--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:16:31 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0024/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -346.32 -349.49
2 -346.36 -349.80
--------------------------------------
TOTAL -346.34 -349.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897479 0.088455 0.322916 1.476304 0.865055 1501.00 1501.00 1.000
r(A<->C){all} 0.155206 0.018281 0.000001 0.428306 0.117143 171.98 214.24 1.000
r(A<->G){all} 0.162364 0.018576 0.000137 0.440965 0.127915 192.56 241.79 1.001
r(A<->T){all} 0.188523 0.022540 0.000056 0.480304 0.154707 190.36 204.89 1.000
r(C<->G){all} 0.162757 0.020194 0.000148 0.458450 0.123171 145.88 204.27 1.000
r(C<->T){all} 0.161280 0.019924 0.000004 0.441566 0.121679 214.27 226.58 1.000
r(G<->T){all} 0.169870 0.020750 0.000010 0.460272 0.131502 101.21 148.05 1.000
pi(A){all} 0.230901 0.000699 0.180236 0.284478 0.230378 1108.88 1236.37 1.000
pi(C){all} 0.244033 0.000710 0.191083 0.293866 0.243810 1250.20 1337.54 1.000
pi(G){all} 0.276403 0.000802 0.224465 0.333880 0.276252 1254.58 1349.90 1.000
pi(T){all} 0.248663 0.000734 0.195568 0.301169 0.247734 1176.48 1300.71 1.001
alpha{1,2} 0.398603 0.207545 0.000128 1.286648 0.239216 1076.08 1200.62 1.000
alpha{3} 0.444125 0.241762 0.000113 1.387533 0.281861 1135.03 1218.99 1.000
pinvar{all} 0.993415 0.000057 0.977955 1.000000 0.995973 1077.48 1289.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -329.687019
Model 2: PositiveSelection -329.687019
Model 0: one-ratio -329.68702
Model 7: beta -329.687019
Model 8: beta&w>1 -329.687019
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 0.0
Model 8 vs 7 0.0
>C1
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C2
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C3
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C4
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C5
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C6
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=83
C1 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C2 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C3 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C4 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C5 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C6 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
**************************************************
C1 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C2 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C3 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C4 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C5 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C6 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
*********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 83 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 83 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2490]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2490]--->[2490]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.439 Mb, Max= 30.594 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C2 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C3 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C4 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C5 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C6 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
**************************************************
C1 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C2 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C3 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C4 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C5 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C6 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
*********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
C2 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
C3 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
C4 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
C5 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
C6 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
**************************************************
C1 GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
C2 GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
C3 GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
C4 GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
C5 GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
C6 GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
**************************************************
C1 CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
C2 CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
C3 CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
C4 CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
C5 CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
C6 CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
**************************************************
C1 GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
C2 GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
C3 GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
C4 GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
C5 GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
C6 GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
**************************************************
C1 CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
C2 CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
C3 CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
C4 CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
C5 CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
C6 CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
*************************************************
>C1
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C2
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C3
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C4
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C5
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C6
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C1
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C2
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C3
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C4
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C5
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C6
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 249 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788920
Setting output file names to "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 289162985
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0285644836
Seed = 399988855
Swapseed = 1579788920
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -557.273937 -- -24.965149
Chain 2 -- -557.273852 -- -24.965149
Chain 3 -- -557.273937 -- -24.965149
Chain 4 -- -557.273937 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -557.273852 -- -24.965149
Chain 2 -- -557.273937 -- -24.965149
Chain 3 -- -557.273937 -- -24.965149
Chain 4 -- -557.273852 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-557.274] (-557.274) (-557.274) (-557.274) * [-557.274] (-557.274) (-557.274) (-557.274)
500 -- (-363.268) [-352.392] (-357.709) (-356.882) * [-351.973] (-356.656) (-357.609) (-353.297) -- 0:33:19
1000 -- (-354.683) (-358.038) (-356.239) [-353.360] * (-353.027) (-362.421) (-352.399) [-354.205] -- 0:16:39
1500 -- (-354.837) (-352.191) [-358.508] (-359.237) * (-351.893) (-357.109) (-357.685) [-351.767] -- 0:11:05
2000 -- [-356.859] (-359.242) (-353.022) (-356.467) * (-356.910) [-355.257] (-361.150) (-360.464) -- 0:08:19
2500 -- (-354.216) (-357.886) (-357.567) [-356.538] * [-362.939] (-351.217) (-352.345) (-354.048) -- 0:06:39
3000 -- [-360.945] (-363.214) (-359.904) (-360.059) * (-359.399) (-352.022) (-355.076) [-356.570] -- 0:05:32
3500 -- (-355.499) [-356.052] (-355.220) (-355.354) * (-356.121) [-351.933] (-365.311) (-354.468) -- 0:04:44
4000 -- (-363.285) [-351.969] (-354.731) (-354.569) * [-354.741] (-352.584) (-363.748) (-353.401) -- 0:04:09
4500 -- (-350.185) (-351.380) [-354.255] (-359.139) * [-353.898] (-358.122) (-359.745) (-355.459) -- 0:03:41
5000 -- (-358.721) (-357.753) (-357.708) [-356.975] * (-353.959) [-355.986] (-356.622) (-355.280) -- 0:03:19
Average standard deviation of split frequencies: 0.075151
5500 -- (-358.820) (-349.756) [-354.539] (-361.856) * (-364.489) [-356.743] (-359.923) (-355.984) -- 0:03:00
6000 -- [-353.355] (-359.299) (-352.975) (-361.109) * (-359.012) (-356.567) [-357.772] (-363.308) -- 0:02:45
6500 -- [-354.003] (-358.001) (-362.076) (-368.852) * (-356.140) (-356.059) (-360.909) [-353.323] -- 0:02:32
7000 -- [-358.153] (-356.123) (-355.199) (-366.218) * (-357.972) (-355.497) (-349.197) [-360.023] -- 0:02:21
7500 -- (-358.092) [-368.093] (-355.258) (-353.608) * [-358.261] (-352.670) (-354.940) (-363.663) -- 0:02:12
8000 -- [-351.678] (-345.217) (-360.326) (-345.240) * [-355.819] (-355.985) (-360.613) (-361.418) -- 0:02:04
8500 -- (-360.224) (-345.570) [-357.183] (-346.873) * (-360.408) (-354.949) [-353.069] (-371.528) -- 0:01:56
9000 -- (-361.729) (-345.456) (-365.078) [-347.694] * (-365.923) (-357.219) [-356.705] (-358.752) -- 0:01:50
9500 -- (-355.222) (-345.104) [-357.485] (-348.829) * (-354.280) [-353.798] (-356.732) (-346.233) -- 0:01:44
10000 -- (-361.719) (-345.584) (-368.991) [-345.082] * (-366.055) [-356.547] (-353.699) (-350.176) -- 0:01:39
Average standard deviation of split frequencies: 0.055824
10500 -- (-357.091) (-348.807) (-358.630) [-347.693] * (-352.705) (-358.526) (-352.175) [-345.956] -- 0:01:34
11000 -- (-363.339) [-345.918] (-349.292) (-345.713) * (-361.765) (-351.488) [-353.741] (-347.926) -- 0:01:29
11500 -- (-370.583) (-347.322) [-345.876] (-345.303) * (-367.474) [-352.174] (-355.243) (-350.448) -- 0:01:25
12000 -- (-352.756) (-348.117) [-346.050] (-348.029) * (-346.804) [-351.978] (-352.631) (-345.645) -- 0:01:22
12500 -- (-347.396) (-345.541) (-347.661) [-345.837] * (-345.681) [-358.105] (-353.328) (-347.116) -- 0:01:19
13000 -- (-349.494) (-347.691) [-346.133] (-346.545) * (-347.145) [-351.923] (-349.622) (-346.741) -- 0:01:15
13500 -- (-349.202) (-347.981) (-345.973) [-347.216] * (-346.645) (-360.505) (-362.577) [-346.207] -- 0:01:13
14000 -- (-346.253) (-345.745) (-345.567) [-345.218] * (-346.530) (-357.048) (-356.528) [-348.374] -- 0:02:20
14500 -- (-346.327) (-346.259) (-347.429) [-348.131] * (-344.945) [-351.554] (-355.121) (-347.920) -- 0:02:15
15000 -- (-345.656) (-346.165) (-348.251) [-346.544] * (-345.198) (-364.379) (-363.244) [-346.701] -- 0:02:11
Average standard deviation of split frequencies: 0.046520
15500 -- [-345.117] (-348.202) (-345.636) (-346.338) * (-349.500) (-354.899) [-355.437] (-345.806) -- 0:02:07
16000 -- (-352.602) (-345.345) [-345.515] (-345.251) * (-346.638) (-357.743) [-352.051] (-349.412) -- 0:02:03
16500 -- (-347.162) (-351.308) [-345.452] (-344.876) * [-345.677] (-359.650) (-355.960) (-347.110) -- 0:01:59
17000 -- [-349.590] (-348.646) (-347.912) (-350.515) * (-348.506) [-358.762] (-355.969) (-345.525) -- 0:01:55
17500 -- (-348.745) (-347.469) [-347.577] (-348.625) * (-348.435) (-355.225) (-356.205) [-349.112] -- 0:01:52
18000 -- (-346.822) (-345.113) (-351.570) [-347.537] * (-345.855) (-362.114) [-348.892] (-349.400) -- 0:01:49
18500 -- (-345.918) (-344.968) [-345.470] (-346.355) * (-345.385) [-354.550] (-357.704) (-347.285) -- 0:01:46
19000 -- (-350.305) (-344.874) (-348.064) [-346.384] * (-345.182) [-358.957] (-355.455) (-346.305) -- 0:01:43
19500 -- (-348.784) (-345.429) [-349.139] (-347.638) * (-348.889) [-352.125] (-360.188) (-347.183) -- 0:01:40
20000 -- (-349.727) (-350.617) [-349.545] (-345.911) * (-346.386) (-361.302) [-352.659] (-347.767) -- 0:01:38
Average standard deviation of split frequencies: 0.062727
20500 -- (-348.430) (-350.084) (-348.335) [-347.657] * (-348.106) (-378.533) [-351.575] (-346.887) -- 0:01:35
21000 -- (-349.905) [-345.848] (-346.676) (-350.924) * (-345.326) (-370.939) (-360.850) [-347.496] -- 0:01:33
21500 -- (-346.623) [-346.510] (-350.473) (-346.174) * [-346.889] (-360.838) (-370.581) (-345.902) -- 0:01:31
22000 -- [-349.861] (-348.055) (-345.872) (-345.622) * (-351.260) (-356.538) (-358.757) [-349.055] -- 0:01:28
22500 -- (-346.663) [-347.777] (-350.829) (-346.272) * (-349.056) (-353.873) [-352.567] (-346.687) -- 0:01:26
23000 -- (-347.078) [-344.741] (-347.302) (-349.847) * [-347.357] (-348.068) (-369.894) (-348.261) -- 0:01:24
23500 -- [-345.214] (-347.562) (-346.360) (-347.124) * [-346.881] (-345.928) (-365.171) (-346.468) -- 0:01:23
24000 -- (-346.489) (-347.603) [-347.882] (-349.956) * (-345.854) [-347.743] (-354.167) (-348.499) -- 0:01:21
24500 -- [-347.483] (-346.235) (-348.804) (-350.057) * (-345.848) [-347.522] (-347.600) (-347.218) -- 0:01:19
25000 -- (-345.742) (-352.723) [-346.775] (-349.514) * (-347.088) (-346.137) [-347.629] (-348.133) -- 0:01:18
Average standard deviation of split frequencies: 0.050576
25500 -- (-345.420) (-346.943) (-351.774) [-346.129] * (-347.277) [-346.281] (-344.963) (-346.524) -- 0:01:16
26000 -- (-345.247) (-346.344) [-345.924] (-346.714) * (-349.621) (-348.134) [-347.733] (-345.712) -- 0:01:14
26500 -- [-349.021] (-347.098) (-345.273) (-345.615) * (-347.677) (-348.653) (-346.754) [-345.895] -- 0:01:13
27000 -- (-347.610) [-345.735] (-344.926) (-346.706) * (-348.900) (-351.670) [-345.368] (-345.765) -- 0:01:12
27500 -- (-345.920) (-347.606) (-347.849) [-349.028] * (-346.760) (-353.530) (-351.042) [-346.748] -- 0:01:10
28000 -- (-348.285) [-346.495] (-345.343) (-344.825) * (-346.376) [-348.101] (-349.507) (-345.875) -- 0:01:09
28500 -- (-345.941) [-347.622] (-345.138) (-345.741) * [-347.123] (-347.720) (-346.588) (-346.894) -- 0:01:08
29000 -- [-346.490] (-347.903) (-347.030) (-347.812) * (-348.558) (-348.400) (-347.940) [-347.015] -- 0:01:40
29500 -- (-350.019) (-346.899) [-346.227] (-348.918) * (-349.515) (-347.949) [-345.311] (-345.090) -- 0:01:38
