- 0:00:03
938500 -- (-1192.225) (-1194.800) [-1195.285] (-1190.371) * [-1192.350] (-1192.923) (-1193.466) (-1191.378) -- 0:00:03
939000 -- (-1190.774) (-1191.134) (-1192.687) [-1192.393] * [-1190.532] (-1191.027) (-1194.441) (-1190.719) -- 0:00:03
939500 -- (-1191.404) [-1193.301] (-1194.769) (-1191.691) * (-1193.348) [-1191.323] (-1191.733) (-1191.261) -- 0:00:03
940000 -- (-1189.999) (-1193.365) [-1189.125] (-1190.372) * [-1193.315] (-1191.071) (-1189.416) (-1191.371) -- 0:00:03
Average standard deviation of split frequencies: 0.008018
940500 -- (-1190.141) (-1191.480) (-1198.853) [-1191.070] * (-1193.312) [-1190.400] (-1191.741) (-1190.671) -- 0:00:03
941000 -- [-1189.685] (-1194.313) (-1193.206) (-1192.534) * (-1190.637) [-1190.197] (-1191.192) (-1190.188) -- 0:00:03
941500 -- (-1191.592) (-1190.556) [-1190.479] (-1192.154) * [-1194.513] (-1189.536) (-1192.163) (-1190.234) -- 0:00:03
942000 -- (-1192.206) (-1191.495) [-1193.497] (-1194.079) * (-1192.162) (-1190.968) [-1190.889] (-1191.512) -- 0:00:03
942500 -- [-1189.099] (-1191.561) (-1191.576) (-1193.494) * (-1194.214) (-1192.531) (-1191.253) [-1189.987] -- 0:00:03
943000 -- (-1189.424) (-1191.513) (-1191.971) [-1190.118] * (-1192.358) (-1191.602) [-1189.819] (-1190.521) -- 0:00:03
943500 -- (-1192.460) (-1190.683) (-1192.974) [-1189.444] * (-1192.834) (-1190.755) [-1191.988] (-1191.133) -- 0:00:03
944000 -- [-1191.436] (-1189.755) (-1191.091) (-1191.699) * [-1190.053] (-1190.788) (-1192.936) (-1191.469) -- 0:00:03
944500 -- (-1190.881) (-1190.459) (-1190.254) [-1193.037] * [-1192.001] (-1193.367) (-1192.134) (-1191.135) -- 0:00:03
945000 -- (-1190.571) (-1190.022) (-1190.312) [-1191.581] * (-1189.996) (-1191.400) [-1191.905] (-1193.107) -- 0:00:03
Average standard deviation of split frequencies: 0.008565
945500 -- (-1194.988) (-1189.651) [-1191.374] (-1190.595) * (-1190.241) [-1191.435] (-1191.681) (-1192.151) -- 0:00:03
946000 -- (-1193.120) [-1190.474] (-1191.166) (-1191.401) * (-1192.508) (-1193.200) [-1192.808] (-1198.541) -- 0:00:03
946500 -- [-1190.959] (-1190.232) (-1189.918) (-1192.244) * (-1191.333) (-1196.358) (-1190.227) [-1195.742] -- 0:00:03
947000 -- (-1190.299) [-1189.956] (-1190.215) (-1190.051) * [-1191.350] (-1192.695) (-1191.666) (-1193.890) -- 0:00:03
947500 -- (-1191.284) [-1193.969] (-1190.657) (-1189.905) * [-1189.565] (-1189.613) (-1191.584) (-1189.861) -- 0:00:03
948000 -- (-1193.917) (-1190.698) (-1191.806) [-1189.905] * (-1190.221) [-1190.542] (-1191.000) (-1189.518) -- 0:00:03
948500 -- [-1194.592] (-1191.071) (-1197.007) (-1192.965) * (-1196.540) (-1195.871) [-1191.237] (-1191.625) -- 0:00:03
949000 -- (-1189.989) (-1189.936) (-1193.182) [-1194.771] * (-1192.720) (-1189.724) [-1193.026] (-1190.322) -- 0:00:03
949500 -- (-1190.181) [-1191.741] (-1192.259) (-1192.888) * (-1192.088) [-1189.846] (-1190.749) (-1190.031) -- 0:00:03
950000 -- [-1190.474] (-1192.338) (-1192.588) (-1189.107) * (-1191.697) (-1192.519) (-1192.261) [-1190.148] -- 0:00:03
Average standard deviation of split frequencies: 0.008461
950500 -- [-1189.634] (-1191.516) (-1191.833) (-1192.158) * (-1195.056) (-1197.362) (-1190.745) [-1192.558] -- 0:00:03
951000 -- (-1192.117) [-1190.581] (-1193.047) (-1191.023) * [-1195.634] (-1191.419) (-1192.254) (-1190.915) -- 0:00:03
951500 -- (-1189.733) (-1193.035) [-1189.353] (-1191.823) * [-1192.892] (-1191.824) (-1190.140) (-1191.978) -- 0:00:03
952000 -- [-1189.420] (-1193.554) (-1192.176) (-1190.871) * [-1190.543] (-1190.735) (-1189.422) (-1190.162) -- 0:00:02
952500 -- [-1190.004] (-1198.389) (-1190.556) (-1192.163) * [-1192.601] (-1190.554) (-1194.860) (-1193.219) -- 0:00:02
953000 -- (-1192.690) [-1192.838] (-1189.708) (-1192.002) * [-1192.256] (-1191.839) (-1190.809) (-1193.388) -- 0:00:02
953500 -- (-1192.227) [-1193.845] (-1189.515) (-1195.333) * [-1189.848] (-1192.990) (-1191.456) (-1191.941) -- 0:00:02
954000 -- (-1191.868) [-1190.039] (-1190.636) (-1194.836) * (-1193.462) (-1195.536) (-1193.759) [-1190.969] -- 0:00:02
954500 -- (-1190.682) (-1194.526) (-1190.963) [-1190.476] * [-1190.826] (-1193.649) (-1191.723) (-1192.579) -- 0:00:02
955000 -- (-1191.273) (-1191.956) [-1190.734] (-1192.590) * (-1189.911) [-1189.247] (-1189.738) (-1196.313) -- 0:00:02
Average standard deviation of split frequencies: 0.008290
955500 -- (-1190.610) (-1191.468) (-1194.345) [-1189.690] * [-1190.439] (-1193.444) (-1194.565) (-1190.323) -- 0:00:02
956000 -- (-1194.271) (-1190.581) [-1190.788] (-1190.795) * (-1192.011) (-1192.105) [-1190.928] (-1189.455) -- 0:00:02
956500 -- (-1189.904) (-1192.366) (-1191.104) [-1190.342] * [-1193.726] (-1192.586) (-1194.590) (-1190.618) -- 0:00:02