30000 -- (-350.884) (-346.263) [-348.256] (-350.652) * (-347.032) [-345.784] (-348.507) (-347.017) -- 0:01:37
Average standard deviation of split frequencies: 0.040735
30500 -- (-348.181) (-345.367) (-348.649) [-353.233] * (-351.074) (-348.397) (-347.839) [-349.364] -- 0:01:35
31000 -- (-345.265) (-346.685) [-346.935] (-348.236) * (-348.951) [-345.289] (-345.961) (-349.685) -- 0:01:33
31500 -- [-345.773] (-346.937) (-349.931) (-348.343) * (-345.391) (-345.227) [-347.326] (-349.571) -- 0:01:32
32000 -- (-346.237) [-347.420] (-348.996) (-349.974) * (-345.264) [-345.237] (-348.972) (-345.067) -- 0:01:30
32500 -- (-345.175) (-350.597) [-346.062] (-348.277) * (-348.310) (-345.380) [-345.891] (-345.946) -- 0:01:29
33000 -- [-345.468] (-347.947) (-346.066) (-347.063) * (-348.277) (-345.355) [-348.227] (-349.057) -- 0:01:27
33500 -- (-346.278) (-345.683) (-346.920) [-346.604] * [-345.827] (-345.824) (-349.576) (-346.486) -- 0:01:26
34000 -- [-348.241] (-347.938) (-350.098) (-344.709) * (-348.993) (-351.225) [-348.933] (-345.709) -- 0:01:25
34500 -- (-345.972) (-348.206) (-346.809) [-346.943] * (-345.721) (-349.957) (-348.599) [-349.808] -- 0:01:23
35000 -- (-347.523) (-348.520) (-347.174) [-344.903] * [-344.787] (-349.821) (-347.133) (-347.511) -- 0:01:22
Average standard deviation of split frequencies: 0.028808
35500 -- (-347.983) [-350.114] (-345.186) (-345.107) * (-345.409) (-348.872) (-348.762) [-345.349] -- 0:01:21
36000 -- (-346.172) (-353.142) [-345.766] (-345.924) * (-344.782) (-349.675) [-346.986] (-345.583) -- 0:01:20
36500 -- (-349.661) [-347.435] (-350.913) (-347.204) * (-344.995) (-345.695) (-346.938) [-350.203] -- 0:01:19
37000 -- [-347.413] (-348.871) (-346.875) (-352.417) * (-346.892) (-346.637) [-346.616] (-346.748) -- 0:01:18
37500 -- (-345.349) [-349.093] (-351.050) (-357.392) * (-347.177) (-348.828) [-347.267] (-349.762) -- 0:01:17
38000 -- (-351.100) [-349.653] (-350.769) (-346.844) * (-348.092) (-347.439) (-348.369) [-353.010] -- 0:01:15
38500 -- [-351.494] (-350.164) (-345.412) (-346.674) * (-345.536) (-347.198) [-348.057] (-348.104) -- 0:01:14
39000 -- (-349.356) [-346.701] (-345.913) (-347.895) * [-347.517] (-347.640) (-345.478) (-347.381) -- 0:01:13
39500 -- (-347.953) (-347.593) (-347.414) [-345.971] * (-347.710) (-345.603) [-346.797] (-344.942) -- 0:01:12
40000 -- [-345.627] (-345.470) (-346.199) (-349.512) * (-346.225) [-345.210] (-348.052) (-346.442) -- 0:01:12
Average standard deviation of split frequencies: 0.027455
40500 -- (-348.034) [-347.315] (-347.662) (-345.803) * (-347.102) [-346.172] (-349.159) (-347.152) -- 0:01:11
41000 -- (-346.544) [-346.460] (-347.095) (-345.770) * (-346.852) (-344.915) [-348.786] (-345.344) -- 0:01:10
41500 -- (-347.860) [-345.701] (-345.551) (-349.416) * (-344.701) [-348.974] (-346.922) (-345.380) -- 0:01:09
42000 -- (-346.056) (-346.704) [-345.993] (-345.783) * [-347.780] (-348.839) (-349.732) (-345.973) -- 0:01:08
42500 -- (-347.059) (-347.852) [-348.311] (-345.743) * [-345.772] (-349.642) (-347.589) (-346.284) -- 0:01:07
43000 -- (-346.332) (-346.652) [-346.858] (-347.690) * [-347.910] (-348.481) (-345.758) (-346.860) -- 0:01:06
43500 -- [-346.216] (-346.825) (-347.526) (-346.288) * (-347.494) [-346.318] (-346.035) (-346.339) -- 0:01:05
44000 -- (-346.441) (-346.996) (-349.547) [-349.979] * (-346.872) (-346.862) (-349.736) [-346.388] -- 0:01:05
44500 -- (-346.558) [-345.604] (-346.147) (-346.237) * [-346.067] (-346.111) (-349.619) (-346.227) -- 0:01:25
45000 -- (-348.100) (-346.920) [-345.713] (-346.949) * [-346.153] (-346.455) (-349.118) (-347.268) -- 0:01:24
Average standard deviation of split frequencies: 0.028070
45500 -- (-345.009) (-349.988) (-346.992) [-347.703] * (-346.891) (-345.766) (-346.965) [-345.378] -- 0:01:23
46000 -- (-345.754) (-349.117) [-346.115] (-349.723) * (-348.381) (-345.893) (-347.791) [-347.435] -- 0:01:22
46500 -- [-345.103] (-347.620) (-349.125) (-349.810) * (-346.653) (-347.877) (-351.093) [-347.745] -- 0:01:22
47000 -- (-345.993) [-345.831] (-345.996) (-348.776) * (-349.440) [-347.333] (-348.377) (-346.217) -- 0:01:21
47500 -- (-347.476) [-344.965] (-347.893) (-346.997) * [-346.559] (-349.789) (-346.475) (-353.541) -- 0:01:20
48000 -- [-349.579] (-346.378) (-347.427) (-347.773) * (-346.935) (-345.135) (-346.385) [-346.578] -- 0:01:19
48500 -- [-347.005] (-349.723) (-347.682) (-348.287) * [-345.021] (-347.267) (-348.270) (-345.275) -- 0:01:18
49000 -- (-349.583) [-348.006] (-345.399) (-346.154) * (-346.079) [-349.547] (-350.313) (-346.406) -- 0:01:17
49500 -- (-346.189) (-348.879) (-345.007) [-347.507] * [-345.795] (-348.855) (-346.295) (-347.378) -- 0:01:16
50000 -- [-347.353] (-347.653) (-350.110) (-347.390) * (-347.676) (-348.295) (-345.554) [-345.416] -- 0:01:16
Average standard deviation of split frequencies: 0.026140
50500 -- (-351.760) [-351.208] (-349.901) (-346.700) * (-355.105) [-345.723] (-345.602) (-346.509) -- 0:01:15
51000 -- (-347.032) (-348.733) [-347.321] (-346.266) * (-348.905) (-345.459) [-347.299] (-347.442) -- 0:01:14
51500 -- [-345.466] (-347.719) (-346.334) (-347.573) * (-347.852) (-344.953) [-349.349] (-346.211) -- 0:01:13
52000 -- (-347.898) (-347.051) [-347.087] (-349.844) * (-348.364) (-349.382) (-350.665) [-348.674] -- 0:01:12
52500 -- (-349.001) (-349.781) (-349.923) [-347.350] * (-346.030) (-348.548) (-350.613) [-350.812] -- 0:01:12
53000 -- [-346.141] (-345.512) (-349.562) (-347.196) * (-347.408) (-345.682) (-349.315) [-346.634] -- 0:01:11
53500 -- (-349.366) (-351.887) (-348.042) [-347.331] * (-350.166) (-346.915) [-346.353] (-345.572) -- 0:01:10
54000 -- (-348.702) (-349.287) [-345.654] (-352.767) * (-353.150) (-351.341) [-346.204] (-348.019) -- 0:01:10
54500 -- (-349.517) (-350.138) (-349.154) [-351.048] * (-351.912) (-346.984) (-346.113) [-347.956] -- 0:01:09
55000 -- (-349.761) (-347.086) (-350.472) [-347.810] * (-346.836) [-347.296] (-348.423) (-349.530) -- 0:01:08
Average standard deviation of split frequencies: 0.027469
55500 -- [-346.981] (-349.218) (-350.843) (-346.330) * (-346.664) (-346.242) (-347.147) [-347.845] -- 0:01:08
56000 -- (-345.481) (-350.813) [-345.235] (-347.194) * (-354.136) (-344.841) (-346.810) [-348.931] -- 0:01:07
56500 -- (-347.775) (-345.366) [-346.915] (-349.502) * (-350.662) (-347.650) [-349.463] (-349.772) -- 0:01:06
57000 -- (-347.436) (-347.922) (-346.453) [-350.043] * (-349.377) (-348.001) [-346.343] (-346.307) -- 0:01:06
57500 -- (-347.723) [-346.651] (-347.055) (-345.818) * (-347.734) (-350.925) [-346.879] (-344.969) -- 0:01:05
58000 -- (-346.085) (-345.949) (-346.913) [-348.914] * [-346.325] (-346.263) (-347.083) (-346.122) -- 0:01:04
58500 -- (-346.141) [-346.627] (-350.640) (-345.450) * (-352.287) (-345.180) (-345.188) [-345.549] -- 0:01:04
59000 -- (-347.489) (-345.787) (-351.377) [-347.013] * (-345.315) (-345.670) [-346.033] (-345.685) -- 0:01:03
59500 -- (-346.303) (-348.356) [-346.698] (-346.126) * (-345.365) (-345.698) [-346.103] (-349.547) -- 0:01:03
60000 -- (-345.279) (-346.555) (-348.596) [-347.099] * [-348.570] (-351.683) (-346.793) (-346.631) -- 0:01:18
Average standard deviation of split frequencies: 0.024947
60500 -- (-346.398) [-346.008] (-346.559) (-348.948) * (-349.589) (-344.735) [-346.898] (-345.508) -- 0:01:17
61000 -- (-348.902) (-346.186) (-346.183) [-347.367] * (-346.786) (-345.554) [-348.407] (-348.109) -- 0:01:16
61500 -- (-347.654) (-347.953) (-346.768) [-346.842] * (-346.672) (-346.776) (-347.774) [-346.206] -- 0:01:16
62000 -- (-348.970) (-345.641) (-348.758) [-347.123] * [-346.067] (-347.829) (-348.273) (-346.866) -- 0:01:15
62500 -- [-348.500] (-345.765) (-350.689) (-347.399) * (-347.220) (-347.540) (-348.050) [-348.465] -- 0:01:15
63000 -- (-346.628) (-345.424) (-351.590) [-347.649] * [-345.291] (-345.558) (-345.845) (-347.348) -- 0:01:14
63500 -- (-346.702) (-348.715) (-349.936) [-347.324] * (-345.895) (-347.281) [-346.796] (-347.938) -- 0:01:13
64000 -- [-344.808] (-349.229) (-347.138) (-345.727) * [-346.319] (-347.129) (-347.182) (-351.322) -- 0:01:13
64500 -- (-345.286) (-348.850) [-346.955] (-345.181) * (-348.411) (-347.987) (-346.509) [-345.310] -- 0:01:12
65000 -- [-347.656] (-350.096) (-349.164) (-350.783) * [-345.565] (-345.785) (-347.123) (-349.244) -- 0:01:11
Average standard deviation of split frequencies: 0.020713
65500 -- [-347.575] (-350.785) (-347.920) (-349.633) * (-345.609) (-345.983) [-347.252] (-351.614) -- 0:01:11
66000 -- (-345.823) (-346.848) (-350.326) [-348.318] * (-348.440) (-345.899) [-346.331] (-347.379) -- 0:01:10
66500 -- [-345.271] (-346.132) (-345.523) (-348.858) * (-350.925) (-344.901) [-347.047] (-349.969) -- 0:01:10
67000 -- [-345.272] (-347.297) (-350.612) (-345.601) * (-349.020) (-346.667) (-348.434) [-346.046] -- 0:01:09
67500 -- (-345.313) (-345.466) [-346.434] (-346.442) * (-354.525) (-345.336) [-345.212] (-347.940) -- 0:01:09
68000 -- (-349.573) (-346.279) [-346.985] (-345.552) * (-349.628) (-346.438) [-346.827] (-347.989) -- 0:01:08
68500 -- [-345.881] (-345.984) (-347.854) (-344.953) * (-346.827) (-345.887) (-347.833) [-345.358] -- 0:01:07
69000 -- (-346.289) (-348.001) [-346.420] (-349.281) * (-347.201) (-345.538) [-349.271] (-351.036) -- 0:01:07
69500 -- (-346.164) (-347.883) [-344.792] (-347.683) * (-351.139) [-346.211] (-348.164) (-352.850) -- 0:01:06
70000 -- [-346.939] (-346.241) (-346.764) (-348.509) * (-347.746) (-345.872) [-346.276] (-345.339) -- 0:01:06
Average standard deviation of split frequencies: 0.023681
70500 -- (-345.783) [-346.242] (-346.046) (-348.108) * (-348.176) (-346.676) [-347.849] (-347.953) -- 0:01:05
71000 -- (-346.581) (-346.904) (-346.739) [-347.059] * (-347.229) (-345.867) (-347.856) [-346.009] -- 0:01:05
71500 -- (-345.181) [-345.768] (-346.983) (-346.831) * (-345.915) (-349.313) (-352.808) [-346.464] -- 0:01:04
72000 -- (-345.039) (-347.743) (-346.744) [-344.809] * (-346.011) (-347.416) (-351.973) [-345.673] -- 0:01:04
72500 -- [-347.359] (-351.476) (-346.508) (-346.041) * [-345.848] (-346.160) (-346.206) (-345.701) -- 0:01:03
73000 -- (-345.169) (-349.492) (-348.255) [-348.425] * (-345.880) [-349.940] (-351.072) (-348.117) -- 0:01:03
73500 -- (-354.463) (-349.596) [-349.589] (-347.839) * (-347.245) (-350.180) (-351.797) [-348.077] -- 0:01:03
74000 -- (-345.546) (-352.760) (-348.790) [-346.040] * [-346.373] (-347.789) (-345.509) (-348.776) -- 0:01:02
74500 -- [-345.739] (-349.075) (-349.057) (-346.128) * [-349.264] (-346.546) (-346.981) (-349.663) -- 0:01:02
75000 -- (-349.299) [-345.743] (-346.557) (-347.834) * (-348.705) [-346.921] (-344.777) (-348.432) -- 0:01:01
Average standard deviation of split frequencies: 0.025992
75500 -- (-346.797) [-345.496] (-351.797) (-346.482) * [-347.247] (-347.133) (-345.734) (-346.665) -- 0:01:01
76000 -- (-346.984) (-344.702) [-346.236] (-345.313) * [-346.671] (-345.966) (-346.844) (-347.608) -- 0:01:00
76500 -- (-352.211) (-345.518) [-346.114] (-345.772) * (-347.600) [-350.189] (-346.823) (-348.401) -- 0:01:12
77000 -- (-348.015) [-345.756] (-347.044) (-347.399) * (-347.696) (-346.339) (-348.021) [-348.034] -- 0:01:11
77500 -- (-346.469) (-347.478) [-345.847] (-347.741) * (-350.057) (-345.847) (-347.129) [-345.974] -- 0:01:11
78000 -- (-345.149) (-348.031) [-346.049] (-346.457) * (-348.235) (-347.494) [-346.190] (-345.736) -- 0:01:10
78500 -- [-346.206] (-347.359) (-348.415) (-346.537) * (-348.004) [-346.465] (-347.131) (-346.884) -- 0:01:10
79000 -- (-344.777) [-346.569] (-349.413) (-346.493) * (-348.727) (-347.262) [-346.878] (-347.122) -- 0:01:09
79500 -- (-345.892) (-347.119) [-347.184] (-345.558) * (-348.386) (-346.960) (-345.162) [-348.164] -- 0:01:09
80000 -- (-348.331) (-346.466) (-347.259) [-346.279] * (-351.659) (-346.823) (-348.759) [-346.590] -- 0:01:09
Average standard deviation of split frequencies: 0.030388
80500 -- (-346.284) (-350.262) (-350.022) [-350.803] * (-347.336) (-349.923) (-346.338) [-346.360] -- 0:01:08
81000 -- (-347.440) (-347.767) [-345.866] (-347.226) * (-346.439) [-347.620] (-350.534) (-347.331) -- 0:01:08
81500 -- (-349.077) (-346.830) (-346.410) [-349.192] * (-349.774) [-346.425] (-347.365) (-347.823) -- 0:01:07
82000 -- (-346.175) (-347.041) [-345.575] (-345.934) * (-353.249) (-347.686) (-348.251) [-347.597] -- 0:01:07
82500 -- [-345.483] (-345.609) (-346.349) (-345.561) * (-348.060) (-349.720) [-345.387] (-347.939) -- 0:01:06
83000 -- (-348.148) (-346.612) (-347.767) [-347.073] * (-347.636) [-346.240] (-346.917) (-347.915) -- 0:01:06
83500 -- (-347.887) (-349.266) (-351.130) [-345.561] * (-347.854) [-346.373] (-349.340) (-345.435) -- 0:01:05
84000 -- [-346.517] (-346.082) (-346.258) (-345.907) * [-346.295] (-345.928) (-346.463) (-346.728) -- 0:01:05
84500 -- [-345.909] (-346.348) (-347.409) (-345.674) * [-346.351] (-346.301) (-346.793) (-345.207) -- 0:01:05
85000 -- (-345.043) (-350.892) (-346.264) [-345.847] * (-346.157) [-351.825] (-346.255) (-345.474) -- 0:01:04
Average standard deviation of split frequencies: 0.024667
85500 -- [-346.093] (-349.170) (-348.831) (-348.518) * [-347.694] (-345.456) (-346.514) (-347.872) -- 0:01:04
86000 -- (-347.563) [-346.244] (-346.633) (-346.288) * (-345.699) (-346.232) [-348.972] (-346.291) -- 0:01:03
86500 -- (-347.232) (-347.776) (-345.216) [-347.533] * (-346.561) [-347.135] (-347.451) (-346.445) -- 0:01:03
87000 -- (-347.834) (-348.564) (-345.201) [-347.588] * (-349.948) [-345.710] (-345.251) (-352.496) -- 0:01:02
87500 -- (-347.377) (-348.816) [-350.955] (-346.271) * [-350.097] (-346.790) (-347.049) (-347.831) -- 0:01:02
88000 -- (-345.980) (-347.957) [-346.882] (-348.213) * (-346.866) (-348.784) [-347.304] (-346.511) -- 0:01:02
88500 -- (-346.391) [-348.108] (-346.591) (-350.466) * (-345.964) (-352.802) [-357.629] (-349.909) -- 0:01:01
89000 -- (-346.051) [-348.202] (-345.509) (-346.691) * (-351.988) (-345.230) (-348.580) [-346.860] -- 0:01:01
89500 -- (-346.428) (-346.014) [-345.711] (-346.462) * (-348.132) (-346.268) [-348.376] (-350.897) -- 0:01:01
90000 -- [-345.086] (-347.388) (-346.086) (-345.781) * (-349.096) (-348.627) [-350.183] (-347.321) -- 0:01:00
Average standard deviation of split frequencies: 0.028186
90500 -- [-345.555] (-349.270) (-345.850) (-345.315) * (-346.647) (-346.953) (-349.055) [-345.866] -- 0:01:00
91000 -- (-348.246) (-349.251) (-348.138) [-345.360] * [-347.195] (-348.060) (-345.664) (-345.357) -- 0:00:59
91500 -- (-347.764) (-348.555) [-346.191] (-347.314) * (-346.605) [-346.032] (-347.178) (-345.214) -- 0:00:59
92000 -- (-346.642) (-346.349) [-347.410] (-346.298) * [-345.415] (-350.527) (-348.683) (-348.947) -- 0:00:59
92500 -- [-346.430] (-348.627) (-346.443) (-345.640) * [-345.807] (-354.942) (-345.559) (-355.505) -- 0:00:58
93000 -- [-345.607] (-346.655) (-347.840) (-345.149) * (-346.548) [-352.911] (-345.979) (-354.920) -- 0:00:58
93500 -- (-346.679) (-346.410) (-346.639) [-347.511] * [-346.233] (-346.057) (-346.227) (-349.352) -- 0:01:07
94000 -- [-347.321] (-346.089) (-346.432) (-347.219) * (-345.560) (-346.734) [-345.925] (-346.876) -- 0:01:07
94500 -- [-346.192] (-350.298) (-345.061) (-349.077) * (-346.590) [-345.812] (-345.784) (-345.726) -- 0:01:07
95000 -- (-345.052) [-349.580] (-348.062) (-349.413) * (-345.585) (-348.048) (-345.549) [-345.722] -- 0:01:06
Average standard deviation of split frequencies: 0.026025
95500 -- [-348.220] (-345.866) (-346.575) (-345.367) * (-353.691) (-350.117) [-347.183] (-345.829) -- 0:01:06
96000 -- [-347.623] (-345.833) (-346.549) (-347.412) * (-351.918) [-347.787] (-347.306) (-347.485) -- 0:01:05
96500 -- (-345.135) [-345.541] (-347.220) (-347.656) * (-351.471) (-345.728) (-346.065) [-346.555] -- 0:01:05
97000 -- (-346.291) (-349.703) [-345.805] (-351.253) * (-353.460) [-346.562] (-347.600) (-345.476) -- 0:01:05
97500 -- (-345.511) (-345.081) [-349.620] (-346.587) * (-347.514) (-350.057) (-348.072) [-346.089] -- 0:01:04
98000 -- (-346.329) (-345.665) [-349.071] (-347.901) * (-346.855) [-346.059] (-346.048) (-347.817) -- 0:01:04
98500 -- [-345.375] (-345.718) (-346.286) (-347.039) * (-345.284) (-347.966) [-345.501] (-347.977) -- 0:01:04
99000 -- (-346.462) [-345.938] (-349.278) (-350.724) * (-345.788) (-354.315) [-345.328] (-348.181) -- 0:01:03
99500 -- (-346.129) (-349.081) (-347.990) [-345.326] * (-350.559) (-347.224) (-348.649) [-346.339] -- 0:01:03
100000 -- [-347.675] (-347.038) (-345.101) (-349.996) * (-347.237) (-350.313) (-347.031) [-346.599] -- 0:01:02
Average standard deviation of split frequencies: 0.025198
100500 -- (-346.592) (-346.986) (-348.121) [-348.779] * (-347.720) (-353.291) (-346.934) [-346.717] -- 0:01:02
101000 -- [-345.842] (-344.878) (-347.899) (-350.394) * (-347.657) (-351.243) [-346.759] (-345.508) -- 0:01:02
101500 -- [-349.983] (-344.800) (-347.260) (-351.323) * (-348.498) (-347.053) (-349.719) [-346.374] -- 0:01:01
102000 -- (-345.881) (-345.726) (-347.283) [-345.739] * (-349.858) (-346.658) (-354.057) [-351.243] -- 0:01:01
102500 -- (-347.046) (-347.901) (-348.476) [-349.568] * (-349.086) (-347.357) (-347.480) [-348.185] -- 0:01:01
103000 -- (-345.407) (-348.540) [-347.767] (-349.590) * (-347.219) (-345.288) (-348.222) [-348.439] -- 0:01:00
103500 -- [-346.002] (-346.678) (-346.496) (-346.266) * (-348.821) (-346.267) (-350.196) [-347.114] -- 0:01:00
104000 -- [-346.198] (-347.094) (-352.371) (-346.514) * (-345.563) (-353.275) [-349.227] (-352.874) -- 0:01:00
104500 -- (-350.393) (-345.756) [-351.127] (-346.108) * (-352.648) (-345.687) (-353.827) [-345.962] -- 0:00:59
105000 -- (-346.282) [-348.968] (-347.897) (-347.199) * (-349.825) (-349.573) [-347.575] (-351.385) -- 0:00:59
Average standard deviation of split frequencies: 0.023930
105500 -- (-348.584) (-349.580) (-347.597) [-346.725] * [-347.908] (-346.736) (-346.923) (-346.186) -- 0:00:59
106000 -- (-347.951) (-346.790) [-348.351] (-350.511) * (-351.482) (-348.534) [-347.633] (-346.085) -- 0:00:59
106500 -- (-351.439) (-349.521) [-344.985] (-349.214) * (-345.971) (-349.191) [-346.482] (-346.238) -- 0:00:58
107000 -- (-346.084) [-345.758] (-350.809) (-351.783) * (-345.806) [-346.545] (-346.353) (-346.729) -- 0:00:58
107500 -- (-345.981) [-345.657] (-348.227) (-348.468) * (-345.168) (-348.506) [-345.148] (-350.798) -- 0:00:58
108000 -- (-346.378) (-348.479) [-347.767] (-347.401) * [-345.401] (-347.653) (-345.809) (-346.130) -- 0:00:57
108500 -- (-345.607) (-349.452) (-351.381) [-345.770] * (-348.495) (-347.058) [-349.687] (-347.406) -- 0:00:57
109000 -- (-345.823) [-346.085] (-346.133) (-346.035) * (-345.636) [-349.657] (-347.854) (-345.915) -- 0:00:57
109500 -- (-346.020) (-351.113) [-348.218] (-345.486) * [-345.510] (-346.367) (-346.290) (-346.248) -- 0:00:56
110000 -- (-346.105) (-348.723) (-346.315) [-345.037] * (-345.850) [-348.120] (-345.764) (-347.642) -- 0:00:56
Average standard deviation of split frequencies: 0.023530
110500 -- (-345.514) (-352.631) [-349.633] (-346.186) * (-350.174) [-350.121] (-345.819) (-347.889) -- 0:01:04
111000 -- (-346.632) (-348.176) [-347.009] (-347.115) * (-349.331) (-350.053) [-345.618] (-346.404) -- 0:01:04
111500 -- (-346.408) (-352.707) (-345.759) [-346.326] * (-348.748) (-348.190) (-345.174) [-347.931] -- 0:01:03
112000 -- [-345.206] (-345.170) (-345.606) (-346.886) * (-344.945) [-348.082] (-347.292) (-347.214) -- 0:01:03
112500 -- (-346.290) (-349.200) [-345.718] (-346.958) * (-348.751) [-350.839] (-350.408) (-347.038) -- 0:01:03
113000 -- (-353.611) (-347.549) [-347.869] (-345.712) * (-345.602) (-348.879) [-346.086] (-352.280) -- 0:01:02
113500 -- (-346.535) (-347.569) (-346.228) [-346.230] * [-345.336] (-345.321) (-347.315) (-347.577) -- 0:01:02
114000 -- (-346.976) [-345.937] (-348.932) (-350.083) * (-349.039) (-345.750) (-347.494) [-347.841] -- 0:01:02
114500 -- [-346.691] (-347.500) (-346.244) (-350.224) * (-350.331) (-347.804) [-345.993] (-347.909) -- 0:01:01
115000 -- (-345.771) [-346.157] (-347.349) (-346.029) * [-347.782] (-345.024) (-347.081) (-345.840) -- 0:01:01
Average standard deviation of split frequencies: 0.023275
115500 -- [-345.928] (-346.055) (-346.345) (-348.598) * (-345.729) (-346.415) [-349.308] (-346.559) -- 0:01:01
116000 -- (-345.198) (-347.928) (-345.359) [-347.974] * (-345.643) (-347.556) (-347.445) [-351.574] -- 0:01:00
116500 -- (-345.697) (-348.447) (-346.386) [-346.314] * (-348.799) (-345.273) [-345.692] (-347.310) -- 0:01:00
117000 -- (-346.193) [-346.925] (-347.252) (-346.145) * [-345.499] (-347.129) (-349.975) (-345.803) -- 0:01:00
117500 -- [-346.718] (-348.405) (-346.138) (-345.514) * (-349.125) (-349.160) [-350.261] (-349.930) -- 0:01:00
118000 -- (-347.774) (-345.166) [-346.268] (-348.698) * (-345.965) (-350.201) [-347.337] (-349.465) -- 0:00:59
118500 -- (-349.117) [-346.533] (-348.664) (-347.152) * (-346.015) (-351.197) [-348.876] (-350.205) -- 0:00:59
119000 -- (-347.710) (-346.010) [-345.826] (-348.278) * [-347.497] (-348.498) (-346.775) (-350.875) -- 0:00:59
119500 -- (-347.795) (-345.804) [-347.851] (-346.086) * (-349.064) [-346.058] (-346.873) (-345.625) -- 0:00:58
120000 -- (-347.561) [-346.049] (-348.663) (-346.857) * (-346.442) [-346.212] (-346.794) (-346.617) -- 0:00:58
Average standard deviation of split frequencies: 0.021877
120500 -- (-346.619) (-349.344) (-346.845) [-345.628] * (-352.799) (-346.024) [-346.998] (-348.275) -- 0:00:58
121000 -- (-346.973) (-346.666) (-346.297) [-345.269] * [-346.364] (-346.337) (-352.873) (-347.358) -- 0:00:58
121500 -- (-345.813) (-347.067) (-347.470) [-345.194] * (-346.076) (-347.104) (-349.620) [-348.312] -- 0:00:57
122000 -- (-347.616) (-351.198) (-346.772) [-350.500] * (-344.940) (-348.528) [-346.809] (-346.025) -- 0:00:57
122500 -- (-346.317) (-347.718) [-345.690] (-346.166) * (-345.590) [-346.354] (-348.528) (-350.667) -- 0:00:57
123000 -- (-347.607) [-347.071] (-347.221) (-350.704) * [-346.367] (-348.424) (-344.831) (-347.675) -- 0:00:57
123500 -- (-348.769) (-344.919) (-346.850) [-345.317] * (-349.948) (-347.060) (-345.850) [-347.511] -- 0:00:56
124000 -- [-346.150] (-347.087) (-345.787) (-346.832) * (-349.714) (-348.140) (-346.490) [-348.634] -- 0:00:56
124500 -- (-348.899) [-345.554] (-345.408) (-346.572) * (-347.028) (-346.091) [-346.165] (-352.066) -- 0:00:56
125000 -- [-345.360] (-346.242) (-347.005) (-347.246) * (-346.721) (-345.788) (-346.463) [-349.327] -- 0:00:56
Average standard deviation of split frequencies: 0.022270
125500 -- (-345.359) (-346.771) [-347.781] (-345.690) * (-345.932) [-345.502] (-348.055) (-346.770) -- 0:00:55
126000 -- (-345.340) (-345.519) (-345.859) [-345.408] * (-344.897) (-346.445) (-346.317) [-350.580] -- 0:00:55
126500 -- [-345.782] (-347.598) (-345.414) (-355.477) * (-345.889) (-345.784) (-348.134) [-347.289] -- 0:00:55
127000 -- [-348.789] (-345.722) (-345.545) (-347.427) * (-347.022) (-347.321) [-346.578] (-349.471) -- 0:01:01
127500 -- (-345.551) (-346.094) [-344.865] (-347.794) * (-350.228) (-348.335) [-352.556] (-352.148) -- 0:01:01
128000 -- (-345.729) (-347.826) (-345.362) [-348.765] * (-350.462) [-345.889] (-351.223) (-348.868) -- 0:01:01
128500 -- (-346.370) [-351.556] (-345.509) (-347.012) * [-346.937] (-347.052) (-356.094) (-346.515) -- 0:01:01
129000 -- [-346.736] (-348.398) (-349.180) (-345.489) * (-349.477) (-345.997) (-354.867) [-346.006] -- 0:01:00
129500 -- [-345.517] (-349.052) (-347.592) (-350.108) * (-347.888) (-347.419) (-350.245) [-345.835] -- 0:01:00
130000 -- (-346.089) (-350.059) (-348.054) [-348.930] * (-347.152) (-345.554) [-351.372] (-346.262) -- 0:01:00
Average standard deviation of split frequencies: 0.022333
130500 -- [-347.147] (-347.066) (-347.260) (-348.228) * (-346.007) (-346.443) (-347.658) [-345.161] -- 0:00:59
131000 -- (-345.722) [-346.131] (-348.482) (-355.404) * (-346.302) (-352.382) [-345.635] (-346.421) -- 0:00:59
131500 -- (-345.708) (-347.974) [-346.483] (-349.784) * (-345.914) (-349.588) [-350.494] (-347.976) -- 0:00:59
132000 -- (-347.400) [-347.087] (-346.041) (-347.146) * (-347.463) (-345.483) (-351.008) [-346.087] -- 0:00:59
132500 -- (-350.537) (-347.015) (-346.656) [-345.621] * [-346.853] (-349.551) (-346.985) (-348.688) -- 0:00:58
133000 -- (-348.364) (-349.169) [-346.463] (-346.322) * [-351.031] (-354.155) (-346.678) (-350.189) -- 0:00:58
133500 -- (-346.483) (-350.427) (-346.576) [-346.604] * (-348.188) (-350.257) (-346.761) [-350.339] -- 0:00:58
134000 -- [-346.119] (-351.234) (-350.644) (-349.797) * (-350.138) [-346.557] (-347.041) (-347.968) -- 0:00:58
134500 -- (-349.917) [-353.292] (-348.441) (-346.807) * (-346.967) (-345.928) (-346.793) [-347.245] -- 0:00:57
135000 -- [-346.277] (-347.604) (-347.024) (-348.699) * (-345.649) (-347.350) [-345.608] (-345.613) -- 0:00:57
Average standard deviation of split frequencies: 0.020194
135500 -- (-352.006) [-349.816] (-347.911) (-350.912) * [-345.770] (-349.384) (-348.870) (-354.417) -- 0:00:57
136000 -- (-346.904) (-352.315) [-349.070] (-351.011) * (-345.141) (-351.036) [-345.429] (-350.101) -- 0:00:57
136500 -- (-346.944) (-346.914) (-349.364) [-348.036] * (-347.837) (-345.240) [-345.584] (-349.450) -- 0:00:56
137000 -- (-346.360) (-345.604) (-346.096) [-345.248] * [-346.063] (-346.524) (-345.995) (-349.177) -- 0:00:56
137500 -- (-346.496) [-344.986] (-345.879) (-346.640) * (-348.020) (-347.613) [-347.611] (-351.191) -- 0:00:56
138000 -- [-346.822] (-347.475) (-345.634) (-348.314) * (-346.712) [-347.920] (-346.229) (-347.699) -- 0:00:56
138500 -- [-346.117] (-345.871) (-345.833) (-347.438) * (-347.981) (-348.060) (-346.779) [-346.811] -- 0:00:55
139000 -- (-345.546) (-346.117) (-348.278) [-348.616] * (-346.027) [-346.459] (-351.564) (-349.121) -- 0:00:55
139500 -- (-346.765) (-346.595) [-346.920] (-346.069) * (-351.314) [-345.730] (-345.923) (-349.794) -- 0:00:55
140000 -- (-348.660) (-351.544) (-345.023) [-345.405] * (-350.416) (-346.413) [-345.525] (-347.794) -- 0:00:55
Average standard deviation of split frequencies: 0.019670
140500 -- (-345.590) (-348.492) (-345.437) [-348.118] * (-348.850) (-345.375) [-345.301] (-348.063) -- 0:00:55
141000 -- (-349.013) (-346.000) (-346.584) [-346.799] * (-349.960) (-348.732) (-346.459) [-347.644] -- 0:00:54
141500 -- (-346.678) (-345.679) (-349.391) [-349.018] * (-346.247) (-349.367) [-347.618] (-345.023) -- 0:00:54
142000 -- (-346.256) [-346.623] (-349.307) (-349.201) * (-346.415) (-345.766) (-348.894) [-348.454] -- 0:00:54
142500 -- (-347.320) (-347.315) (-349.566) [-345.184] * (-347.189) (-346.885) (-347.895) [-347.563] -- 0:00:54
143000 -- (-348.979) (-348.826) (-346.896) [-347.968] * (-349.458) (-346.032) (-345.891) [-347.080] -- 0:00:53
143500 -- [-346.019] (-347.269) (-345.399) (-350.331) * (-347.700) [-347.191] (-349.911) (-345.851) -- 0:00:53
144000 -- (-345.214) [-348.469] (-350.360) (-347.476) * (-348.256) [-345.561] (-344.945) (-346.176) -- 0:00:59
144500 -- [-347.377] (-351.297) (-347.460) (-347.641) * [-345.487] (-346.591) (-346.194) (-345.273) -- 0:00:59
145000 -- (-355.416) (-346.609) (-346.309) [-345.329] * (-346.558) (-348.660) [-347.044] (-348.501) -- 0:00:58
Average standard deviation of split frequencies: 0.020355
145500 -- [-345.178] (-345.500) (-346.484) (-345.918) * (-348.880) (-346.376) [-345.604] (-345.779) -- 0:00:58
146000 -- (-348.160) (-348.419) [-351.150] (-345.833) * [-346.221] (-349.985) (-349.318) (-346.144) -- 0:00:58
146500 -- (-349.738) (-345.789) (-345.691) [-345.539] * (-347.485) [-348.165] (-346.281) (-348.513) -- 0:00:58
147000 -- (-348.152) (-345.598) [-345.475] (-347.691) * (-345.029) (-349.696) [-346.079] (-346.691) -- 0:00:58
147500 -- [-346.251] (-348.477) (-347.798) (-346.223) * [-345.411] (-347.781) (-346.124) (-346.335) -- 0:00:57
148000 -- [-345.431] (-351.076) (-347.384) (-347.251) * [-346.968] (-346.008) (-346.439) (-348.963) -- 0:00:57
148500 -- (-347.360) [-348.589] (-348.204) (-348.853) * (-347.212) [-348.210] (-349.079) (-351.075) -- 0:00:57
149000 -- (-345.308) (-347.205) [-347.198] (-347.402) * (-345.765) (-346.869) (-348.031) [-347.043] -- 0:00:57