957000 -- (-1190.234) [-1191.630] (-1192.603) (-1192.436) * (-1192.493) [-1192.522] (-1198.809) (-1191.737) -- 0:00:02
957500 -- (-1189.545) (-1193.873) [-1192.249] (-1193.636) * (-1191.890) (-1191.726) [-1191.591] (-1191.082) -- 0:00:02
958000 -- (-1189.926) (-1196.937) [-1192.545] (-1191.615) * (-1189.949) (-1189.974) (-1191.597) [-1190.289] -- 0:00:02
958500 -- [-1189.964] (-1189.649) (-1190.033) (-1193.996) * (-1189.695) (-1193.242) [-1189.384] (-1191.898) -- 0:00:02
959000 -- (-1192.844) (-1196.718) (-1193.696) [-1194.242] * (-1191.426) (-1191.552) [-1190.180] (-1191.867) -- 0:00:02
959500 -- (-1194.070) (-1194.140) (-1191.958) [-1190.608] * (-1189.680) [-1191.017] (-1192.011) (-1194.388) -- 0:00:02
960000 -- [-1191.395] (-1191.510) (-1191.167) (-1190.156) * (-1190.240) (-1191.579) [-1195.593] (-1190.890) -- 0:00:02
Average standard deviation of split frequencies: 0.008373
960500 -- [-1191.350] (-1191.979) (-1192.255) (-1190.239) * (-1189.477) (-1189.763) [-1189.746] (-1192.788) -- 0:00:02
961000 -- [-1190.750] (-1195.361) (-1192.842) (-1190.979) * [-1189.475] (-1194.218) (-1189.248) (-1197.414) -- 0:00:02
961500 -- (-1191.697) (-1190.180) (-1191.825) [-1191.566] * (-1192.367) (-1190.085) [-1191.731] (-1194.526) -- 0:00:02
962000 -- (-1190.776) (-1190.503) (-1193.343) [-1189.807] * [-1191.004] (-1195.466) (-1191.574) (-1195.831) -- 0:00:02
962500 -- (-1190.831) [-1190.825] (-1191.695) (-1190.163) * [-1189.616] (-1192.669) (-1193.928) (-1189.881) -- 0:00:02
963000 -- (-1191.582) (-1190.096) [-1191.773] (-1189.870) * [-1189.257] (-1193.118) (-1192.915) (-1190.967) -- 0:00:02
963500 -- [-1191.116] (-1192.093) (-1194.187) (-1191.731) * (-1189.577) (-1192.739) (-1190.721) [-1191.028] -- 0:00:02
964000 -- (-1191.915) [-1192.835] (-1197.334) (-1190.823) * (-1195.066) [-1191.173] (-1192.003) (-1191.352) -- 0:00:02
964500 -- (-1194.180) (-1191.931) (-1194.976) [-1190.438] * (-1189.488) [-1192.007] (-1190.533) (-1191.342) -- 0:00:02
965000 -- (-1192.348) [-1190.655] (-1191.101) (-1191.985) * (-1191.028) [-1193.344] (-1189.374) (-1190.359) -- 0:00:02
Average standard deviation of split frequencies: 0.008509
965500 -- (-1192.455) [-1193.317] (-1189.973) (-1189.900) * [-1190.756] (-1195.038) (-1189.422) (-1192.253) -- 0:00:02
966000 -- (-1189.838) (-1192.321) (-1190.433) [-1191.686] * (-1193.511) [-1192.976] (-1193.055) (-1189.638) -- 0:00:02
966500 -- (-1190.561) (-1192.528) (-1190.548) [-1192.724] * (-1193.850) [-1192.739] (-1193.062) (-1191.615) -- 0:00:02
967000 -- [-1191.744] (-1191.838) (-1193.744) (-1191.662) * (-1193.967) [-1191.891] (-1193.667) (-1190.904) -- 0:00:02
967500 -- (-1191.244) (-1190.476) (-1192.537) [-1192.983] * (-1192.822) (-1190.668) [-1189.933] (-1191.673) -- 0:00:02
968000 -- [-1189.875] (-1190.485) (-1191.549) (-1189.727) * (-1191.712) (-1190.112) [-1189.631] (-1189.540) -- 0:00:01
968500 -- (-1193.867) [-1193.016] (-1191.587) (-1192.166) * (-1192.776) (-1194.600) (-1189.936) [-1191.197] -- 0:00:01
969000 -- (-1194.841) [-1192.800] (-1191.449) (-1191.424) * [-1191.871] (-1192.347) (-1191.806) (-1189.739) -- 0:00:01
969500 -- [-1195.783] (-1192.377) (-1192.664) (-1193.720) * (-1192.755) (-1191.896) (-1191.744) [-1190.333] -- 0:00:01
970000 -- (-1193.086) [-1192.062] (-1191.296) (-1191.952) * (-1189.426) (-1191.650) [-1192.974] (-1191.524) -- 0:00:01
Average standard deviation of split frequencies: 0.008529
970500 -- (-1196.039) (-1190.941) (-1193.420) [-1192.985] * (-1190.236) [-1190.379] (-1191.124) (-1192.907) -- 0:00:01
971000 -- [-1190.411] (-1190.889) (-1191.332) (-1191.809) * (-1191.060) (-1192.075) [-1191.490] (-1192.748) -- 0:00:01
971500 -- (-1192.036) [-1194.646] (-1192.199) (-1193.332) * (-1193.258) (-1192.900) [-1190.999] (-1192.591) -- 0:00:01
972000 -- (-1193.501) [-1191.302] (-1193.659) (-1192.428) * (-1191.758) (-1193.178) (-1191.791) [-1194.972] -- 0:00:01
972500 -- [-1191.837] (-1191.616) (-1193.588) (-1192.242) * (-1189.292) [-1189.495] (-1192.122) (-1195.144) -- 0:00:01
973000 -- (-1192.751) (-1190.455) [-1192.079] (-1192.138) * (-1192.276) (-1191.684) [-1189.367] (-1194.210) -- 0:00:01
973500 -- (-1190.607) (-1191.978) (-1189.767) [-1192.259] * (-1191.830) (-1192.402) [-1190.668] (-1191.740) -- 0:00:01
974000 -- (-1192.346) (-1192.870) [-1190.366] (-1191.592) * (-1189.978) (-1190.075) [-1192.613] (-1193.343) -- 0:00:01
974500 -- (-1193.519) (-1193.463) [-1189.887] (-1193.739) * [-1190.900] (-1191.558) (-1191.448) (-1191.523) -- 0:00:01
975000 -- (-1192.176) (-1192.434) [-1191.293] (-1190.016) * [-1190.169] (-1189.709) (-1190.836) (-1191.608) -- 0:00:01
Average standard deviation of split frequencies: 0.008543
975500 -- [-1191.239] (-1196.043) (-1191.326) (-1189.825) * (-1189.178) [-1189.485] (-1190.249) (-1190.352) -- 0:00:01
976000 -- (-1192.560) [-1191.591] (-1191.049) (-1191.243) * (-1190.137) (-1189.348) [-1192.420] (-1191.619) -- 0:00:01
976500 -- (-1191.387) [-1192.478] (-1189.946) (-1192.983) * [-1192.374] (-1195.792) (-1191.183) (-1196.743) -- 0:00:01
977000 -- (-1192.108) (-1190.308) [-1190.625] (-1192.321) * (-1192.018) (-1196.029) [-1190.470] (-1189.473) -- 0:00:01
977500 -- (-1190.788) (-1191.010) [-1193.407] (-1190.448) * [-1191.993] (-1191.941) (-1194.775) (-1190.404) -- 0:00:01
978000 -- (-1189.653) [-1189.179] (-1192.197) (-1190.412) * (-1192.835) (-1191.105) [-1190.028] (-1192.923) -- 0:00:01
978500 -- (-1191.937) (-1189.179) (-1192.002) [-1191.465] * [-1191.015] (-1194.526) (-1191.387) (-1193.541) -- 0:00:01
979000 -- (-1191.472) (-1191.510) (-1191.583) [-1190.664] * (-1190.347) (-1191.850) [-1190.552] (-1190.472) -- 0:00:01
979500 -- (-1190.564) (-1193.061) [-1192.104] (-1193.293) * (-1191.930) (-1190.813) (-1191.324) [-1191.571] -- 0:00:01
980000 -- (-1189.808) [-1189.655] (-1193.545) (-1197.204) * (-1193.273) (-1190.779) [-1189.821] (-1193.936) -- 0:00:01
Average standard deviation of split frequencies: 0.007851
980500 -- (-1190.629) [-1194.116] (-1191.621) (-1193.280) * [-1194.736] (-1194.507) (-1190.264) (-1191.870) -- 0:00:01
981000 -- (-1193.656) [-1190.968] (-1194.914) (-1193.738) * [-1191.180] (-1190.735) (-1193.528) (-1193.467) -- 0:00:01
981500 -- [-1190.452] (-1189.961) (-1191.245) (-1195.037) * [-1192.849] (-1192.613) (-1191.271) (-1191.853) -- 0:00:01
982000 -- (-1199.762) [-1191.069] (-1194.002) (-1194.852) * (-1190.751) [-1190.868] (-1190.491) (-1191.583) -- 0:00:01
982500 -- [-1193.698] (-1192.272) (-1191.597) (-1191.109) * (-1192.071) (-1190.659) (-1190.616) [-1189.794] -- 0:00:01
983000 -- (-1195.714) [-1189.994] (-1190.265) (-1195.788) * (-1191.537) (-1192.007) (-1190.634) [-1189.758] -- 0:00:01
983500 -- [-1193.989] (-1195.948) (-1191.110) (-1194.299) * (-1191.408) (-1192.909) [-1189.791] (-1192.292) -- 0:00:01
984000 -- [-1190.915] (-1197.201) (-1191.140) (-1193.388) * (-1190.606) (-1192.209) (-1192.260) [-1190.296] -- 0:00:00
984500 -- [-1190.693] (-1189.345) (-1189.756) (-1189.250) * (-1193.019) (-1190.544) (-1190.931) [-1189.648] -- 0:00:00
985000 -- (-1190.689) (-1193.338) (-1190.938) [-1195.265] * (-1192.925) (-1190.972) (-1189.480) [-1192.671] -- 0:00:00
Average standard deviation of split frequencies: 0.008187
985500 -- [-1191.321] (-1193.493) (-1190.224) (-1195.168) * (-1192.157) (-1191.916) [-1189.993] (-1197.880) -- 0:00:00
986000 -- [-1193.061] (-1190.091) (-1192.573) (-1193.615) * (-1192.653) (-1191.157) [-1189.615] (-1192.010) -- 0:00:00
986500 -- [-1192.374] (-1191.284) (-1192.235) (-1194.007) * (-1190.340) (-1192.350) [-1189.756] (-1191.583) -- 0:00:00
987000 -- (-1194.549) [-1191.333] (-1190.757) (-1192.188) * (-1190.920) (-1190.028) [-1192.888] (-1192.297) -- 0:00:00
987500 -- (-1190.451) (-1191.331) (-1191.802) [-1192.217] * (-1192.484) (-1189.584) [-1190.838] (-1191.033) -- 0:00:00
988000 -- (-1192.361) (-1190.712) (-1191.162) [-1189.761] * (-1191.879) [-1191.018] (-1192.992) (-1192.758) -- 0:00:00
988500 -- [-1192.433] (-1194.895) (-1191.353) (-1190.495) * (-1191.609) (-1191.579) (-1192.152) [-1190.310] -- 0:00:00
989000 -- [-1193.652] (-1191.637) (-1189.975) (-1191.638) * (-1191.348) (-1189.876) [-1193.764] (-1191.955) -- 0:00:00
989500 -- (-1193.846) (-1190.814) (-1191.586) [-1191.986] * (-1189.514) (-1190.743) [-1190.800] (-1191.155) -- 0:00:00
990000 -- (-1197.509) (-1189.133) [-1192.280] (-1190.095) * [-1193.117] (-1196.971) (-1190.778) (-1191.262) -- 0:00:00
Average standard deviation of split frequencies: 0.007962
990500 -- (-1191.099) (-1189.947) (-1194.958) [-1191.660] * (-1193.794) [-1198.611] (-1191.852) (-1191.693) -- 0:00:00
991000 -- (-1190.179) (-1190.072) [-1191.717] (-1190.858) * [-1194.747] (-1193.405) (-1193.214) (-1192.042) -- 0:00:00
991500 -- (-1192.940) [-1191.118] (-1190.770) (-1194.264) * (-1193.710) (-1192.272) (-1192.347) [-1190.485] -- 0:00:00
992000 -- (-1194.289) (-1190.646) [-1192.085] (-1190.075) * (-1195.295) (-1191.184) (-1191.255) [-1191.089] -- 0:00:00
992500 -- [-1190.666] (-1192.827) (-1192.198) (-1190.553) * (-1193.604) (-1192.263) [-1192.016] (-1189.938) -- 0:00:00
993000 -- (-1191.940) (-1193.337) [-1189.114] (-1191.815) * (-1191.962) (-1192.536) [-1189.595] (-1191.098) -- 0:00:00
993500 -- (-1190.384) (-1193.366) [-1191.479] (-1191.905) * (-1192.372) [-1192.277] (-1189.951) (-1192.746) -- 0:00:00