149500 -- (-350.431) (-348.176) (-347.634) [-346.216] * [-346.675] (-347.481) (-346.183) (-348.666) -- 0:00:56
150000 -- [-346.256] (-347.310) (-347.748) (-347.339) * [-346.365] (-345.593) (-346.019) (-349.171) -- 0:00:56
Average standard deviation of split frequencies: 0.019342
150500 -- (-348.134) (-347.899) [-349.049] (-353.223) * (-346.168) [-345.586] (-348.018) (-347.137) -- 0:00:56
151000 -- [-345.073] (-348.132) (-346.502) (-351.017) * [-345.523] (-351.121) (-346.388) (-345.103) -- 0:00:56
151500 -- [-345.376] (-347.719) (-348.233) (-351.787) * (-345.428) (-346.933) [-346.831] (-347.375) -- 0:00:56
152000 -- (-348.187) (-347.903) [-345.209] (-349.102) * (-347.146) (-346.861) [-345.691] (-346.449) -- 0:00:55
152500 -- [-349.237] (-346.438) (-345.790) (-345.027) * (-348.028) (-349.338) (-347.905) [-347.011] -- 0:00:55
153000 -- (-347.129) (-347.810) (-346.389) [-346.918] * [-345.217] (-348.966) (-347.576) (-349.582) -- 0:00:55
153500 -- (-346.058) (-347.635) [-346.233] (-348.272) * [-345.404] (-346.553) (-351.463) (-347.425) -- 0:00:55
154000 -- (-345.389) (-348.187) [-345.277] (-346.044) * (-350.049) (-346.942) [-349.578] (-347.422) -- 0:00:54
154500 -- (-345.799) (-345.565) (-349.646) [-347.601] * (-347.093) (-347.149) (-348.006) [-348.179] -- 0:00:54
155000 -- (-350.805) (-348.327) [-346.786] (-346.964) * (-348.366) [-350.382] (-346.985) (-347.738) -- 0:00:54
Average standard deviation of split frequencies: 0.019714
155500 -- (-346.180) (-347.410) (-346.163) [-347.383] * (-352.264) (-349.197) (-350.277) [-349.608] -- 0:00:54
156000 -- (-346.947) [-344.996] (-345.196) (-345.525) * (-345.138) (-345.516) [-347.253] (-350.308) -- 0:00:54
156500 -- (-350.346) (-347.148) [-347.208] (-349.363) * (-352.220) [-347.591] (-347.724) (-347.051) -- 0:00:53
157000 -- (-348.794) (-349.321) (-350.234) [-350.144] * (-345.236) (-346.490) [-347.367] (-349.575) -- 0:00:53
157500 -- (-346.013) (-345.223) (-345.723) [-351.001] * (-346.198) (-346.022) (-346.549) [-346.800] -- 0:00:53
158000 -- (-347.047) (-346.426) (-345.525) [-347.988] * (-345.558) [-347.491] (-347.112) (-350.296) -- 0:00:53
158500 -- (-345.857) (-348.840) [-347.331] (-346.468) * [-346.042] (-345.763) (-346.601) (-352.725) -- 0:00:53
159000 -- (-345.952) (-345.844) (-346.394) [-347.162] * (-349.955) [-350.232] (-347.569) (-348.546) -- 0:00:52
159500 -- (-345.430) (-351.125) (-346.895) [-346.266] * (-349.835) [-346.161] (-350.596) (-346.593) -- 0:00:52
160000 -- (-346.587) [-348.198] (-345.658) (-346.144) * (-345.986) [-345.976] (-347.311) (-347.297) -- 0:00:52
Average standard deviation of split frequencies: 0.021125
160500 -- [-347.275] (-346.139) (-345.792) (-346.426) * (-346.399) (-345.473) (-345.903) [-348.007] -- 0:00:52
161000 -- (-348.194) (-345.727) (-348.950) [-347.320] * [-346.290] (-349.708) (-346.221) (-347.106) -- 0:00:52
161500 -- (-348.740) (-348.225) (-345.463) [-346.077] * [-349.338] (-347.057) (-347.817) (-347.009) -- 0:00:57
162000 -- (-349.498) (-349.116) [-347.439] (-345.887) * [-352.616] (-351.871) (-346.690) (-346.624) -- 0:00:56
162500 -- (-348.072) (-350.941) [-347.896] (-347.766) * (-351.073) (-347.106) [-346.397] (-348.571) -- 0:00:56
163000 -- (-347.574) (-347.411) [-349.906] (-345.333) * (-345.876) (-348.548) (-349.947) [-350.515] -- 0:00:56
163500 -- (-347.470) (-347.061) [-345.983] (-349.163) * (-345.301) [-346.776] (-345.934) (-347.088) -- 0:00:56
164000 -- [-347.566] (-345.760) (-349.444) (-345.732) * (-345.982) [-346.842] (-345.679) (-346.308) -- 0:00:56
164500 -- (-348.296) (-350.220) (-345.919) [-346.259] * (-345.625) (-349.924) (-351.929) [-345.422] -- 0:00:55
165000 -- (-345.955) (-350.749) [-345.020] (-347.278) * (-346.321) (-350.344) (-347.310) [-347.128] -- 0:00:55
Average standard deviation of split frequencies: 0.020304
165500 -- [-344.823] (-347.752) (-347.331) (-349.297) * (-347.056) (-345.887) (-348.899) [-348.334] -- 0:00:55
166000 -- (-345.764) (-350.471) (-347.891) [-346.328] * (-345.942) (-348.560) [-347.467] (-345.677) -- 0:00:55
166500 -- (-345.139) [-348.908] (-346.369) (-347.338) * (-346.964) [-344.997] (-346.377) (-347.969) -- 0:00:55
167000 -- (-345.960) (-347.557) [-346.621] (-345.295) * (-348.443) (-346.526) [-345.109] (-345.513) -- 0:00:54
167500 -- (-348.248) [-345.329] (-346.465) (-348.498) * (-346.508) [-346.490] (-348.185) (-345.757) -- 0:00:54
168000 -- [-348.895] (-350.054) (-348.032) (-345.613) * [-346.063] (-346.756) (-345.022) (-345.827) -- 0:00:54
168500 -- (-348.319) (-347.175) (-348.439) [-347.059] * [-345.339] (-350.152) (-345.061) (-350.793) -- 0:00:54
169000 -- (-347.246) [-345.328] (-346.045) (-347.271) * (-345.734) [-346.943] (-346.259) (-349.996) -- 0:00:54
169500 -- [-346.633] (-348.775) (-348.882) (-347.519) * (-346.980) [-347.787] (-348.545) (-348.369) -- 0:00:53
170000 -- (-345.570) (-345.091) (-347.802) [-347.261] * [-351.299] (-346.931) (-345.889) (-347.270) -- 0:00:53
Average standard deviation of split frequencies: 0.020440
170500 -- (-348.229) (-347.291) [-346.853] (-347.824) * (-346.727) [-346.729] (-345.867) (-346.098) -- 0:00:53
171000 -- (-346.863) (-346.078) (-347.279) [-346.812] * (-345.746) (-348.041) [-346.389] (-346.767) -- 0:00:53
171500 -- [-347.617] (-347.955) (-345.437) (-349.733) * (-346.060) (-347.285) (-348.711) [-346.951] -- 0:00:53
172000 -- (-346.411) (-348.201) [-350.704] (-350.281) * (-345.664) (-352.231) (-348.390) [-347.676] -- 0:00:52
172500 -- (-351.256) (-347.630) (-348.761) [-346.246] * [-348.076] (-348.949) (-346.464) (-350.110) -- 0:00:52
173000 -- [-346.163] (-349.968) (-352.101) (-346.913) * [-345.672] (-348.282) (-347.233) (-350.829) -- 0:00:52
173500 -- (-349.385) (-349.935) [-345.618] (-348.630) * (-345.843) (-354.943) (-348.700) [-348.545] -- 0:00:52
174000 -- [-346.649] (-348.188) (-346.703) (-346.975) * (-345.414) (-347.516) (-346.599) [-345.957] -- 0:00:52
174500 -- (-348.371) (-346.177) [-346.645] (-349.038) * (-347.021) [-348.037] (-345.980) (-347.180) -- 0:00:52
175000 -- (-349.451) (-354.629) [-350.173] (-346.179) * [-347.425] (-348.217) (-347.305) (-346.731) -- 0:00:51
Average standard deviation of split frequencies: 0.020300
175500 -- (-346.649) (-353.568) (-347.955) [-351.246] * [-345.941] (-345.962) (-346.106) (-346.945) -- 0:00:51
176000 -- [-346.023] (-346.702) (-350.889) (-346.940) * (-349.182) (-348.524) [-346.468] (-350.348) -- 0:00:51
176500 -- (-345.056) [-347.073] (-347.966) (-346.170) * (-345.881) [-347.154] (-345.058) (-348.686) -- 0:00:51
177000 -- (-347.822) (-345.685) (-347.741) [-348.286] * (-353.735) (-350.902) [-346.690] (-345.753) -- 0:00:51
177500 -- (-359.652) (-346.592) [-347.577] (-345.675) * (-348.004) (-350.333) [-347.324] (-347.488) -- 0:00:50
178000 -- (-345.945) [-345.067] (-350.167) (-347.924) * [-347.779] (-346.833) (-347.386) (-347.559) -- 0:00:50
178500 -- [-346.523] (-345.881) (-345.414) (-347.266) * (-347.075) (-346.545) [-345.092] (-347.321) -- 0:00:50
179000 -- (-346.546) (-347.024) (-345.633) [-348.276] * (-352.115) (-345.940) [-345.725] (-346.601) -- 0:00:55
179500 -- [-346.705] (-345.232) (-345.014) (-347.446) * (-350.080) (-345.688) [-346.918] (-345.046) -- 0:00:54
180000 -- (-346.704) (-350.378) [-348.021] (-347.159) * [-347.485] (-348.491) (-345.775) (-347.909) -- 0:00:54
Average standard deviation of split frequencies: 0.018951
180500 -- (-349.087) (-350.724) [-346.508] (-345.088) * [-349.482] (-348.078) (-345.359) (-345.679) -- 0:00:54
181000 -- (-350.442) [-348.564] (-351.699) (-349.836) * [-348.801] (-351.487) (-345.740) (-345.558) -- 0:00:54
181500 -- (-355.528) [-345.647] (-346.030) (-348.917) * (-347.334) (-346.326) [-347.516] (-344.826) -- 0:00:54
182000 -- [-347.826] (-345.087) (-346.389) (-351.150) * [-346.665] (-345.475) (-345.851) (-345.714) -- 0:00:53
182500 -- (-345.438) [-346.799] (-346.056) (-350.573) * (-350.414) (-345.691) (-346.463) [-345.263] -- 0:00:53
183000 -- [-346.390] (-346.934) (-345.069) (-346.259) * (-347.648) [-345.824] (-345.893) (-346.861) -- 0:00:53
183500 -- (-345.843) [-348.393] (-346.189) (-346.311) * (-350.073) [-346.769] (-345.606) (-348.965) -- 0:00:53
184000 -- [-349.235] (-348.051) (-350.726) (-345.747) * [-347.692] (-347.635) (-349.119) (-345.773) -- 0:00:53
184500 -- [-347.469] (-346.669) (-349.945) (-346.285) * [-345.009] (-350.164) (-350.054) (-345.852) -- 0:00:53
185000 -- [-348.738] (-347.685) (-348.166) (-345.850) * (-344.810) [-355.277] (-347.428) (-348.879) -- 0:00:52
Average standard deviation of split frequencies: 0.017994
185500 -- (-345.275) (-346.947) [-345.986] (-348.705) * [-346.785] (-347.440) (-347.029) (-348.012) -- 0:00:52
186000 -- (-346.082) (-349.487) [-345.996] (-346.915) * (-346.508) (-352.446) (-347.431) [-347.989] -- 0:00:52
186500 -- (-348.551) (-345.292) (-349.111) [-345.616] * [-346.376] (-350.117) (-346.689) (-349.139) -- 0:00:52
187000 -- (-346.984) [-346.214] (-347.337) (-348.211) * [-345.736] (-348.108) (-350.408) (-346.706) -- 0:00:52
187500 -- (-347.046) [-347.176] (-348.901) (-348.986) * [-345.857] (-349.263) (-347.994) (-350.349) -- 0:00:52
188000 -- [-347.354] (-349.342) (-347.803) (-346.823) * (-345.738) [-346.954] (-346.307) (-347.376) -- 0:00:51
188500 -- [-349.696] (-348.006) (-346.852) (-352.444) * (-349.553) (-345.462) (-348.478) [-347.048] -- 0:00:51
189000 -- (-346.842) [-347.545] (-347.223) (-349.575) * (-346.846) (-345.669) [-346.928] (-347.286) -- 0:00:51
189500 -- (-346.088) (-346.373) (-348.688) [-348.460] * (-345.788) (-348.372) [-345.688] (-351.230) -- 0:00:51
190000 -- (-345.902) (-347.060) (-351.399) [-346.564] * [-346.668] (-348.503) (-350.571) (-346.494) -- 0:00:51
Average standard deviation of split frequencies: 0.017060
190500 -- (-346.387) (-352.483) (-349.418) [-345.656] * [-345.543] (-346.725) (-350.066) (-346.945) -- 0:00:50
191000 -- (-349.620) [-348.015] (-348.777) (-346.247) * (-345.723) (-345.523) [-346.045] (-346.894) -- 0:00:50
191500 -- [-346.665] (-346.761) (-348.325) (-347.766) * (-346.995) (-349.469) [-347.167] (-347.293) -- 0:00:50
192000 -- [-347.393] (-345.077) (-348.536) (-346.673) * [-346.861] (-345.953) (-345.232) (-347.960) -- 0:00:50
192500 -- (-352.697) [-346.691] (-350.710) (-345.935) * [-345.563] (-346.952) (-347.228) (-349.356) -- 0:00:50
193000 -- (-348.110) (-345.782) [-349.022] (-346.988) * (-347.757) (-346.036) (-346.838) [-346.600] -- 0:00:50
193500 -- (-352.445) (-346.453) [-346.703] (-346.810) * [-347.366] (-346.628) (-346.543) (-345.168) -- 0:00:50
194000 -- (-346.131) (-348.797) (-346.736) [-346.036] * (-348.475) [-346.702] (-348.843) (-346.446) -- 0:00:49
194500 -- (-347.261) [-346.470] (-345.540) (-346.586) * (-347.521) (-348.273) [-346.323] (-346.320) -- 0:00:49
195000 -- (-347.848) (-347.112) (-347.073) [-345.498] * (-345.784) [-346.651] (-346.117) (-344.818) -- 0:00:49
Average standard deviation of split frequencies: 0.016355
195500 -- (-350.000) [-349.228] (-345.450) (-348.006) * [-346.183] (-345.425) (-350.271) (-348.332) -- 0:00:49
196000 -- [-349.677] (-348.939) (-346.844) (-345.960) * (-348.991) (-349.645) (-346.037) [-348.461] -- 0:00:53
196500 -- (-345.221) (-350.243) [-346.914] (-344.969) * [-347.872] (-348.866) (-346.892) (-346.163) -- 0:00:53
197000 -- (-346.002) (-345.862) (-345.338) [-346.984] * (-350.997) (-350.307) (-346.006) [-347.587] -- 0:00:52
197500 -- (-345.492) (-347.826) [-346.914] (-348.411) * (-347.319) (-349.560) [-349.387] (-349.311) -- 0:00:52
198000 -- (-346.308) (-347.928) (-347.618) [-346.868] * (-345.754) (-346.037) (-346.625) [-347.485] -- 0:00:52
198500 -- [-347.727] (-347.343) (-347.688) (-348.429) * [-348.679] (-349.036) (-345.928) (-346.603) -- 0:00:52
199000 -- (-346.681) (-345.557) [-345.330] (-348.282) * (-345.761) [-348.504] (-346.280) (-346.496) -- 0:00:52
199500 -- [-348.717] (-345.856) (-346.622) (-351.070) * [-348.019] (-347.224) (-345.938) (-346.745) -- 0:00:52
200000 -- (-347.878) (-346.328) (-347.062) [-346.215] * (-346.992) [-346.006] (-348.958) (-346.418) -- 0:00:51
Average standard deviation of split frequencies: 0.015505
200500 -- [-346.999] (-347.993) (-351.507) (-346.000) * (-345.488) [-347.144] (-348.335) (-345.567) -- 0:00:51
201000 -- (-348.567) (-347.060) (-351.237) [-351.002] * (-346.862) [-346.632] (-348.334) (-346.738) -- 0:00:51
201500 -- (-352.160) [-347.603] (-349.488) (-346.952) * [-345.375] (-348.706) (-351.053) (-350.104) -- 0:00:51
202000 -- (-354.115) [-346.099] (-346.506) (-346.874) * [-348.033] (-345.795) (-347.841) (-352.395) -- 0:00:51
202500 -- [-347.464] (-348.867) (-353.383) (-349.005) * (-346.623) (-351.360) [-350.493] (-349.564) -- 0:00:51
203000 -- [-348.049] (-346.644) (-349.165) (-347.140) * (-347.285) [-346.373] (-347.710) (-345.745) -- 0:00:51
203500 -- (-348.604) (-346.842) (-348.268) [-346.429] * [-345.864] (-349.776) (-348.409) (-348.909) -- 0:00:50
204000 -- (-345.966) [-345.223] (-346.180) (-349.519) * (-347.988) (-348.874) [-349.154] (-348.885) -- 0:00:50
204500 -- (-349.525) (-345.249) (-346.992) [-348.989] * (-346.909) [-348.622] (-345.179) (-349.167) -- 0:00:50
205000 -- (-346.802) (-347.024) (-347.465) [-346.582] * (-344.914) (-345.733) (-346.540) [-347.621] -- 0:00:50
Average standard deviation of split frequencies: 0.014989
205500 -- (-346.038) [-346.919] (-348.071) (-348.144) * (-346.132) (-345.087) [-347.698] (-348.920) -- 0:00:50
206000 -- [-348.376] (-345.953) (-349.321) (-347.186) * (-345.582) [-347.220] (-345.670) (-345.792) -- 0:00:50
206500 -- (-347.848) [-346.481] (-346.403) (-347.063) * (-347.400) [-347.429] (-346.072) (-346.837) -- 0:00:49
207000 -- (-345.515) (-347.722) [-346.150] (-346.592) * (-350.664) (-345.271) (-353.044) [-346.226] -- 0:00:49
207500 -- (-346.941) [-348.586] (-346.582) (-346.852) * (-347.183) (-347.577) [-345.352] (-348.968) -- 0:00:49
208000 -- (-346.408) [-345.605] (-345.101) (-346.830) * (-348.981) (-348.665) [-346.268] (-347.684) -- 0:00:49
208500 -- [-346.362] (-348.452) (-345.303) (-346.460) * (-351.715) (-346.893) [-346.935] (-349.702) -- 0:00:49