994000 -- (-1190.360) [-1189.717] (-1189.620) (-1192.474) * (-1190.876) [-1192.453] (-1190.808) (-1190.055) -- 0:00:00
994500 -- (-1196.384) (-1190.878) [-1190.359] (-1191.123) * (-1190.292) [-1191.086] (-1198.285) (-1189.422) -- 0:00:00
995000 -- [-1192.084] (-1194.801) (-1189.297) (-1191.440) * [-1191.334] (-1193.073) (-1194.458) (-1190.467) -- 0:00:00
Average standard deviation of split frequencies: 0.007857
995500 -- (-1193.745) (-1193.381) (-1192.477) [-1191.437] * (-1191.936) (-1191.311) (-1193.361) [-1192.034] -- 0:00:00
996000 -- (-1192.051) [-1189.646] (-1191.875) (-1195.591) * (-1190.085) (-1192.811) [-1191.036] (-1193.333) -- 0:00:00
996500 -- (-1193.784) (-1191.237) [-1192.146] (-1192.478) * [-1191.235] (-1195.344) (-1192.081) (-1194.647) -- 0:00:00
997000 -- (-1192.262) [-1190.202] (-1190.641) (-1191.466) * (-1190.316) (-1193.865) [-1190.129] (-1192.893) -- 0:00:00
997500 -- (-1190.280) (-1189.928) [-1192.596] (-1189.588) * (-1190.461) (-1191.798) (-1193.145) [-1189.966] -- 0:00:00
998000 -- (-1193.206) (-1190.187) (-1190.144) [-1194.398] * (-1191.583) (-1190.732) (-1190.328) [-1190.239] -- 0:00:00
998500 -- (-1191.651) (-1193.419) (-1190.460) [-1194.040] * (-1190.281) (-1191.094) (-1190.543) [-1191.627] -- 0:00:00
999000 -- [-1189.800] (-1192.052) (-1189.877) (-1194.213) * (-1190.455) [-1189.645] (-1191.612) (-1191.313) -- 0:00:00
999500 -- (-1189.358) (-1192.195) [-1190.577] (-1191.797) * [-1190.845] (-1189.778) (-1191.637) (-1195.156) -- 0:00:00
1000000 -- (-1189.323) (-1192.986) (-1197.940) [-1192.778] * [-1192.514] (-1191.451) (-1190.010) (-1192.048) -- 0:00:00
Average standard deviation of split frequencies: 0.007977
Analysis completed in 1 mins 2 seconds
Analysis used 61.35 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1188.95
Likelihood of best state for "cold" chain of run 2 was -1188.95
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 61 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.1 % ( 28 %) Dirichlet(Pi{all})
28.5 % ( 30 %) Slider(Pi{all})
78.3 % ( 52 %) Multiplier(Alpha{1,2})
78.4 % ( 53 %) Multiplier(Alpha{3})
19.5 % ( 18 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 19 %) Multiplier(V{all})
97.5 % (100 %) Nodeslider(V{all})
30.3 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 68 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
26.9 % ( 23 %) Dirichlet(Pi{all})
28.5 % ( 32 %) Slider(Pi{all})
78.9 % ( 47 %) Multiplier(Alpha{1,2})
77.5 % ( 48 %) Multiplier(Alpha{3})
18.2 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 20 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.9 % ( 35 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166534 0.82 0.66
3 | 166165 166744 0.84
4 | 166722 167352 166483
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166766 0.82 0.67
3 | 166564 166464 0.84
4 | 166525 166878 166803
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1190.44
|2 1 |
| |
| 22 |
| 1 1 1 2 |
| 2 1 2 2 * 1 1 |
| 2 2112 12 2 121 2 1 21 2 2 |
| * 2 1 112 2 1 211 21 2 1 22 2 |
| 1 2 1 1 1 11 * 12 2 1|
|1 1 12 21 2 1 1 1 1 12 2|
| * 22 2122 1 122 1 2 2 1 1 |
| 2 2 1 1 122 2 2 2 |
| 2 1 12 1 1 1 |
| 1 1 2 2 |
| 2 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1192.51
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1190.66 -1193.77
2 -1190.69 -1194.82
--------------------------------------
TOTAL -1190.68 -1194.42
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896021 0.090975 0.356315 1.499759 0.867918 1484.91 1492.96 1.001
r(A<->C){all} 0.166173 0.018957 0.000029 0.428657 0.131402 223.08 297.63 1.002
r(A<->G){all} 0.164215 0.019240 0.000059 0.442867 0.125772 199.72 257.07 1.000
r(A<->T){all} 0.161100 0.019347 0.000022 0.431829 0.124907 211.25 261.44 1.005
r(C<->G){all} 0.171478 0.020401 0.000261 0.463205 0.134397 272.33 285.58 1.003
r(C<->T){all} 0.166968 0.020721 0.000025 0.449386 0.128566 188.56 224.83 1.000
r(G<->T){all} 0.170065 0.019740 0.000010 0.449776 0.134686 288.83 298.36 1.000
pi(A){all} 0.236261 0.000214 0.206917 0.263350 0.235987 1354.73 1390.02 1.003
pi(C){all} 0.333179 0.000254 0.304258 0.366824 0.333529 1139.26 1185.73 1.001
pi(G){all} 0.263370 0.000223 0.235792 0.293443 0.263006 1343.52 1362.34 1.000
pi(T){all} 0.167190 0.000158 0.142788 0.192266 0.166905 1270.58 1294.38 1.000
alpha{1,2} 0.408690 0.214423 0.000134 1.305066 0.241558 1359.44 1373.69 1.000
alpha{3} 0.451995 0.227112 0.000319 1.392186 0.300586 1217.43 1311.86 1.000
pinvar{all} 0.998193 0.000005 0.994101 0.999999 0.998934 1056.82 1067.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ....**
8 -- ..****
9 -- ..**..
10 -- .*.***
11 -- .****.
12 -- .*..*.
13 -- .**...
14 -- .*...*
15 -- .*.*..
16 -- ..*.*.
17 -- ...*.*
18 -- .***.*
19 -- ..*..*
20 -- .**.**
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 479 0.159560 0.016488 0.147901 0.171219 2
8 473 0.157562 0.000471 0.157229 0.157895 2
9 453 0.150899 0.004240 0.147901 0.153897 2
10 443 0.147568 0.006124 0.143238 0.151899 2
11 435 0.144903 0.013662 0.135243 0.154564 2
12 430 0.143238 0.006595 0.138574 0.147901 2
13 429 0.142905 0.019315 0.129247 0.156562 2
14 429 0.142905 0.008951 0.136576 0.149234 2
15 424 0.141239 0.001884 0.139907 0.142572 2
16 421 0.140240 0.007066 0.135243 0.145237 2
17 419 0.139574 0.000471 0.139241 0.139907 2
18 410 0.136576 0.010364 0.129247 0.143904 2
19 409 0.136243 0.009893 0.129247 0.143238 2
20 400 0.133245 0.012248 0.124584 0.141905 2
21 388 0.129247 0.001884 0.127915 0.130580 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0285/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.101218 0.010602 0.000086 0.302596 0.069345 1.000 2
length{all}[2] 0.097938 0.009266 0.000025 0.284182 0.068401 1.001 2
length{all}[3] 0.099344 0.009843 0.000030 0.293839 0.068237 1.000 2
length{all}[4] 0.099013 0.009563 0.000002 0.287464 0.069800 1.000 2
length{all}[5] 0.100828 0.010103 0.000041 0.303465 0.070378 1.000 2
length{all}[6] 0.097546 0.009573 0.000072 0.291817 0.066385 1.001 2
length{all}[7] 0.092825 0.008668 0.000334 0.285251 0.065874 1.009 2
length{all}[8] 0.106348 0.012406 0.000111 0.306621 0.071438 0.998 2
length{all}[9] 0.106857 0.012221 0.000229 0.324483 0.069824 1.013 2
length{all}[10] 0.097550 0.007196 0.000243 0.266811 0.073971 0.998 2
length{all}[11] 0.096792 0.008836 0.000038 0.281930 0.071899 1.000 2
length{all}[12] 0.093227 0.012368 0.000037 0.272702 0.060552 1.002 2
length{all}[13] 0.098929 0.011418 0.000262 0.329179 0.066062 1.001 2
length{all}[14] 0.102365 0.010348 0.000048 0.305058 0.075969 1.004 2
length{all}[15] 0.096583 0.010831 0.000104 0.312992 0.062296 0.998 2
length{all}[16] 0.101283 0.009415 0.000315 0.289033 0.068329 1.003 2
length{all}[17] 0.100522 0.010443 0.000048 0.335004 0.067970 0.999 2
length{all}[18] 0.098254 0.010222 0.000797 0.276911 0.066386 0.998 2
length{all}[19] 0.100981 0.008447 0.000096 0.267633 0.074057 1.005 2
length{all}[20] 0.091318 0.007500 0.000008 0.263950 0.065926 0.998 2
length{all}[21] 0.106604 0.010890 0.000089 0.323743 0.075411 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007977
Maximum standard deviation of split frequencies = 0.019315
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.013
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 876
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 292 / 292 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 292 / 292 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.023429 0.028859 0.073485 0.067565 0.056367 0.101768 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1258.609455
Iterating by ming2
Initial: fx= 1258.609455
x= 0.02343 0.02886 0.07349 0.06756 0.05637 0.10177 0.30000 1.30000
1 h-m-p 0.0000 0.0001 700.8559 ++ 1218.561520 m 0.0001 13 | 1/8
2 h-m-p 0.0008 0.0082 67.5633 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 641.6340 ++ 1210.785655 m 0.0000 44 | 2/8
4 h-m-p 0.0002 0.0121 54.3028 ----------.. | 2/8
5 h-m-p 0.0000 0.0001 573.5076 ++ 1179.099971 m 0.0001 74 | 3/8
6 h-m-p 0.0011 0.0194 42.3730 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 498.5461 ++ 1169.346934 m 0.0000 105 | 4/8
8 h-m-p 0.0005 0.0432 31.0963 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 407.3840 ++ 1165.901920 m 0.0000 136 | 5/8
10 h-m-p 0.0003 0.0647 20.7522 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 287.6419 ++ 1157.639127 m 0.0001 166 | 6/8
12 h-m-p 0.5325 8.0000 0.0000 ++ 1157.639127 m 8.0000 177 | 6/8
13 h-m-p 0.0211 8.0000 0.0036 -------------.. | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 1157.639127 m 8.0000 217 | 6/8
15 h-m-p 0.0057 2.8536 0.8551 ---------Y 1157.639127 0 0.0000 239 | 6/8
16 h-m-p 0.0160 8.0000 0.0001 +++++ 1157.639127 m 8.0000 255 | 6/8
17 h-m-p 0.0021 1.0608 1.8405 +++++ 1157.639045 m 1.0608 271 | 7/8
18 h-m-p 0.2561 1.2806 1.3730 ++ 1157.638718 m 1.2806 282 | 8/8
19 h-m-p 0.0160 8.0000 0.0000 Y 1157.638718 0 0.0160 293
Out..
lnL = -1157.638718
294 lfun, 294 eigenQcodon, 1764 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.044996 0.060973 0.087251 0.066549 0.024444 0.013503 0.000100 0.583163 0.572464
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.756171
np = 9
lnL0 = -1241.917864
Iterating by ming2
Initial: fx= 1241.917864
x= 0.04500 0.06097 0.08725 0.06655 0.02444 0.01350 0.00011 0.58316 0.57246
1 h-m-p 0.0000 0.0000 685.6434 ++ 1239.738714 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 359.8613 +++ 1218.746998 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0001 171.2378 ++ 1205.767897 m 0.0001 39 | 3/9
4 h-m-p 0.0002 0.0027 93.9350 ++ 1168.856134 m 0.0027 51 | 4/9
5 h-m-p 0.0000 0.0000 1054.0128 ++ 1164.564639 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 21134.0106 ++ 1163.289969 m 0.0000 75 | 6/9
7 h-m-p 0.0000 0.0001 1226.2259 ++ 1157.639048 m 0.0001 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 -------Y 1157.639048 0 0.0000 106
Out..