209000 -- (-345.863) (-347.375) [-349.148] (-347.579) * (-345.177) (-346.133) (-347.712) [-348.538] -- 0:00:49
209500 -- (-347.046) (-347.536) [-346.430] (-346.032) * (-353.719) [-346.618] (-351.446) (-346.799) -- 0:00:49
210000 -- (-347.713) [-347.871] (-347.663) (-344.903) * (-351.853) [-345.194] (-347.954) (-345.898) -- 0:00:48
Average standard deviation of split frequencies: 0.016606
210500 -- [-350.045] (-348.276) (-349.356) (-347.245) * [-347.905] (-345.334) (-345.549) (-350.734) -- 0:00:48
211000 -- (-345.661) (-349.326) (-346.235) [-346.381] * (-349.029) (-348.675) [-350.921] (-348.056) -- 0:00:48
211500 -- (-348.295) (-350.443) [-346.021] (-348.629) * (-347.142) (-345.946) [-345.047] (-347.264) -- 0:00:48
212000 -- [-349.473] (-347.594) (-345.164) (-347.999) * (-345.294) (-345.710) (-347.601) [-344.801] -- 0:00:48
212500 -- (-350.043) (-348.380) [-348.909] (-347.961) * (-346.997) (-345.497) (-345.825) [-345.038] -- 0:00:48
213000 -- (-346.479) [-345.360] (-349.042) (-351.115) * [-346.320] (-346.182) (-345.836) (-346.697) -- 0:00:51
213500 -- (-345.575) [-345.971] (-349.108) (-347.047) * [-345.707] (-346.335) (-347.610) (-350.028) -- 0:00:51
214000 -- (-344.836) (-347.787) [-350.541] (-346.518) * (-345.978) (-347.198) [-346.555] (-349.555) -- 0:00:51
214500 -- (-346.825) (-347.905) (-345.881) [-345.628] * (-348.089) (-350.350) [-346.695] (-349.127) -- 0:00:51
215000 -- (-346.723) (-348.153) (-347.941) [-348.960] * (-349.037) [-346.726] (-347.727) (-349.464) -- 0:00:51
Average standard deviation of split frequencies: 0.017338
215500 -- [-345.512] (-345.467) (-346.670) (-348.883) * (-348.807) [-346.234] (-346.796) (-345.890) -- 0:00:50
216000 -- (-346.465) (-346.778) [-345.359] (-346.378) * [-346.196] (-346.123) (-347.256) (-350.003) -- 0:00:50
216500 -- (-345.509) [-350.234] (-344.950) (-346.802) * [-347.080] (-350.094) (-349.285) (-348.924) -- 0:00:50
217000 -- [-351.499] (-347.705) (-348.700) (-349.592) * (-347.936) (-346.624) (-348.272) [-347.709] -- 0:00:50
217500 -- (-347.862) (-348.048) [-345.967] (-350.135) * (-345.883) (-347.664) (-348.677) [-349.074] -- 0:00:50
218000 -- (-346.274) (-346.817) [-346.592] (-346.295) * (-347.164) [-345.017] (-346.239) (-346.097) -- 0:00:50
218500 -- (-349.177) [-346.883] (-347.881) (-349.854) * (-346.568) (-346.497) [-345.561] (-346.562) -- 0:00:50
219000 -- (-346.737) (-347.471) (-347.942) [-348.622] * (-348.813) [-349.814] (-346.523) (-345.938) -- 0:00:49
219500 -- (-348.461) (-347.411) (-348.135) [-348.014] * (-346.642) (-350.490) (-347.850) [-345.542] -- 0:00:49
220000 -- (-347.947) [-345.809] (-345.961) (-346.572) * (-346.179) (-352.036) [-345.440] (-346.991) -- 0:00:49
Average standard deviation of split frequencies: 0.016734
220500 -- (-348.328) [-348.680] (-346.071) (-347.376) * (-347.744) (-346.425) [-346.568] (-350.951) -- 0:00:49
221000 -- (-346.082) (-346.518) [-345.263] (-347.570) * (-348.992) (-349.142) [-345.913] (-349.686) -- 0:00:49
221500 -- (-347.643) (-348.525) [-348.068] (-351.490) * (-346.579) [-346.972] (-347.449) (-346.732) -- 0:00:49
222000 -- (-346.633) (-350.507) [-345.156] (-346.880) * (-346.296) [-345.591] (-346.886) (-349.824) -- 0:00:49
222500 -- (-345.129) (-348.210) (-346.228) [-346.659] * [-346.049] (-350.489) (-346.655) (-348.457) -- 0:00:48
223000 -- (-346.634) (-348.599) (-346.049) [-345.101] * (-349.178) [-347.776] (-345.790) (-348.013) -- 0:00:48
223500 -- (-346.648) [-346.508] (-347.249) (-347.839) * [-351.333] (-347.367) (-345.992) (-345.199) -- 0:00:48
224000 -- (-347.956) [-345.943] (-350.836) (-346.540) * (-345.415) [-347.466] (-348.072) (-348.434) -- 0:00:48
224500 -- (-348.381) (-345.832) [-346.218] (-352.303) * (-345.291) [-348.454] (-346.489) (-349.108) -- 0:00:48
225000 -- (-346.658) (-346.854) (-346.088) [-345.799] * (-345.403) (-346.783) [-347.068] (-346.938) -- 0:00:48
Average standard deviation of split frequencies: 0.015644
225500 -- [-346.045] (-350.256) (-346.936) (-347.712) * (-348.663) (-348.573) (-346.671) [-346.016] -- 0:00:48
226000 -- [-347.349] (-346.512) (-348.197) (-346.372) * (-349.885) [-347.532] (-346.461) (-349.937) -- 0:00:47
226500 -- (-348.368) (-348.078) (-346.467) [-347.000] * (-345.475) [-346.691] (-346.267) (-346.868) -- 0:00:47
227000 -- (-348.349) (-347.542) (-345.943) [-347.700] * (-345.762) (-345.899) [-345.826] (-347.639) -- 0:00:47
227500 -- (-348.564) (-345.545) (-345.686) [-345.729] * (-345.850) (-347.449) [-345.872] (-345.751) -- 0:00:47
228000 -- (-345.467) [-345.279] (-345.670) (-347.787) * (-347.124) (-347.314) [-346.185] (-348.704) -- 0:00:47
228500 -- (-347.038) (-348.023) [-346.238] (-348.217) * (-345.709) (-347.205) (-345.944) [-346.309] -- 0:00:47
229000 -- [-349.607] (-347.427) (-347.034) (-345.291) * [-346.462] (-349.307) (-346.072) (-347.773) -- 0:00:47
229500 -- (-346.477) (-345.930) (-344.944) [-345.628] * [-346.093] (-346.577) (-345.627) (-345.426) -- 0:00:47
230000 -- (-348.600) (-346.153) (-345.514) [-346.193] * (-349.102) (-347.455) (-346.130) [-345.458] -- 0:00:50
Average standard deviation of split frequencies: 0.017371
230500 -- (-352.351) (-347.036) [-345.734] (-346.856) * [-345.371] (-346.840) (-345.641) (-347.941) -- 0:00:50
231000 -- [-345.711] (-348.654) (-351.807) (-348.051) * [-345.117] (-347.028) (-346.124) (-347.291) -- 0:00:49
231500 -- (-347.398) (-345.604) [-346.257] (-351.775) * (-345.975) [-347.755] (-345.912) (-346.933) -- 0:00:49
232000 -- [-345.836] (-346.379) (-346.574) (-350.230) * (-345.962) (-346.906) (-350.581) [-345.310] -- 0:00:49
232500 -- (-345.701) (-345.379) (-348.568) [-349.012] * (-346.422) [-345.092] (-346.728) (-346.634) -- 0:00:49
233000 -- (-346.647) [-346.383] (-349.914) (-347.050) * (-345.536) (-346.320) (-345.559) [-345.247] -- 0:00:49
233500 -- (-346.876) (-350.768) (-348.765) [-346.722] * (-348.425) [-348.729] (-347.798) (-348.121) -- 0:00:49
234000 -- (-351.580) (-348.130) [-347.183] (-347.447) * (-345.051) [-345.675] (-348.210) (-345.461) -- 0:00:49
234500 -- (-350.653) (-350.229) [-346.489] (-347.546) * [-348.127] (-346.498) (-348.065) (-347.904) -- 0:00:48
235000 -- (-345.574) (-347.094) (-355.137) [-347.049] * (-348.352) [-345.665] (-348.240) (-348.346) -- 0:00:48
Average standard deviation of split frequencies: 0.016836
235500 -- (-350.495) (-349.202) [-352.115] (-347.136) * (-348.954) (-346.801) (-347.493) [-346.087] -- 0:00:48
236000 -- (-347.840) (-349.014) [-348.865] (-348.489) * (-346.799) [-345.759] (-347.645) (-347.236) -- 0:00:48
236500 -- [-345.712] (-349.226) (-346.016) (-347.129) * (-345.364) (-345.552) [-347.201] (-346.722) -- 0:00:48
237000 -- (-348.690) (-354.196) [-346.889] (-347.745) * (-347.094) (-349.978) [-345.405] (-347.900) -- 0:00:48
237500 -- (-346.010) (-345.087) [-348.377] (-346.532) * (-345.860) (-346.084) (-346.971) [-346.964] -- 0:00:48
238000 -- (-351.187) [-346.339] (-347.040) (-346.455) * [-345.890] (-352.384) (-348.784) (-351.461) -- 0:00:48
238500 -- (-347.971) (-345.683) [-347.853] (-350.976) * (-347.389) (-348.964) [-346.674] (-347.626) -- 0:00:47
239000 -- [-346.975] (-347.400) (-349.132) (-349.775) * [-345.650] (-347.171) (-347.636) (-347.358) -- 0:00:47
239500 -- [-346.224] (-351.561) (-347.206) (-347.113) * (-346.841) (-348.689) (-346.094) [-349.895] -- 0:00:47
240000 -- [-346.834] (-348.149) (-350.194) (-346.545) * (-348.733) (-348.218) [-347.047] (-345.934) -- 0:00:47
Average standard deviation of split frequencies: 0.016453
240500 -- (-348.806) (-348.392) (-345.901) [-347.390] * (-348.333) [-348.169] (-347.999) (-347.384) -- 0:00:47
241000 -- (-350.241) (-350.180) (-345.587) [-347.015] * (-346.973) (-347.879) (-346.012) [-346.599] -- 0:00:47
241500 -- (-348.686) (-345.417) (-345.412) [-346.819] * (-346.863) (-348.787) [-345.692] (-347.675) -- 0:00:47
242000 -- [-347.007] (-345.392) (-348.276) (-350.272) * [-346.208] (-350.936) (-347.017) (-345.620) -- 0:00:46
242500 -- (-349.734) [-347.800] (-350.216) (-345.780) * [-345.963] (-347.095) (-345.451) (-345.624) -- 0:00:46
243000 -- [-349.119] (-349.486) (-348.316) (-345.486) * (-347.842) (-345.501) [-347.131] (-346.368) -- 0:00:46
243500 -- (-347.620) (-346.912) [-352.284] (-346.781) * [-347.343] (-347.063) (-346.097) (-347.086) -- 0:00:46
244000 -- (-347.623) (-345.961) [-350.014] (-346.302) * [-345.872] (-347.802) (-350.046) (-346.279) -- 0:00:46
244500 -- [-345.813] (-346.115) (-346.210) (-348.272) * (-345.843) (-348.733) (-345.849) [-352.210] -- 0:00:46
245000 -- (-350.064) (-346.598) (-348.885) [-350.612] * [-346.903] (-353.343) (-346.350) (-349.459) -- 0:00:46
Average standard deviation of split frequencies: 0.016973
245500 -- (-345.892) (-345.252) (-348.001) [-348.367] * (-344.691) (-355.882) (-346.138) [-350.465] -- 0:00:46
246000 -- (-347.341) [-347.321] (-349.764) (-348.883) * (-347.266) [-348.621] (-346.139) (-348.665) -- 0:00:45
246500 -- [-347.078] (-345.150) (-346.519) (-352.312) * (-347.400) (-348.657) [-345.270] (-353.119) -- 0:00:45
247000 -- [-347.125] (-345.516) (-346.471) (-346.605) * (-347.424) (-348.031) [-346.503] (-346.731) -- 0:00:45
247500 -- (-350.627) (-346.154) [-348.553] (-346.336) * (-348.512) (-348.601) [-348.716] (-345.372) -- 0:00:48
248000 -- (-346.001) (-345.592) (-345.624) [-345.746] * (-347.669) (-348.022) (-351.757) [-345.741] -- 0:00:48
248500 -- [-347.133] (-346.305) (-346.378) (-345.733) * [-347.876] (-346.794) (-346.976) (-345.387) -- 0:00:48
249000 -- (-348.497) (-348.851) (-348.342) [-345.131] * (-346.992) (-347.015) [-347.038] (-346.026) -- 0:00:48
249500 -- (-356.114) (-346.063) (-345.735) [-347.765] * (-346.126) [-346.534] (-348.820) (-345.986) -- 0:00:48
250000 -- (-345.263) (-347.379) [-347.155] (-344.919) * (-346.137) [-347.975] (-346.301) (-346.262) -- 0:00:48
Average standard deviation of split frequencies: 0.017019
250500 -- (-349.816) (-346.011) (-345.274) [-349.449] * (-346.773) (-348.180) (-346.048) [-347.520] -- 0:00:47
251000 -- [-349.341] (-348.156) (-345.946) (-346.438) * (-347.299) [-352.820] (-347.882) (-346.996) -- 0:00:47
251500 -- (-350.391) [-349.500] (-344.734) (-345.409) * (-347.843) (-347.347) [-347.806] (-346.028) -- 0:00:47
252000 -- (-351.522) (-348.332) [-348.632] (-349.286) * (-346.802) (-346.383) [-346.946] (-345.577) -- 0:00:47
252500 -- (-348.516) [-345.488] (-349.348) (-348.422) * (-346.411) [-346.592] (-347.484) (-344.833) -- 0:00:47
253000 -- (-346.775) [-345.221] (-352.900) (-347.265) * [-346.683] (-349.886) (-348.396) (-345.916) -- 0:00:47
253500 -- (-345.727) (-347.314) (-347.455) [-346.217] * (-346.879) (-347.375) (-348.908) [-347.423] -- 0:00:47
254000 -- [-347.075] (-346.180) (-345.445) (-345.926) * (-352.855) (-355.160) (-348.564) [-348.899] -- 0:00:46
254500 -- (-350.700) (-348.381) [-346.653] (-349.347) * (-347.281) (-354.758) (-347.748) [-345.740] -- 0:00:46
255000 -- (-351.340) [-346.179] (-347.734) (-346.579) * (-346.897) [-345.649] (-346.625) (-347.018) -- 0:00:46
Average standard deviation of split frequencies: 0.016397
255500 -- (-347.486) (-350.111) [-346.045] (-349.416) * [-347.708] (-346.901) (-345.927) (-346.719) -- 0:00:46
256000 -- [-345.554] (-348.744) (-346.087) (-345.257) * [-348.241] (-348.273) (-346.495) (-345.371) -- 0:00:46
256500 -- (-348.987) (-349.559) (-347.257) [-346.546] * (-348.960) (-347.039) [-347.080] (-345.014) -- 0:00:46
257000 -- [-346.355] (-345.672) (-345.245) (-348.050) * (-345.430) (-347.449) [-347.398] (-348.158) -- 0:00:46
257500 -- (-345.542) [-346.097] (-345.243) (-346.587) * (-346.664) [-347.084] (-347.147) (-349.442) -- 0:00:46
258000 -- [-345.413] (-346.075) (-349.024) (-345.772) * (-346.427) (-345.214) [-347.262] (-346.740) -- 0:00:46
258500 -- (-346.129) (-349.528) [-346.867] (-347.022) * [-347.808] (-347.061) (-348.279) (-345.089) -- 0:00:45
259000 -- [-347.214] (-348.450) (-348.042) (-345.829) * (-345.549) (-345.975) (-346.075) [-346.198] -- 0:00:45
259500 -- (-348.448) (-348.911) [-346.987] (-346.946) * (-346.310) [-346.422] (-347.306) (-348.190) -- 0:00:45
260000 -- [-347.790] (-346.641) (-346.738) (-349.345) * (-345.734) (-346.811) (-346.661) [-346.195] -- 0:00:45
Average standard deviation of split frequencies: 0.015824
260500 -- (-346.448) [-347.094] (-345.348) (-349.013) * [-346.339] (-346.321) (-349.534) (-346.545) -- 0:00:45
261000 -- (-347.986) (-348.540) (-345.392) [-345.806] * (-345.246) (-347.108) (-352.147) [-346.649] -- 0:00:45
261500 -- (-348.665) [-345.923] (-346.044) (-347.732) * [-348.306] (-349.753) (-348.529) (-348.872) -- 0:00:45
262000 -- [-347.286] (-345.001) (-345.171) (-353.751) * [-345.811] (-349.159) (-348.821) (-348.623) -- 0:00:45
262500 -- [-346.129] (-345.239) (-346.958) (-348.324) * (-349.514) [-345.480] (-346.272) (-347.805) -- 0:00:44
263000 -- (-347.452) (-346.994) [-346.994] (-347.435) * (-346.378) (-348.092) (-347.841) [-347.241] -- 0:00:44
263500 -- (-347.390) (-354.078) [-345.835] (-345.972) * (-349.459) (-346.415) (-350.342) [-346.068] -- 0:00:44
264000 -- [-348.653] (-351.765) (-346.612) (-348.807) * (-351.108) (-348.236) [-345.079] (-345.172) -- 0:00:44
264500 -- (-345.433) (-346.057) (-348.214) [-348.815] * (-348.149) (-349.692) (-346.865) [-347.096] -- 0:00:47
265000 -- (-345.659) [-345.668] (-349.998) (-346.779) * (-346.464) (-347.834) [-346.231] (-345.009) -- 0:00:47
Average standard deviation of split frequencies: 0.016216
265500 -- (-345.751) (-347.779) [-344.834] (-347.936) * (-346.165) (-348.881) (-346.887) [-348.585] -- 0:00:47
266000 -- (-346.856) (-348.822) [-344.732] (-349.632) * [-345.494] (-350.701) (-345.494) (-346.775) -- 0:00:46
266500 -- (-347.730) (-349.695) [-346.516] (-346.797) * (-346.625) (-346.481) (-349.481) [-347.015] -- 0:00:46
267000 -- (-347.664) (-350.484) [-345.109] (-347.521) * (-350.315) [-347.676] (-346.876) (-347.700) -- 0:00:46
267500 -- [-350.086] (-353.195) (-348.014) (-347.952) * (-346.415) (-349.620) (-348.432) [-346.892] -- 0:00:46
268000 -- [-347.451] (-349.828) (-350.690) (-348.624) * [-345.458] (-345.048) (-347.713) (-346.938) -- 0:00:46
268500 -- (-347.958) (-350.164) [-347.576] (-348.686) * [-345.328] (-346.764) (-349.065) (-350.078) -- 0:00:46
269000 -- (-348.314) (-349.683) (-345.181) [-345.067] * (-346.562) [-348.759] (-346.864) (-347.331) -- 0:00:46
269500 -- (-348.401) (-350.571) (-344.926) [-346.155] * (-349.871) (-346.051) (-351.435) [-347.586] -- 0:00:46
270000 -- [-348.351] (-346.591) (-345.391) (-345.962) * (-347.927) (-346.397) [-345.787] (-347.239) -- 0:00:45
Average standard deviation of split frequencies: 0.015675
270500 -- (-348.387) (-347.802) [-349.685] (-346.575) * (-349.854) [-345.839] (-345.856) (-346.240) -- 0:00:45
271000 -- (-347.559) (-350.131) (-347.381) [-345.358] * (-346.526) [-345.797] (-355.986) (-347.708) -- 0:00:45
271500 -- (-350.957) [-349.748] (-346.392) (-350.833) * (-350.263) (-347.663) (-350.252) [-349.689] -- 0:00:45
272000 -- [-349.340] (-347.031) (-347.772) (-353.079) * [-350.046] (-351.525) (-347.793) (-348.001) -- 0:00:45
272500 -- (-348.771) (-349.054) [-347.497] (-346.553) * (-348.916) (-348.977) [-347.666] (-348.217) -- 0:00:45
273000 -- (-348.633) [-345.807] (-346.704) (-346.201) * (-348.560) (-346.773) (-346.807) [-348.430] -- 0:00:45
273500 -- (-346.398) (-350.091) [-345.917] (-349.169) * (-348.857) [-347.466] (-345.915) (-348.464) -- 0:00:45
274000 -- (-346.008) (-345.506) [-347.878] (-351.357) * (-348.750) (-346.212) (-347.415) [-347.397] -- 0:00:45
274500 -- (-347.024) (-350.293) [-346.694] (-347.206) * (-347.713) (-346.588) (-348.979) [-346.247] -- 0:00:44
275000 -- (-346.957) (-350.250) [-345.732] (-346.795) * (-346.329) (-348.985) (-347.624) [-344.839] -- 0:00:44
Average standard deviation of split frequencies: 0.016001
275500 -- [-350.494] (-349.345) (-349.357) (-347.446) * (-346.087) (-346.421) (-348.483) [-346.150] -- 0:00:44
276000 -- (-347.486) [-344.982] (-347.166) (-351.169) * (-345.732) (-345.732) [-346.843] (-347.013) -- 0:00:44
276500 -- (-348.687) [-346.637] (-348.911) (-347.602) * (-349.008) (-345.716) [-347.440] (-345.664) -- 0:00:44
277000 -- (-350.477) [-347.366] (-347.396) (-346.198) * (-346.742) (-347.102) (-346.151) [-347.657] -- 0:00:44
277500 -- [-346.391] (-346.998) (-346.806) (-347.734) * (-348.021) (-347.149) [-346.526] (-348.275) -- 0:00:44
278000 -- (-346.323) (-347.333) (-345.060) [-347.109] * (-347.134) (-346.514) (-347.462) [-350.876] -- 0:00:44
278500 -- (-347.248) (-346.479) (-347.158) [-347.629] * (-348.404) (-350.523) [-345.502] (-345.712) -- 0:00:44
279000 -- (-349.716) (-353.575) [-347.620] (-347.851) * [-347.889] (-347.727) (-349.710) (-351.328) -- 0:00:43
279500 -- (-348.225) [-348.849] (-345.928) (-346.510) * (-349.008) (-346.254) [-347.792] (-347.354) -- 0:00:43
280000 -- (-346.463) [-349.779] (-350.047) (-347.923) * (-347.016) (-346.428) [-348.745] (-352.641) -- 0:00:43
Average standard deviation of split frequencies: 0.014851
280500 -- (-349.655) (-349.213) [-346.199] (-350.171) * (-348.016) (-346.534) [-348.970] (-347.606) -- 0:00:43
281000 -- (-347.080) (-351.223) [-346.755] (-346.309) * (-346.041) (-347.302) (-347.957) [-346.076] -- 0:00:43
281500 -- (-346.491) (-351.528) [-345.480] (-347.376) * (-347.009) (-346.886) (-348.152) [-346.543] -- 0:00:43
282000 -- [-345.419] (-348.460) (-344.898) (-347.916) * (-347.418) (-346.899) (-351.648) [-349.123] -- 0:00:45
282500 -- (-346.672) [-348.516] (-346.804) (-347.984) * [-347.658] (-347.350) (-347.981) (-348.181) -- 0:00:45
283000 -- (-348.984) (-346.343) [-345.570] (-345.781) * (-347.050) (-345.397) (-345.783) [-345.895] -- 0:00:45
283500 -- [-348.111] (-346.855) (-348.252) (-347.436) * (-351.521) (-346.411) (-350.056) [-347.785] -- 0:00:45
284000 -- (-347.422) (-348.660) (-345.838) [-348.137] * [-346.721] (-348.922) (-347.059) (-349.554) -- 0:00:45
284500 -- (-346.643) [-347.755] (-351.189) (-347.891) * [-346.371] (-346.250) (-351.349) (-345.106) -- 0:00:45
285000 -- (-351.758) [-347.333] (-345.992) (-349.311) * (-345.846) (-349.168) (-345.487) [-346.388] -- 0:00:45
Average standard deviation of split frequencies: 0.015494
285500 -- (-346.329) (-346.488) (-346.961) [-349.244] * (-345.532) (-348.752) (-349.024) [-345.414] -- 0:00:45
286000 -- (-345.364) [-345.404] (-347.567) (-345.663) * [-348.980] (-350.728) (-347.011) (-347.986) -- 0:00:44
286500 -- [-346.720] (-347.959) (-349.900) (-345.360) * (-348.451) [-344.977] (-352.738) (-347.641) -- 0:00:44
287000 -- (-346.196) [-351.094] (-350.199) (-347.971) * (-345.897) (-346.190) [-347.945] (-348.695) -- 0:00:44
287500 -- (-349.548) [-349.709] (-349.729) (-346.207) * (-349.343) (-347.961) [-346.410] (-348.899) -- 0:00:44
288000 -- (-346.215) (-348.885) [-349.391] (-348.247) * [-348.588] (-346.676) (-347.056) (-346.958) -- 0:00:44
288500 -- [-346.436] (-348.268) (-346.139) (-348.354) * (-347.118) (-347.865) [-345.835] (-346.937) -- 0:00:44
289000 -- (-349.689) [-347.229] (-345.718) (-346.309) * (-347.605) (-353.376) [-346.380] (-347.586) -- 0:00:44
289500 -- (-353.954) [-346.041] (-347.024) (-345.285) * (-356.406) (-345.458) (-346.186) [-346.652] -- 0:00:44
290000 -- (-350.000) (-345.724) [-348.700] (-350.207) * (-346.421) (-346.611) [-345.258] (-349.537) -- 0:00:44
Average standard deviation of split frequencies: 0.015858
290500 -- (-345.592) (-347.174) (-348.434) [-350.601] * (-347.705) (-347.323) (-345.357) [-348.567] -- 0:00:43
291000 -- (-346.767) (-347.382) [-347.069] (-347.971) * (-345.064) (-345.315) [-347.344] (-346.006) -- 0:00:43
291500 -- (-350.544) [-348.435] (-352.746) (-348.330) * [-348.537] (-350.130) (-349.284) (-351.352) -- 0:00:43
292000 -- (-349.542) (-346.079) (-350.209) [-348.827] * [-345.841] (-347.068) (-345.373) (-350.208) -- 0:00:43
292500 -- (-346.763) [-345.554] (-348.356) (-345.710) * [-346.534] (-345.542) (-346.230) (-347.850) -- 0:00:43
293000 -- (-346.127) [-346.035] (-351.816) (-347.222) * (-347.157) (-351.676) (-346.925) [-346.567] -- 0:00:43
293500 -- (-346.028) [-348.502] (-345.696) (-345.979) * [-345.918] (-352.313) (-347.299) (-348.615) -- 0:00:43
294000 -- (-356.232) (-348.053) [-345.720] (-345.646) * (-347.878) (-351.566) [-346.213] (-349.149) -- 0:00:43
294500 -- (-348.942) [-347.991] (-345.733) (-345.355) * (-347.279) [-349.851] (-351.659) (-347.656) -- 0:00:43
295000 -- (-347.186) (-345.602) [-348.695] (-352.444) * (-348.625) (-347.577) [-346.888] (-346.243) -- 0:00:43
Average standard deviation of split frequencies: 0.016722
295500 -- [-349.802] (-347.134) (-348.673) (-347.257) * (-346.721) (-347.331) [-349.340] (-347.413) -- 0:00:42
296000 -- (-351.272) (-346.859) [-347.943] (-347.928) * (-349.753) (-349.684) [-349.416] (-345.311) -- 0:00:42
296500 -- [-346.065] (-350.829) (-347.241) (-345.452) * (-348.188) (-347.406) (-347.624) [-351.428] -- 0:00:42
297000 -- (-347.259) [-350.585] (-346.247) (-347.950) * (-348.191) [-348.703] (-353.970) (-349.757) -- 0:00:42
297500 -- (-345.095) (-349.719) [-344.978] (-347.839) * (-350.802) (-349.336) (-355.320) [-347.466] -- 0:00:42
298000 -- (-346.936) [-346.242] (-346.563) (-348.668) * (-347.900) (-348.451) [-347.801] (-346.300) -- 0:00:42
298500 -- (-346.455) [-350.017] (-346.789) (-346.850) * (-346.693) (-348.103) (-346.826) [-350.140] -- 0:00:42
299000 -- (-346.176) (-347.381) (-349.919) [-345.143] * (-346.663) (-346.616) [-348.632] (-347.814) -- 0:00:44
299500 -- (-344.808) [-347.450] (-344.872) (-348.495) * [-346.980] (-345.462) (-349.085) (-347.076) -- 0:00:44
300000 -- (-345.701) (-347.524) [-349.894] (-351.740) * (-348.425) (-348.174) (-347.749) [-348.514] -- 0:00:44
Average standard deviation of split frequencies: 0.016637
300500 -- [-345.438] (-345.708) (-346.448) (-348.980) * (-347.764) (-346.991) [-345.690] (-347.160) -- 0:00:44
301000 -- (-345.090) [-345.262] (-346.811) (-350.185) * [-347.596] (-350.890) (-347.657) (-347.243) -- 0:00:44
301500 -- (-350.024) (-348.794) (-345.601) [-348.545] * (-346.430) [-349.862] (-346.313) (-345.620) -- 0:00:44
302000 -- (-346.515) (-346.510) (-346.143) [-347.852] * (-348.577) [-348.607] (-346.567) (-345.545) -- 0:00:43
302500 -- (-345.473) [-347.939] (-351.223) (-347.797) * (-345.014) [-347.891] (-346.119) (-345.798) -- 0:00:43
303000 -- (-348.210) (-350.391) (-348.813) [-346.053] * (-347.784) (-348.983) (-346.800) [-347.603] -- 0:00:43
303500 -- [-344.771] (-349.644) (-347.718) (-345.270) * [-349.665] (-350.514) (-345.773) (-347.188) -- 0:00:43
304000 -- (-348.635) (-348.219) [-347.170] (-351.500) * [-348.134] (-350.235) (-345.122) (-347.681) -- 0:00:43
304500 -- (-349.622) (-350.541) (-348.367) [-345.703] * (-348.945) (-348.779) [-346.256] (-345.031) -- 0:00:43
305000 -- (-348.079) (-351.041) [-347.549] (-345.903) * (-350.488) (-345.626) [-345.618] (-344.855) -- 0:00:43
Average standard deviation of split frequencies: 0.016054
305500 -- (-348.279) [-347.190] (-346.201) (-347.465) * (-348.608) [-347.664] (-347.156) (-346.939) -- 0:00:43
306000 -- (-348.602) (-344.993) (-345.841) [-345.865] * (-347.982) (-347.763) [-345.829] (-346.050) -- 0:00:43
306500 -- (-346.462) (-345.876) [-346.200] (-346.352) * (-350.277) (-347.153) (-351.913) [-345.239] -- 0:00:42
307000 -- (-348.355) [-346.825] (-347.914) (-350.078) * (-347.514) (-347.651) (-346.653) [-346.920] -- 0:00:42
307500 -- (-348.349) (-346.777) [-351.086] (-347.088) * [-346.944] (-346.900) (-345.152) (-347.502) -- 0:00:42
308000 -- (-349.362) (-345.678) (-346.672) [-347.519] * (-345.468) (-347.768) (-346.331) [-344.909] -- 0:00:42
308500 -- (-346.657) (-348.209) [-348.357] (-348.828) * (-345.322) (-345.987) [-347.047] (-345.557) -- 0:00:42
309000 -- [-346.638] (-346.701) (-348.714) (-348.137) * (-345.239) (-346.581) (-346.340) [-347.672] -- 0:00:42
309500 -- (-346.063) (-346.066) (-348.265) [-349.011] * (-346.982) (-346.635) (-345.740) [-348.112] -- 0:00:42
310000 -- (-347.775) [-345.184] (-348.395) (-347.925) * (-345.680) [-349.005] (-348.594) (-345.518) -- 0:00:42
Average standard deviation of split frequencies: 0.016186
310500 -- [-348.490] (-347.268) (-352.313) (-348.416) * (-347.047) [-347.067] (-346.697) (-346.813) -- 0:00:42
311000 -- (-347.715) (-346.899) [-348.459] (-348.881) * [-347.092] (-345.446) (-345.585) (-348.514) -- 0:00:42
311500 -- [-348.995] (-345.881) (-347.402) (-347.594) * [-348.371] (-347.667) (-348.192) (-346.436) -- 0:00:41
312000 -- (-349.282) [-345.665] (-345.867) (-350.419) * (-346.224) [-345.739] (-350.476) (-347.242) -- 0:00:41
312500 -- (-348.971) (-346.680) (-349.026) [-346.960] * (-348.790) [-349.314] (-346.434) (-349.408) -- 0:00:41
313000 -- (-344.784) (-347.148) [-345.193] (-346.738) * (-346.240) [-346.368] (-350.149) (-347.391) -- 0:00:41
313500 -- (-346.876) [-347.916] (-345.196) (-349.223) * [-346.584] (-348.770) (-348.999) (-345.184) -- 0:00:41
314000 -- [-346.032] (-347.976) (-349.223) (-350.077) * (-346.150) (-347.475) (-348.146) [-344.901] -- 0:00:41
314500 -- (-346.386) (-345.304) (-348.041) [-349.322] * (-352.154) (-345.457) (-348.510) [-347.085] -- 0:00:41
315000 -- [-347.145] (-345.849) (-345.919) (-348.038) * (-346.593) [-346.742] (-351.282) (-345.510) -- 0:00:41
Average standard deviation of split frequencies: 0.014835
315500 -- (-346.179) (-346.523) [-345.397] (-347.472) * [-346.546] (-346.298) (-345.917) (-347.037) -- 0:00:41
316000 -- [-347.950] (-346.595) (-345.955) (-345.218) * (-349.940) [-345.662] (-345.772) (-348.544) -- 0:00:41
316500 -- (-345.889) (-346.272) (-348.239) [-348.359] * (-345.193) (-347.639) (-347.861) [-350.335] -- 0:00:43
317000 -- (-346.026) (-347.191) (-346.540) [-345.477] * (-347.860) [-346.954] (-346.176) (-348.492) -- 0:00:43
317500 -- [-344.967] (-345.954) (-349.295) (-348.469) * (-348.067) [-346.271] (-347.829) (-348.132) -- 0:00:42
318000 -- [-346.749] (-345.671) (-348.648) (-346.822) * (-347.437) (-345.271) [-346.020] (-348.510) -- 0:00:42
318500 -- (-345.073) (-345.700) [-344.818] (-347.217) * [-347.059] (-348.419) (-346.165) (-347.545) -- 0:00:42
319000 -- (-349.282) [-346.405] (-347.674) (-345.699) * (-345.279) (-349.578) (-347.366) [-353.053] -- 0:00:42
319500 -- (-345.110) (-345.146) (-345.962) [-346.686] * (-345.169) (-346.468) (-350.532) [-347.250] -- 0:00:42
320000 -- (-345.955) [-347.688] (-347.120) (-346.104) * (-346.386) [-346.898] (-349.865) (-345.234) -- 0:00:42
Average standard deviation of split frequencies: 0.014469
320500 -- (-348.928) [-346.550] (-350.613) (-348.058) * (-347.722) (-347.564) (-349.885) [-347.524] -- 0:00:42
321000 -- (-345.142) (-347.736) (-349.904) [-345.486] * (-349.445) (-352.265) [-346.700] (-348.412) -- 0:00:42
321500 -- (-351.543) [-346.560] (-345.004) (-345.273) * (-350.776) (-346.906) [-346.770] (-348.500) -- 0:00:42
322000 -- (-354.475) (-345.921) [-345.701] (-347.283) * (-346.404) (-347.114) [-345.636] (-347.094) -- 0:00:42
322500 -- (-351.477) [-347.804] (-348.137) (-346.272) * [-347.786] (-348.890) (-348.164) (-350.515) -- 0:00:42
323000 -- (-354.440) (-346.844) (-348.343) [-347.243] * [-347.142] (-346.813) (-348.583) (-347.814) -- 0:00:41
323500 -- (-346.355) [-346.064] (-349.303) (-350.325) * (-347.495) [-346.755] (-347.240) (-351.230) -- 0:00:41
324000 -- (-346.573) (-349.041) [-346.227] (-348.623) * [-345.565] (-350.119) (-345.730) (-347.169) -- 0:00:41
324500 -- (-352.535) (-346.426) [-345.751] (-350.268) * (-347.590) (-347.669) (-345.441) [-346.435] -- 0:00:41
325000 -- (-351.251) [-347.102] (-347.061) (-346.610) * (-345.731) (-347.870) (-346.846) [-346.783] -- 0:00:41
Average standard deviation of split frequencies: 0.014612
325500 -- (-348.034) (-346.814) [-346.426] (-345.687) * [-348.540] (-349.798) (-346.498) (-348.521) -- 0:00:41
326000 -- [-348.292] (-348.544) (-346.153) (-349.217) * (-346.384) [-348.252] (-348.702) (-350.993) -- 0:00:41
326500 -- [-346.047] (-347.110) (-345.876) (-348.654) * (-345.984) [-346.885] (-349.059) (-348.197) -- 0:00:41
327000 -- [-349.297] (-349.431) (-345.316) (-348.869) * (-345.669) (-345.925) [-346.032] (-347.008) -- 0:00:41
327500 -- [-346.646] (-347.724) (-346.995) (-348.840) * (-347.783) [-348.959] (-345.553) (-349.005) -- 0:00:41