lnL = -1157.639048
107 lfun, 321 eigenQcodon, 1284 P(t)
Time used: 0:00
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.032943 0.029785 0.012681 0.090629 0.051665 0.069724 0.000100 0.833249 0.323297 0.429853 2.565316
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.303506
np = 11
lnL0 = -1235.005228
Iterating by ming2
Initial: fx= 1235.005228
x= 0.03294 0.02978 0.01268 0.09063 0.05166 0.06972 0.00011 0.83325 0.32330 0.42985 2.56532
1 h-m-p 0.0000 0.0000 619.9118 ++ 1233.574791 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0011 152.5870 ++++ 1209.353133 m 0.0011 32 | 2/11
3 h-m-p 0.0000 0.0002 338.2361 ++ 1188.583350 m 0.0002 46 | 3/11
4 h-m-p 0.0001 0.0006 100.8801 ++ 1183.959934 m 0.0006 60 | 4/11
5 h-m-p 0.0000 0.0000 7604.8155 ++ 1168.635756 m 0.0000 74 | 5/11
6 h-m-p 0.0000 0.0000 3876.4710 ++ 1167.759369 m 0.0000 88 | 6/11
7 h-m-p 0.0011 0.0059 8.1463 -----------.. | 6/11
8 h-m-p 0.0000 0.0000 388.3057 ++ 1161.612030 m 0.0000 125 | 7/11
9 h-m-p 0.0160 8.0000 6.2085 -------------.. | 7/11
10 h-m-p 0.0000 0.0000 281.4626 ++ 1157.639089 m 0.0000 164 | 8/11
11 h-m-p 0.1096 8.0000 0.0000 ++++ 1157.639089 m 8.0000 180 | 8/11
12 h-m-p 0.0160 8.0000 0.0558 --------Y 1157.639089 0 0.0000 205 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 1157.639089 m 8.0000 225 | 8/11
14 h-m-p 0.0160 8.0000 2.8901 -----------N 1157.639089 0 0.0000 253 | 8/11
15 h-m-p 0.0160 8.0000 0.0023 +++++ 1157.639088 m 8.0000 270 | 8/11
16 h-m-p 0.0160 8.0000 2.3694 -----------Y 1157.639088 0 0.0000 298 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 1157.639088 m 8.0000 315 | 8/11
18 h-m-p 0.0160 8.0000 0.0020 +++++ 1157.639088 m 8.0000 335 | 8/11
19 h-m-p 0.0160 8.0000 3.4887 -------------.. | 8/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 1157.639088 m 8.0000 380 | 8/11
21 h-m-p 0.0160 8.0000 0.3685 ----------Y 1157.639088 0 0.0000 407 | 8/11
22 h-m-p 0.0160 8.0000 0.0074 +++++ 1157.639084 m 8.0000 427 | 8/11
23 h-m-p 0.0430 8.0000 1.3811 -----------C 1157.639084 0 0.0000 455 | 8/11
24 h-m-p 0.0160 8.0000 0.0003 +++++ 1157.639084 m 8.0000 472 | 8/11
25 h-m-p 0.0160 8.0000 1.6442 -------------.. | 8/11
26 h-m-p 0.0160 8.0000 0.0001 +++++ 1157.639084 m 8.0000 517 | 8/11
27 h-m-p 0.0160 8.0000 0.0916 ---------N 1157.639084 0 0.0000 543 | 8/11
28 h-m-p 0.0160 8.0000 0.0003 +++++ 1157.639084 m 8.0000 563 | 8/11
29 h-m-p 0.0160 8.0000 1.2954 ----------Y 1157.639084 0 0.0000 590 | 8/11
30 h-m-p 0.0160 8.0000 0.0012 +++++ 1157.639084 m 8.0000 607 | 8/11
31 h-m-p 0.0160 8.0000 1.2276 -----------Y 1157.639084 0 0.0000 635 | 8/11
32 h-m-p 0.0160 8.0000 0.0000 ----Y 1157.639084 0 0.0000 653 | 8/11
33 h-m-p 0.0160 8.0000 0.0211 ---------C 1157.639084 0 0.0000 679 | 8/11
34 h-m-p 0.0160 8.0000 0.0000 +++++ 1157.639084 m 8.0000 699 | 8/11
35 h-m-p 0.0047 2.3419 0.9944 +++++ 1157.638858 m 2.3419 719 | 9/11
36 h-m-p 0.4509 8.0000 3.8076 ---------------C 1157.638858 0 0.0000 751 | 9/11
37 h-m-p 0.0160 8.0000 0.0000 ----N 1157.638858 0 0.0000 769 | 9/11
38 h-m-p 0.0160 8.0000 0.0001 -----N 1157.638858 0 0.0000 790
Out..
lnL = -1157.638858
791 lfun, 3164 eigenQcodon, 14238 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1157.681978 S = -1157.637788 -0.017048
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:04
did 20 / 58 patterns 0:04
did 30 / 58 patterns 0:04
did 40 / 58 patterns 0:04
did 50 / 58 patterns 0:04
did 58 / 58 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.087887 0.072693 0.055276 0.080386 0.069573 0.048923 0.000100 0.215103 1.124694
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 25.418758
np = 9
lnL0 = -1264.496430
Iterating by ming2
Initial: fx= 1264.496430
x= 0.08789 0.07269 0.05528 0.08039 0.06957 0.04892 0.00011 0.21510 1.12469
1 h-m-p 0.0000 0.0000 585.4487 ++ 1264.272919 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0054 56.7590 +++++ 1253.947747 m 0.0054 29 | 2/9
3 h-m-p 0.0001 0.0005 969.6823 ++ 1225.881775 m 0.0005 41 | 3/9
4 h-m-p 0.0003 0.0014 467.6752 ++ 1198.333051 m 0.0014 53 | 4/9
5 h-m-p 0.0002 0.0008 211.8487 ++ 1197.342568 m 0.0008 65 | 5/9
6 h-m-p 0.0000 0.0001 970.9937 ++ 1191.526299 m 0.0001 77 | 6/9
7 h-m-p 0.0004 0.0018 218.2255 ++ 1185.399225 m 0.0018 89 | 7/9
8 h-m-p 0.0620 8.0000 6.1830 --------------.. | 7/9
9 h-m-p 0.0000 0.0004 242.1948 +++ 1157.638718 m 0.0004 126 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 C 1157.638718 0 2.3333 138 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 ----N 1157.638718 0 0.0016 155
Out..