328000 -- [-348.683] (-345.493) (-345.309) (-347.617) * [-346.459] (-351.969) (-345.283) (-346.750) -- 0:00:40
328500 -- (-349.138) (-345.547) [-345.053] (-345.289) * (-345.620) (-346.572) (-347.801) [-347.325] -- 0:00:40
329000 -- (-352.936) (-345.776) (-346.731) [-345.352] * (-348.194) (-350.848) (-347.094) [-346.283] -- 0:00:40
329500 -- (-352.496) [-345.093] (-350.975) (-350.522) * (-346.411) (-346.874) (-349.321) [-344.983] -- 0:00:40
330000 -- (-348.613) [-346.579] (-349.361) (-346.303) * [-346.375] (-349.647) (-345.897) (-347.340) -- 0:00:40
Average standard deviation of split frequencies: 0.013356
330500 -- (-349.031) (-345.184) (-348.000) [-347.059] * (-346.044) [-345.591] (-346.896) (-346.637) -- 0:00:40
331000 -- [-348.839] (-346.291) (-346.604) (-347.317) * (-348.086) (-346.138) (-346.353) [-345.891] -- 0:00:40
331500 -- (-345.837) (-347.533) [-346.300] (-349.701) * (-348.356) (-345.815) (-348.553) [-347.919] -- 0:00:40
332000 -- (-348.346) [-346.041] (-345.639) (-351.514) * (-347.539) (-349.040) [-345.240] (-346.963) -- 0:00:40
332500 -- [-345.031] (-345.729) (-348.868) (-348.938) * (-345.794) [-345.305] (-345.219) (-347.072) -- 0:00:40
333000 -- (-349.593) (-346.158) (-347.433) [-348.722] * (-345.296) (-345.239) [-347.357] (-348.116) -- 0:00:40
333500 -- (-345.975) (-345.769) [-346.555] (-345.726) * (-349.353) (-345.940) [-347.029] (-347.472) -- 0:00:41
334000 -- (-345.998) (-345.515) (-347.723) [-350.590] * (-347.978) (-347.423) (-346.733) [-345.824] -- 0:00:41
334500 -- (-346.595) (-347.851) [-349.334] (-349.498) * (-347.553) [-349.591] (-346.978) (-350.642) -- 0:00:41
335000 -- [-346.697] (-345.271) (-349.691) (-348.666) * (-348.550) (-347.871) [-345.012] (-347.793) -- 0:00:41
Average standard deviation of split frequencies: 0.012036
335500 -- [-347.262] (-350.567) (-346.577) (-348.612) * (-346.044) (-347.178) [-349.393] (-346.801) -- 0:00:41
336000 -- (-345.548) [-348.076] (-345.539) (-348.738) * (-347.793) [-346.617] (-345.788) (-348.122) -- 0:00:41
336500 -- [-346.618] (-348.306) (-353.521) (-348.601) * (-347.733) (-349.983) (-345.626) [-347.017] -- 0:00:41
337000 -- (-347.701) [-347.931] (-346.796) (-346.530) * (-345.370) (-346.592) (-349.344) [-347.230] -- 0:00:41
337500 -- (-351.628) (-346.786) [-350.891] (-345.369) * (-346.049) [-345.254] (-348.907) (-348.598) -- 0:00:41
338000 -- (-345.573) [-346.429] (-345.922) (-345.658) * [-349.483] (-347.281) (-347.158) (-346.083) -- 0:00:41
338500 -- (-345.982) [-348.282] (-347.499) (-347.022) * (-349.108) [-346.517] (-347.790) (-347.420) -- 0:00:41
339000 -- [-345.424] (-349.713) (-348.552) (-351.598) * (-346.701) (-345.853) (-347.192) [-346.942] -- 0:00:40
339500 -- (-349.563) (-346.924) (-346.757) [-345.146] * (-348.476) (-347.901) (-347.054) [-348.768] -- 0:00:40
340000 -- (-350.727) [-346.293] (-346.359) (-350.475) * (-345.409) (-345.529) [-347.663] (-347.641) -- 0:00:40
Average standard deviation of split frequencies: 0.012090
340500 -- (-347.570) [-345.477] (-347.729) (-346.496) * (-346.770) (-349.048) [-345.347] (-349.270) -- 0:00:40
341000 -- [-347.278] (-345.926) (-349.116) (-347.081) * (-347.555) (-350.317) (-347.808) [-347.776] -- 0:00:40
341500 -- (-347.529) (-345.007) (-347.739) [-348.079] * (-346.007) (-348.596) [-345.305] (-346.834) -- 0:00:40
342000 -- (-347.967) (-345.484) [-346.248] (-351.027) * (-345.449) (-349.032) [-351.321] (-348.953) -- 0:00:40
342500 -- (-346.986) (-347.038) (-345.924) [-347.073] * (-348.809) (-347.997) [-346.338] (-349.350) -- 0:00:40
343000 -- [-348.364] (-345.717) (-347.371) (-346.774) * (-347.465) (-347.418) (-347.326) [-349.073] -- 0:00:40
343500 -- (-347.390) [-345.708] (-346.365) (-345.863) * (-345.160) [-346.867] (-345.686) (-353.402) -- 0:00:40
344000 -- (-351.612) [-348.078] (-345.664) (-345.372) * [-346.211] (-348.921) (-346.665) (-345.151) -- 0:00:40
344500 -- (-346.448) (-346.604) [-346.817] (-345.192) * (-347.642) (-352.423) [-348.280] (-346.741) -- 0:00:39
345000 -- [-350.910] (-347.271) (-345.932) (-346.241) * (-348.116) (-345.083) (-349.783) [-351.789] -- 0:00:39
Average standard deviation of split frequencies: 0.011330
345500 -- [-353.420] (-346.216) (-346.341) (-349.916) * (-347.782) [-345.536] (-345.294) (-347.686) -- 0:00:39
346000 -- (-349.760) [-348.855] (-349.683) (-346.608) * (-347.592) (-346.662) [-346.617] (-349.065) -- 0:00:39
346500 -- (-347.195) (-348.435) (-346.957) [-345.640] * [-346.027] (-352.137) (-348.978) (-351.536) -- 0:00:39
347000 -- (-347.535) (-346.146) (-346.969) [-347.713] * [-349.872] (-349.354) (-347.211) (-349.465) -- 0:00:39
347500 -- (-346.188) [-349.137] (-347.418) (-349.788) * (-348.553) (-346.235) [-346.342] (-353.563) -- 0:00:39
348000 -- (-349.166) (-354.656) (-345.787) [-346.255] * (-346.854) (-347.630) [-348.144] (-351.279) -- 0:00:39
348500 -- (-346.993) (-345.195) (-346.060) [-346.180] * (-346.327) [-345.659] (-348.129) (-346.574) -- 0:00:39
349000 -- [-346.206] (-345.524) (-347.949) (-345.399) * [-346.050] (-346.823) (-345.468) (-346.360) -- 0:00:39
349500 -- (-347.172) (-345.127) (-349.219) [-346.433] * [-349.804] (-345.620) (-349.049) (-348.569) -- 0:00:39
350000 -- (-344.931) [-347.200] (-346.452) (-349.463) * [-346.755] (-346.612) (-345.740) (-350.682) -- 0:00:39
Average standard deviation of split frequencies: 0.010967
350500 -- (-345.905) [-346.961] (-346.493) (-347.697) * [-348.119] (-346.292) (-346.248) (-347.083) -- 0:00:38
351000 -- (-347.488) [-346.597] (-349.377) (-346.613) * (-348.942) [-348.032] (-346.226) (-345.998) -- 0:00:40
351500 -- (-346.988) [-346.572] (-349.666) (-345.466) * (-348.660) (-349.033) (-348.793) [-346.159] -- 0:00:40
352000 -- [-346.945] (-347.804) (-349.388) (-345.446) * (-349.479) (-349.953) [-345.179] (-347.775) -- 0:00:40
352500 -- (-346.294) (-346.487) (-347.614) [-345.668] * [-345.320] (-349.794) (-345.620) (-347.257) -- 0:00:40
353000 -- [-353.037] (-347.318) (-346.581) (-348.312) * (-346.861) (-349.800) (-345.374) [-347.210] -- 0:00:40
353500 -- [-348.771] (-346.791) (-345.895) (-345.329) * (-352.025) (-345.430) [-346.939] (-346.708) -- 0:00:40
354000 -- [-352.877] (-348.365) (-346.944) (-345.618) * (-346.052) (-348.164) [-346.456] (-346.092) -- 0:00:40
354500 -- (-346.566) (-349.164) [-348.231] (-346.857) * (-349.488) (-346.188) [-345.715] (-349.543) -- 0:00:40
355000 -- (-348.656) [-345.614] (-346.641) (-346.147) * (-349.957) [-346.520] (-347.123) (-345.733) -- 0:00:39
Average standard deviation of split frequencies: 0.011708
355500 -- (-345.358) (-346.658) [-345.439] (-345.118) * (-346.208) (-345.427) [-347.845] (-346.425) -- 0:00:39
356000 -- (-345.809) (-347.585) [-346.402] (-345.592) * (-346.944) (-349.553) [-346.060] (-345.315) -- 0:00:39
356500 -- (-349.117) [-346.736] (-348.703) (-344.691) * (-347.530) [-345.731] (-348.695) (-347.218) -- 0:00:39
357000 -- (-346.046) (-347.760) [-347.562] (-347.207) * (-345.884) (-346.383) (-351.063) [-346.279] -- 0:00:39
357500 -- [-344.891] (-347.194) (-349.431) (-346.663) * (-347.566) [-348.884] (-349.649) (-345.064) -- 0:00:39
358000 -- (-346.613) (-347.405) [-345.578] (-349.214) * (-352.471) [-347.675] (-347.555) (-348.069) -- 0:00:39
358500 -- (-346.206) (-346.373) [-345.309] (-345.494) * (-350.569) [-347.700] (-345.216) (-347.532) -- 0:00:39
359000 -- (-346.058) (-346.335) [-347.339] (-346.788) * [-352.991] (-350.554) (-347.383) (-349.788) -- 0:00:39
359500 -- (-345.199) (-345.579) [-347.484] (-346.463) * [-346.788] (-346.230) (-348.746) (-346.777) -- 0:00:39
360000 -- (-346.464) (-345.663) [-345.500] (-349.000) * (-351.385) [-347.712] (-346.386) (-347.085) -- 0:00:39
Average standard deviation of split frequencies: 0.011351
360500 -- (-345.294) [-346.583] (-345.530) (-348.345) * [-347.216] (-345.544) (-349.179) (-350.214) -- 0:00:39
361000 -- [-347.094] (-345.757) (-350.333) (-345.699) * [-347.996] (-346.899) (-348.259) (-344.937) -- 0:00:38
361500 -- (-347.934) [-347.370] (-348.052) (-347.217) * (-346.533) [-347.764] (-347.679) (-346.350) -- 0:00:38
362000 -- (-345.985) (-347.882) [-347.667] (-348.819) * [-345.061] (-346.321) (-348.430) (-345.395) -- 0:00:38
362500 -- [-347.412] (-346.521) (-346.988) (-350.368) * (-348.961) (-347.768) [-349.151] (-344.942) -- 0:00:38
363000 -- (-347.331) [-347.003] (-345.013) (-346.795) * (-348.543) (-347.783) [-347.175] (-347.293) -- 0:00:38
363500 -- (-345.874) (-348.354) (-346.782) [-348.740] * (-347.496) (-346.443) (-346.238) [-346.665] -- 0:00:38
364000 -- (-346.032) [-348.080] (-349.504) (-345.991) * (-348.267) [-345.453] (-348.520) (-347.237) -- 0:00:38
364500 -- (-347.644) (-346.830) [-347.715] (-348.757) * (-353.249) (-346.321) [-346.910] (-346.033) -- 0:00:38
365000 -- [-351.033] (-346.640) (-345.900) (-351.636) * (-346.642) (-346.957) [-345.327] (-349.152) -- 0:00:38
Average standard deviation of split frequencies: 0.010711
365500 -- (-347.396) (-347.118) (-347.558) [-346.442] * (-345.550) (-345.089) [-347.216] (-347.611) -- 0:00:38
366000 -- (-346.598) (-348.448) (-345.504) [-348.452] * (-348.289) [-346.006] (-346.283) (-347.294) -- 0:00:38
366500 -- (-345.114) [-347.349] (-348.391) (-345.730) * (-347.260) (-345.613) [-347.435] (-344.981) -- 0:00:38
367000 -- (-346.997) [-349.798] (-350.609) (-350.293) * (-347.267) [-346.623] (-346.058) (-346.578) -- 0:00:37
367500 -- (-346.625) [-345.007] (-351.423) (-347.516) * (-350.628) [-345.759] (-346.581) (-346.276) -- 0:00:37
368000 -- [-346.513] (-346.425) (-347.692) (-349.130) * (-350.263) (-347.026) (-349.023) [-347.483] -- 0:00:39
368500 -- (-345.583) (-348.472) [-348.496] (-346.863) * (-345.066) [-345.770] (-347.581) (-348.251) -- 0:00:39
369000 -- (-346.420) (-346.549) [-350.677] (-348.641) * (-349.208) [-348.515] (-347.175) (-348.114) -- 0:00:39
369500 -- (-347.067) (-346.815) [-348.521] (-346.130) * (-346.705) [-346.878] (-347.140) (-347.600) -- 0:00:39
370000 -- (-347.932) [-349.269] (-351.667) (-351.009) * [-346.724] (-351.712) (-347.976) (-349.173) -- 0:00:39
Average standard deviation of split frequencies: 0.010777
370500 -- (-352.724) (-350.126) (-350.483) [-347.289] * (-347.513) [-348.401] (-349.114) (-347.126) -- 0:00:39
371000 -- [-346.482] (-351.034) (-347.129) (-347.042) * (-345.941) [-349.925] (-346.300) (-346.689) -- 0:00:38
371500 -- [-348.359] (-345.142) (-346.879) (-347.868) * (-346.497) (-346.966) (-346.810) [-346.280] -- 0:00:38
372000 -- (-347.552) (-344.968) [-346.637] (-352.347) * (-345.509) (-352.284) (-348.133) [-345.907] -- 0:00:38
372500 -- [-345.915] (-346.031) (-349.294) (-346.603) * (-345.220) (-348.151) (-348.193) [-345.402] -- 0:00:38
373000 -- [-346.011] (-346.427) (-346.609) (-347.546) * (-347.305) (-347.412) [-345.401] (-345.629) -- 0:00:38
373500 -- (-348.130) (-345.561) (-346.810) [-347.238] * [-345.076] (-353.476) (-345.318) (-344.961) -- 0:00:38
374000 -- [-345.378] (-350.420) (-346.153) (-347.030) * [-345.947] (-348.330) (-345.994) (-346.917) -- 0:00:38
374500 -- [-348.520] (-348.054) (-347.928) (-347.346) * (-345.318) [-348.802] (-345.487) (-345.266) -- 0:00:38
375000 -- (-346.363) (-346.033) [-346.603] (-346.076) * (-346.700) (-345.020) [-345.298] (-345.392) -- 0:00:38
Average standard deviation of split frequencies: 0.010426
375500 -- (-348.885) (-347.533) (-348.637) [-346.563] * (-347.933) (-347.646) [-345.235] (-346.453) -- 0:00:38
376000 -- (-346.037) (-350.147) (-347.866) [-346.829] * (-347.388) (-348.213) (-347.248) [-345.284] -- 0:00:38
376500 -- (-351.098) (-348.660) (-346.555) [-345.648] * [-347.180] (-346.537) (-345.628) (-346.339) -- 0:00:38
377000 -- (-346.433) (-347.392) [-347.976] (-345.219) * (-347.285) (-349.717) [-347.249] (-347.361) -- 0:00:38
377500 -- [-346.844] (-347.202) (-345.064) (-353.050) * (-346.325) [-354.691] (-346.972) (-347.180) -- 0:00:37
378000 -- [-346.030] (-348.370) (-345.487) (-346.789) * (-345.581) (-346.574) (-345.126) [-346.049] -- 0:00:37
378500 -- [-347.542] (-351.757) (-348.807) (-347.302) * [-346.223] (-345.087) (-346.481) (-346.637) -- 0:00:37
379000 -- (-348.310) [-345.061] (-347.630) (-348.207) * (-347.849) (-345.340) [-345.175] (-346.814) -- 0:00:37
379500 -- [-347.086] (-346.077) (-348.267) (-348.697) * (-346.675) (-346.220) (-345.339) [-348.433] -- 0:00:37
380000 -- (-346.671) (-345.450) (-345.534) [-348.728] * (-349.833) (-348.907) [-346.808] (-347.633) -- 0:00:37
Average standard deviation of split frequencies: 0.010298
380500 -- (-347.546) [-346.737] (-349.331) (-346.211) * (-347.410) (-347.904) [-346.234] (-348.610) -- 0:00:37
381000 -- [-346.583] (-347.706) (-347.974) (-346.870) * (-349.539) (-349.706) (-345.841) [-347.176] -- 0:00:37
381500 -- (-345.522) (-353.725) (-347.150) [-349.963] * (-345.741) (-346.751) [-347.402] (-348.129) -- 0:00:37
382000 -- [-345.935] (-347.997) (-347.810) (-348.806) * (-350.760) [-345.677] (-348.530) (-347.763) -- 0:00:37
382500 -- (-347.944) (-346.530) [-347.417] (-348.248) * (-347.532) (-347.145) (-348.130) [-346.965] -- 0:00:37
383000 -- (-345.192) [-347.765] (-346.223) (-347.198) * (-347.841) (-350.048) (-346.939) [-349.920] -- 0:00:37
383500 -- [-345.485] (-347.512) (-347.016) (-345.911) * [-345.441] (-346.754) (-346.002) (-345.001) -- 0:00:36
384000 -- [-347.276] (-346.915) (-346.877) (-350.458) * (-346.522) [-345.781] (-345.339) (-346.796) -- 0:00:36
384500 -- (-348.958) (-348.832) [-346.898] (-349.380) * [-348.727] (-349.575) (-347.860) (-347.126) -- 0:00:36
385000 -- (-345.957) [-348.028] (-346.063) (-346.395) * (-349.456) (-353.273) (-345.871) [-345.945] -- 0:00:36
Average standard deviation of split frequencies: 0.010413
385500 -- (-347.696) (-347.537) [-348.168] (-346.331) * [-346.737] (-352.711) (-350.569) (-346.375) -- 0:00:38
386000 -- (-347.746) [-346.494] (-344.946) (-349.226) * [-346.283] (-347.279) (-353.267) (-347.978) -- 0:00:38
386500 -- (-347.487) (-346.827) [-346.996] (-345.437) * [-345.545] (-346.003) (-353.538) (-345.669) -- 0:00:38
387000 -- (-347.707) [-347.373] (-347.678) (-346.509) * (-347.241) (-346.785) [-349.833] (-353.373) -- 0:00:38