lnL = -1157.638718
156 lfun, 1716 eigenQcodon, 9360 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.061172 0.039220 0.038221 0.086630 0.091874 0.038693 0.000100 0.900000 1.197209 1.234769 2.238848
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.711514
np = 11
lnL0 = -1251.873703
Iterating by ming2
Initial: fx= 1251.873703
x= 0.06117 0.03922 0.03822 0.08663 0.09187 0.03869 0.00011 0.90000 1.19721 1.23477 2.23885
1 h-m-p 0.0000 0.0000 605.8964 ++ 1251.152764 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 474.4987 +++ 1191.900125 m 0.0004 31 | 2/11
3 h-m-p 0.0000 0.0000 8540.0842 ++ 1191.267570 m 0.0000 45 | 3/11
4 h-m-p 0.0001 0.0461 31.8575 +++++ 1162.485282 m 0.0461 62 | 4/11
5 h-m-p 0.0000 0.0000 2454.6290 ++ 1161.956346 m 0.0000 76 | 5/11
6 h-m-p 0.0000 0.0002 455.8263 ++ 1159.505337 m 0.0002 90 | 6/11
7 h-m-p 0.0000 0.0001 366.5987 ++ 1157.638972 m 0.0001 104 | 7/11
8 h-m-p 1.0578 8.0000 0.0204 ++ 1157.638952 m 8.0000 118 | 7/11
9 h-m-p 0.0017 0.0083 15.4857 ++ 1157.638937 m 0.0083 136 | 8/11
10 h-m-p 0.1521 0.9369 0.8304 +
QuantileBeta(0.15, 0.00500, 2.19392) = 1.198284e-160 2000 rounds
+ 1157.638718 m 0.9369 150
QuantileBeta(0.15, 0.00500, 2.19392) = 1.198284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19392) = 1.198284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19392) = 1.198284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19392) = 1.198284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19392) = 1.198284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19392) = 1.198284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19392) = 1.198284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19392) = 1.198284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19404) = 1.198200e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19379) = 1.198367e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19392) = 1.198284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19392) = 1.198284e-160 2000 rounds
| 9/11
11 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 2.19373) = 1.198412e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19317) = 1.198796e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
+ 1157.638718 m 8.0000 167
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.240778e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19311) = 1.198841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19286) = 1.199008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
| 9/11
12 h-m-p 0.0160 8.0000 0.1977
QuantileBeta(0.15, 0.00500, 2.19506) = 1.197499e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19350) = 1.198568e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19311) = 1.198835e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19302) = 1.198902e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198919e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198923e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
N 1157.638718 0 0.0000 188
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.240778e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19311) = 1.198840e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19286) = 1.199008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
| 9/11
13 h-m-p 0.0536 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19298) = 1.198925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
N 1157.638718 0 0.0536 204
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.240778e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19311) = 1.198841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19286) = 1.199008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
| 9/11
14 h-m-p 0.1720 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
Y 1157.638718 0 0.0430 220
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.240778e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19311) = 1.198840e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19286) = 1.199008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
| 9/11
15 h-m-p 0.0160 8.0000 8.5998
QuantileBeta(0.15, 0.00500, 2.28326) = 1.139789e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21555) = 1.183579e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19863) = 1.195051e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19440) = 1.197954e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19334) = 1.198682e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19307) = 1.198864e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19301) = 1.198909e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198921e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198923e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
N 1157.638718 0 0.0000 246
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.240778e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198923e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
| 9/11
16 h-m-p 0.6391 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
N 1157.638718 0 0.0100 262
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.240778e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19311) = 1.198840e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19286) = 1.199008e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
| 9/11
17 h-m-p 0.0211 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
C 1157.638718 0 0.0003 280
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
Out..
lnL = -1157.638718
281 lfun, 3372 eigenQcodon, 18546 P(t)
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1157.719572 S = -1157.639987 -0.035550
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:12
did 20 / 58 patterns 0:12
did 30 / 58 patterns 0:12
did 40 / 58 patterns 0:12
did 50 / 58 patterns 0:12
did 58 / 58 patterns 0:13
QuantileBeta(0.15, 0.00500, 2.19299) = 1.198924e-160 2000 rounds
Time used: 0:13
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0285/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 292
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 6 6 6 6 6 6 | TAC 5 5 5 5 5 5 | TGC 3 3 3 3 3 3
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 6 6 6 6 6 6 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 3 3 3 3 3 3 | His CAT 5 5 5 5 5 5 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 8 8 8 8 8 8 | CAC 7 7 7 7 7 7 | CGC 9 9 9 9 9 9
CTA 6 6 6 6 6 6 | CCA 9 9 9 9 9 9 | Gln CAA 6 6 6 6 6 6 | CGA 1 1 1 1 1 1
CTG 5 5 5 5 5 5 | CCG 4 4 4 4 4 4 | CAG 7 7 7 7 7 7 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 4 4 4 4 4 4 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 10 10 10 10 10 10 | ACC 13 13 13 13 13 13 | AAC 6 6 6 6 6 6 | AGC 6 6 6 6 6 6
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 6 6 6 6 6 6 | Arg AGA 3 3 3 3 3 3
Met ATG 7 7 7 7 7 7 | ACG 3 3 3 3 3 3 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 4 4 4 4 4 4 | Asp GAT 6 6 6 6 6 6 | Gly GGT 2 2 2 2 2 2
GTC 5 5 5 5 5 5 | GCC 13 13 13 13 13 13 | GAC 12 12 12 12 12 12 | GGC 10 10 10 10 10 10
GTA 2 2 2 2 2 2 | GCA 8 8 8 8 8 8 | Glu GAA 7 7 7 7 7 7 | GGA 2 2 2 2 2 2
GTG 11 11 11 11 11 11 | GCG 11 11 11 11 11 11 | GAG 8 8 8 8 8 8 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907649_1_295_MLBR_RS01440
position 1: T:0.14041 C:0.26027 A:0.23630 G:0.36301
position 2: T:0.23288 C:0.33219 A:0.27740 G:0.15753
position 3: T:0.12671 C:0.40753 A:0.19521 G:0.27055
Average T:0.16667 C:0.33333 A:0.23630 G:0.26370
#2: NC_002677_1_NP_301325_1_197_ML0285
position 1: T:0.14041 C:0.26027 A:0.23630 G:0.36301
position 2: T:0.23288 C:0.33219 A:0.27740 G:0.15753
position 3: T:0.12671 C:0.40753 A:0.19521 G:0.27055
Average T:0.16667 C:0.33333 A:0.23630 G:0.26370
#3: NZ_LVXE01000050_1_WP_010907649_1_2108_A3216_RS11400
position 1: T:0.14041 C:0.26027 A:0.23630 G:0.36301
position 2: T:0.23288 C:0.33219 A:0.27740 G:0.15753
position 3: T:0.12671 C:0.40753 A:0.19521 G:0.27055
Average T:0.16667 C:0.33333 A:0.23630 G:0.26370
#4: NZ_LYPH01000059_1_WP_010907649_1_2202_A8144_RS10525
position 1: T:0.14041 C:0.26027 A:0.23630 G:0.36301
position 2: T:0.23288 C:0.33219 A:0.27740 G:0.15753
position 3: T:0.12671 C:0.40753 A:0.19521 G:0.27055
Average T:0.16667 C:0.33333 A:0.23630 G:0.26370
#5: NZ_CP029543_1_WP_010907649_1_296_DIJ64_RS01530
position 1: T:0.14041 C:0.26027 A:0.23630 G:0.36301
position 2: T:0.23288 C:0.33219 A:0.27740 G:0.15753
position 3: T:0.12671 C:0.40753 A:0.19521 G:0.27055
Average T:0.16667 C:0.33333 A:0.23630 G:0.26370
#6: NZ_AP014567_1_WP_010907649_1_306_JK2ML_RS01580
position 1: T:0.14041 C:0.26027 A:0.23630 G:0.36301
position 2: T:0.23288 C:0.33219 A:0.27740 G:0.15753
position 3: T:0.12671 C:0.40753 A:0.19521 G:0.27055
Average T:0.16667 C:0.33333 A:0.23630 G:0.26370
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 0
TTC 24 | TCC 36 | TAC 30 | TGC 18
Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 36 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 18 | His H CAT 30 | Arg R CGT 6
CTC 12 | CCC 48 | CAC 42 | CGC 54
CTA 36 | CCA 54 | Gln Q CAA 36 | CGA 6
CTG 30 | CCG 24 | CAG 42 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 24 | Asn N AAT 12 | Ser S AGT 0
ATC 60 | ACC 78 | AAC 36 | AGC 36
ATA 6 | ACA 12 | Lys K AAA 36 | Arg R AGA 18
Met M ATG 42 | ACG 18 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 24 | Asp D GAT 36 | Gly G GGT 12
GTC 30 | GCC 78 | GAC 72 | GGC 60
GTA 12 | GCA 48 | Glu E GAA 42 | GGA 12
GTG 66 | GCG 66 | GAG 48 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14041 C:0.26027 A:0.23630 G:0.36301
position 2: T:0.23288 C:0.33219 A:0.27740 G:0.15753
position 3: T:0.12671 C:0.40753 A:0.19521 G:0.27055
Average T:0.16667 C:0.33333 A:0.23630 G:0.26370
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1157.638718 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907649_1_295_MLBR_RS01440: 0.000004, NC_002677_1_NP_301325_1_197_ML0285: 0.000004, NZ_LVXE01000050_1_WP_010907649_1_2108_A3216_RS11400: 0.000004, NZ_LYPH01000059_1_WP_010907649_1_2202_A8144_RS10525: 0.000004, NZ_CP029543_1_WP_010907649_1_296_DIJ64_RS01530: 0.000004, NZ_AP014567_1_WP_010907649_1_306_JK2ML_RS01580: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 686.1 189.9 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 686.1 189.9 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 686.1 189.9 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 686.1 189.9 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 686.1 189.9 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 686.1 189.9 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1157.639048 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.739018 0.381305
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907649_1_295_MLBR_RS01440: 0.000004, NC_002677_1_NP_301325_1_197_ML0285: 0.000004, NZ_LVXE01000050_1_WP_010907649_1_2108_A3216_RS11400: 0.000004, NZ_LYPH01000059_1_WP_010907649_1_2202_A8144_RS10525: 0.000004, NZ_CP029543_1_WP_010907649_1_296_DIJ64_RS01530: 0.000004, NZ_AP014567_1_WP_010907649_1_306_JK2ML_RS01580: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.73902 0.26098
w: 0.38130 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 686.1 189.9 0.5428 0.0000 0.0000 0.0 0.0
7..2 0.000 686.1 189.9 0.5428 0.0000 0.0000 0.0 0.0
7..3 0.000 686.1 189.9 0.5428 0.0000 0.0000 0.0 0.0
7..4 0.000 686.1 189.9 0.5428 0.0000 0.0000 0.0 0.0
7..5 0.000 686.1 189.9 0.5428 0.0000 0.0000 0.0 0.0
7..6 0.000 686.1 189.9 0.5428 0.0000 0.0000 0.0 0.0
Time used: 0:00
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1157.638858 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.891292 0.045328 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907649_1_295_MLBR_RS01440: 0.000004, NC_002677_1_NP_301325_1_197_ML0285: 0.000004, NZ_LVXE01000050_1_WP_010907649_1_2108_A3216_RS11400: 0.000004, NZ_LYPH01000059_1_WP_010907649_1_2202_A8144_RS10525: 0.000004, NZ_CP029543_1_WP_010907649_1_296_DIJ64_RS01530: 0.000004, NZ_AP014567_1_WP_010907649_1_306_JK2ML_RS01580: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.89129 0.04533 0.06338
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 686.1 189.9 0.1087 0.0000 0.0000 0.0 0.0
7..2 0.000 686.1 189.9 0.1087 0.0000 0.0000 0.0 0.0
7..3 0.000 686.1 189.9 0.1087 0.0000 0.0000 0.0 0.0
7..4 0.000 686.1 189.9 0.1087 0.0000 0.0000 0.0 0.0
7..5 0.000 686.1 189.9 0.1087 0.0000 0.0000 0.0 0.0
7..6 0.000 686.1 189.9 0.1087 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907649_1_295_MLBR_RS01440)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907649_1_295_MLBR_RS01440)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1157.638718 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.366504
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907649_1_295_MLBR_RS01440: 0.000004, NC_002677_1_NP_301325_1_197_ML0285: 0.000004, NZ_LVXE01000050_1_WP_010907649_1_2108_A3216_RS11400: 0.000004, NZ_LYPH01000059_1_WP_010907649_1_2202_A8144_RS10525: 0.000004, NZ_CP029543_1_WP_010907649_1_296_DIJ64_RS01530: 0.000004, NZ_AP014567_1_WP_010907649_1_306_JK2ML_RS01580: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.36650
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1157.638718 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 2.192985 3.348375
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907649_1_295_MLBR_RS01440: 0.000004, NC_002677_1_NP_301325_1_197_ML0285: 0.000004, NZ_LVXE01000050_1_WP_010907649_1_2108_A3216_RS11400: 0.000004, NZ_LYPH01000059_1_WP_010907649_1_2202_A8144_RS10525: 0.000004, NZ_CP029543_1_WP_010907649_1_296_DIJ64_RS01530: 0.000004, NZ_AP014567_1_WP_010907649_1_306_JK2ML_RS01580: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 2.19299
(p1 = 0.00001) w = 3.34838
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 3.34838
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 686.1 189.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907649_1_295_MLBR_RS01440)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.106 0.104 0.103 0.102 0.101 0.099 0.098 0.097 0.096 0.095
Time used: 0:13