387500 -- (-347.483) (-346.062) [-347.205] (-346.898) * (-347.089) (-346.036) [-345.449] (-352.853) -- 0:00:37
388000 -- [-345.436] (-346.680) (-347.787) (-347.214) * [-349.415] (-345.578) (-347.398) (-349.270) -- 0:00:37
388500 -- (-345.743) (-346.627) (-345.054) [-345.497] * (-348.904) (-344.931) (-353.537) [-346.491] -- 0:00:37
389000 -- (-349.100) (-348.786) [-350.015] (-349.479) * [-348.590] (-346.940) (-348.979) (-348.467) -- 0:00:37
389500 -- [-346.528] (-348.817) (-347.472) (-350.496) * (-346.158) (-347.974) [-350.389] (-346.733) -- 0:00:37
390000 -- (-346.031) (-346.917) [-346.514] (-348.268) * (-345.768) (-348.740) (-346.802) [-347.186] -- 0:00:37
Average standard deviation of split frequencies: 0.010415
390500 -- (-346.840) [-348.110] (-345.930) (-349.130) * (-346.392) (-347.718) (-348.836) [-347.678] -- 0:00:37
391000 -- (-345.757) (-347.537) (-345.766) [-346.265] * (-346.457) (-348.573) [-346.899] (-346.288) -- 0:00:37
391500 -- [-353.074] (-346.359) (-352.096) (-346.568) * (-345.913) (-351.757) [-345.294] (-346.868) -- 0:00:37
392000 -- (-347.849) (-346.172) [-348.629] (-347.327) * [-349.081] (-345.504) (-346.708) (-350.129) -- 0:00:37
392500 -- (-350.239) (-347.424) (-349.354) [-347.456] * [-347.641] (-345.684) (-346.729) (-348.804) -- 0:00:37
393000 -- [-345.530] (-345.189) (-353.761) (-346.343) * (-350.700) [-348.376] (-346.227) (-345.655) -- 0:00:37
393500 -- [-346.166] (-348.241) (-345.172) (-347.312) * (-350.819) (-347.120) (-348.510) [-346.667] -- 0:00:36
394000 -- (-353.188) (-346.405) (-345.729) [-345.812] * (-351.197) (-348.292) (-346.794) [-345.539] -- 0:00:36
394500 -- (-349.789) (-346.513) (-347.707) [-346.680] * (-347.784) (-347.370) (-348.903) [-347.485] -- 0:00:36
395000 -- [-349.946] (-344.893) (-346.535) (-345.861) * [-348.131] (-345.093) (-351.054) (-346.343) -- 0:00:36
Average standard deviation of split frequencies: 0.010338
395500 -- (-347.154) (-347.729) [-348.357] (-347.220) * (-349.080) [-348.836] (-348.278) (-347.162) -- 0:00:36
396000 -- (-345.782) [-345.012] (-346.021) (-346.466) * (-348.803) (-346.456) (-349.359) [-345.495] -- 0:00:36
396500 -- (-349.450) (-350.161) [-345.502] (-349.389) * (-349.126) [-345.430] (-347.946) (-345.878) -- 0:00:36
397000 -- [-351.805] (-346.127) (-345.260) (-347.753) * [-345.701] (-347.332) (-346.209) (-346.334) -- 0:00:36
397500 -- (-347.269) (-349.005) (-349.288) [-347.027] * (-345.227) (-347.018) [-346.388] (-345.053) -- 0:00:36
398000 -- [-346.082] (-348.824) (-347.631) (-345.729) * (-346.827) (-346.025) (-353.067) [-346.070] -- 0:00:36
398500 -- (-348.753) [-347.276] (-348.925) (-348.235) * (-348.266) (-352.059) (-346.699) [-344.952] -- 0:00:36
399000 -- (-347.475) (-347.510) (-346.245) [-348.655] * (-347.616) (-348.230) (-351.105) [-346.353] -- 0:00:36
399500 -- (-347.301) [-348.281] (-346.929) (-347.741) * (-347.062) (-345.539) (-349.044) [-345.457] -- 0:00:36
400000 -- [-344.715] (-347.225) (-346.713) (-347.407) * (-347.157) (-347.311) (-346.101) [-345.329] -- 0:00:36
Average standard deviation of split frequencies: 0.010403
400500 -- [-345.737] (-349.110) (-349.622) (-348.064) * [-345.652] (-345.584) (-348.262) (-346.016) -- 0:00:35
401000 -- (-347.432) (-347.393) [-345.199] (-349.092) * [-345.117] (-345.677) (-351.036) (-348.629) -- 0:00:35
401500 -- (-345.356) (-346.033) [-345.947] (-347.677) * [-346.543] (-347.196) (-348.255) (-347.850) -- 0:00:35
402000 -- (-345.761) [-345.727] (-347.418) (-346.248) * (-344.909) [-346.474] (-346.109) (-349.359) -- 0:00:35
402500 -- (-346.191) [-347.428] (-347.326) (-348.010) * (-347.663) (-346.706) [-345.340] (-345.939) -- 0:00:37
403000 -- [-345.656] (-347.316) (-348.764) (-349.179) * (-351.747) (-346.544) [-345.911] (-345.757) -- 0:00:37
403500 -- [-346.707] (-346.140) (-346.728) (-345.453) * (-348.694) [-345.372] (-345.450) (-345.591) -- 0:00:36
404000 -- (-347.354) [-345.553] (-347.821) (-345.772) * (-346.107) (-350.042) (-346.341) [-345.386] -- 0:00:36
404500 -- (-347.568) [-345.886] (-347.489) (-347.191) * (-345.010) [-345.253] (-349.172) (-345.789) -- 0:00:36
405000 -- (-347.199) (-346.348) [-345.323] (-347.155) * (-348.574) (-346.724) [-347.306] (-349.680) -- 0:00:36
Average standard deviation of split frequencies: 0.010817
405500 -- (-345.327) (-347.511) [-345.835] (-345.984) * [-345.577] (-348.247) (-349.091) (-348.027) -- 0:00:36
406000 -- (-345.586) (-348.668) [-349.373] (-346.435) * (-348.511) (-346.661) (-347.753) [-346.611] -- 0:00:36
406500 -- (-345.808) [-347.338] (-345.345) (-348.405) * [-347.753] (-345.485) (-346.392) (-346.422) -- 0:00:36
407000 -- (-348.878) [-346.549] (-345.466) (-346.815) * (-351.187) [-345.803] (-348.580) (-349.232) -- 0:00:36
407500 -- (-346.343) (-346.675) (-345.967) [-347.414] * (-345.361) [-346.054] (-345.718) (-349.874) -- 0:00:36
408000 -- (-346.808) (-345.299) (-345.130) [-346.632] * (-346.185) (-345.880) (-347.198) [-347.368] -- 0:00:36
408500 -- (-346.150) (-345.413) (-346.939) [-346.698] * [-346.899] (-348.889) (-347.193) (-345.827) -- 0:00:36
409000 -- (-345.645) (-346.510) (-347.360) [-346.984] * [-346.325] (-346.399) (-347.809) (-345.775) -- 0:00:36
409500 -- (-347.023) (-349.079) (-346.658) [-347.064] * (-346.361) (-346.589) [-346.238] (-345.516) -- 0:00:36
410000 -- (-349.585) (-350.032) [-347.303] (-349.342) * (-348.654) (-346.063) (-346.896) [-348.853] -- 0:00:35
Average standard deviation of split frequencies: 0.011056
410500 -- (-345.986) [-348.522] (-346.079) (-349.565) * (-347.780) (-347.674) [-345.574] (-347.720) -- 0:00:35
411000 -- [-346.128] (-347.117) (-345.320) (-348.000) * (-346.224) (-345.748) [-348.932] (-348.631) -- 0:00:35
411500 -- [-346.043] (-348.453) (-345.694) (-347.801) * [-350.755] (-347.721) (-346.100) (-350.197) -- 0:00:35
412000 -- (-346.840) [-345.288] (-346.720) (-345.316) * (-350.865) (-348.309) [-346.829] (-350.255) -- 0:00:35
412500 -- [-347.307] (-347.028) (-347.198) (-345.772) * [-346.405] (-348.753) (-345.599) (-347.128) -- 0:00:35
413000 -- (-346.933) [-348.380] (-346.637) (-345.959) * (-348.035) [-347.809] (-346.798) (-347.600) -- 0:00:35
413500 -- (-349.705) (-349.204) (-345.868) [-350.797] * (-347.778) (-346.220) [-345.523] (-347.060) -- 0:00:35
414000 -- (-353.740) [-345.411] (-351.312) (-351.873) * [-346.206] (-345.229) (-347.038) (-349.157) -- 0:00:35
414500 -- [-346.554] (-347.770) (-349.620) (-347.678) * [-346.024] (-346.437) (-344.775) (-346.072) -- 0:00:35
415000 -- [-346.511] (-346.695) (-346.453) (-348.371) * (-345.294) (-348.024) (-348.519) [-351.245] -- 0:00:35
Average standard deviation of split frequencies: 0.010974
415500 -- [-346.235] (-345.512) (-346.921) (-350.603) * (-345.815) (-348.710) (-347.269) [-346.418] -- 0:00:35
416000 -- [-346.995] (-345.521) (-347.455) (-347.444) * (-346.314) (-348.248) [-348.993] (-346.862) -- 0:00:35
416500 -- (-346.304) [-345.934] (-346.373) (-347.747) * (-345.188) [-347.220] (-346.328) (-344.865) -- 0:00:35
417000 -- (-345.361) (-345.481) (-347.361) [-348.096] * (-345.026) (-350.446) [-346.879] (-348.627) -- 0:00:34
417500 -- (-345.701) [-346.026] (-350.095) (-347.616) * [-346.626] (-356.255) (-349.305) (-346.409) -- 0:00:34
418000 -- (-347.388) [-346.311] (-346.315) (-346.183) * (-346.074) (-358.979) [-347.639] (-348.669) -- 0:00:34
418500 -- (-352.692) (-346.189) [-344.973] (-351.662) * [-349.490] (-351.107) (-346.818) (-347.017) -- 0:00:34
419000 -- [-346.518] (-345.376) (-346.463) (-348.706) * (-347.833) [-346.540] (-345.443) (-345.804) -- 0:00:34
419500 -- (-349.104) (-349.024) [-345.220] (-348.370) * (-347.677) (-350.180) (-346.257) [-347.116] -- 0:00:34
420000 -- [-345.534] (-346.171) (-345.522) (-347.542) * [-345.702] (-346.898) (-347.063) (-345.471) -- 0:00:35
Average standard deviation of split frequencies: 0.010557
420500 -- (-348.475) (-345.461) (-345.694) [-347.581] * (-346.689) (-345.981) (-345.413) [-345.214] -- 0:00:35
421000 -- (-348.005) [-345.538] (-346.914) (-345.857) * [-346.961] (-347.640) (-346.240) (-346.155) -- 0:00:35
421500 -- (-345.735) (-346.902) (-345.994) [-348.209] * (-345.971) [-351.041] (-346.966) (-345.618) -- 0:00:35
422000 -- (-349.594) (-350.105) (-346.889) [-346.595] * (-348.272) (-347.012) (-352.826) [-347.048] -- 0:00:35
422500 -- (-347.949) [-347.540] (-344.799) (-348.323) * (-346.550) (-351.358) (-352.332) [-347.821] -- 0:00:35
423000 -- (-350.051) (-350.108) [-347.035] (-349.081) * (-345.934) [-346.472] (-346.115) (-347.502) -- 0:00:35
423500 -- (-345.848) [-349.305] (-346.813) (-346.451) * (-349.450) (-347.319) (-354.543) [-346.457] -- 0:00:35
424000 -- (-347.540) (-349.755) [-347.196] (-348.202) * (-348.345) (-345.596) (-346.277) [-347.378] -- 0:00:35
424500 -- (-348.023) (-347.661) (-349.056) [-347.733] * [-347.742] (-346.506) (-347.766) (-348.854) -- 0:00:35
425000 -- (-347.201) (-349.215) [-348.431] (-348.285) * (-346.836) (-345.747) [-346.413] (-346.010) -- 0:00:35
Average standard deviation of split frequencies: 0.010017
425500 -- (-348.286) (-346.808) [-354.052] (-346.054) * [-351.472] (-345.760) (-347.505) (-350.314) -- 0:00:35
426000 -- (-356.475) (-346.440) (-349.201) [-347.838] * (-348.594) (-350.394) [-348.167] (-349.283) -- 0:00:35
426500 -- (-345.204) (-346.696) (-348.197) [-350.237] * [-345.696] (-349.856) (-352.222) (-349.596) -- 0:00:34
427000 -- (-345.692) (-345.820) [-347.300] (-346.411) * (-346.385) (-349.831) (-345.852) [-346.480] -- 0:00:34
427500 -- (-349.114) (-347.618) (-345.109) [-347.889] * [-345.998] (-349.039) (-346.206) (-347.456) -- 0:00:34
428000 -- (-346.253) (-350.251) (-345.561) [-347.807] * (-347.267) [-347.122] (-347.551) (-348.053) -- 0:00:34
428500 -- (-345.556) (-346.023) [-346.656] (-347.226) * (-349.369) (-347.001) (-346.231) [-347.697] -- 0:00:34
429000 -- [-345.508] (-346.791) (-350.278) (-347.871) * [-348.070] (-350.284) (-349.214) (-346.142) -- 0:00:34
429500 -- (-347.963) (-351.464) (-349.503) [-347.288] * (-351.582) (-350.373) (-346.311) [-347.248] -- 0:00:34
430000 -- (-347.800) [-347.825] (-355.283) (-349.921) * (-349.861) (-350.939) [-349.752] (-348.164) -- 0:00:34
Average standard deviation of split frequencies: 0.010831
430500 -- (-350.057) (-347.088) (-351.326) [-347.342] * (-350.181) [-348.834] (-345.114) (-348.404) -- 0:00:34
431000 -- (-347.845) [-348.411] (-347.201) (-351.397) * [-346.104] (-348.890) (-345.291) (-347.828) -- 0:00:34
431500 -- [-345.918] (-348.748) (-348.358) (-345.986) * (-348.032) [-349.731] (-346.404) (-349.524) -- 0:00:34
432000 -- (-345.867) (-346.585) [-346.079] (-345.796) * [-345.620] (-348.203) (-346.390) (-344.907) -- 0:00:34
432500 -- (-349.379) (-346.005) (-347.104) [-349.764] * [-346.508] (-348.497) (-350.318) (-345.536) -- 0:00:34
433000 -- (-346.788) (-345.240) [-346.172] (-349.244) * (-346.618) (-346.601) [-346.424] (-350.447) -- 0:00:34
433500 -- (-345.293) (-350.896) (-350.378) [-346.703] * (-348.922) [-351.552] (-346.173) (-345.988) -- 0:00:33
434000 -- (-348.698) [-346.085] (-345.947) (-345.842) * (-349.379) [-345.752] (-348.418) (-350.136) -- 0:00:33
434500 -- [-345.583] (-348.941) (-348.245) (-346.641) * [-347.740] (-346.149) (-350.325) (-347.832) -- 0:00:33
435000 -- [-348.407] (-348.088) (-347.413) (-348.251) * (-346.286) (-348.829) (-345.466) [-346.699] -- 0:00:33
Average standard deviation of split frequencies: 0.009902
435500 -- (-350.708) (-346.120) [-346.453] (-347.157) * [-345.397] (-348.497) (-346.742) (-350.830) -- 0:00:33
436000 -- (-353.446) (-347.089) [-346.922] (-348.410) * (-348.525) (-345.157) [-347.686] (-346.660) -- 0:00:33
436500 -- (-348.721) [-347.284] (-345.041) (-347.753) * (-351.101) (-351.706) [-349.352] (-345.539) -- 0:00:33
437000 -- [-349.200] (-346.286) (-348.948) (-347.979) * (-346.031) (-346.271) [-346.846] (-346.668) -- 0:00:34
437500 -- (-345.927) [-346.789] (-345.857) (-348.528) * (-346.581) [-346.218] (-348.415) (-345.782) -- 0:00:34
438000 -- (-347.043) (-348.763) (-345.316) [-346.804] * (-351.049) [-346.640] (-347.456) (-348.070) -- 0:00:34
438500 -- (-345.652) (-348.318) (-348.600) [-345.915] * (-357.250) (-351.148) (-345.953) [-348.126] -- 0:00:34
439000 -- (-350.637) (-349.045) (-346.233) [-344.908] * (-347.926) (-349.100) (-348.604) [-347.417] -- 0:00:34
439500 -- [-346.773] (-349.237) (-346.876) (-344.870) * (-348.151) (-348.417) (-345.426) [-347.093] -- 0:00:34
440000 -- (-346.699) (-348.035) (-348.251) [-346.825] * (-345.795) (-345.207) (-353.012) [-346.088] -- 0:00:34
Average standard deviation of split frequencies: 0.009568
440500 -- (-346.563) (-348.194) (-348.561) [-346.762] * (-347.353) (-346.169) [-346.117] (-346.755) -- 0:00:34
441000 -- [-345.603] (-347.850) (-348.296) (-349.455) * (-346.240) [-348.384] (-346.389) (-353.900) -- 0:00:34
441500 -- (-346.655) [-345.559] (-353.874) (-351.726) * (-345.639) [-347.080] (-346.772) (-345.483) -- 0:00:34
442000 -- (-346.484) [-347.503] (-351.473) (-346.764) * [-348.033] (-345.704) (-346.299) (-347.634) -- 0:00:34
442500 -- [-346.898] (-345.052) (-347.736) (-345.643) * (-349.466) [-345.729] (-348.116) (-349.809) -- 0:00:34
443000 -- (-349.289) (-344.858) (-346.157) [-348.299] * (-347.554) (-346.377) [-348.056] (-350.430) -- 0:00:33
443500 -- (-346.907) (-346.735) (-351.117) [-348.500] * [-347.955] (-346.508) (-344.978) (-347.812) -- 0:00:33
444000 -- (-349.529) (-348.252) (-350.740) [-349.145] * (-352.697) (-347.266) [-345.565] (-347.545) -- 0:00:33
444500 -- [-350.055] (-349.719) (-348.589) (-347.203) * (-349.966) [-345.532] (-346.885) (-349.364) -- 0:00:33
445000 -- (-346.126) (-346.841) (-345.724) [-346.606] * [-345.885] (-347.581) (-346.106) (-345.815) -- 0:00:33
Average standard deviation of split frequencies: 0.009336
445500 -- [-345.519] (-346.203) (-351.308) (-345.836) * (-344.854) (-348.023) [-348.300] (-348.138) -- 0:00:33
446000 -- (-348.396) [-345.293] (-347.807) (-346.658) * [-345.000] (-347.957) (-352.839) (-347.486) -- 0:00:33
446500 -- (-352.358) [-347.390] (-349.792) (-345.382) * (-346.674) [-345.784] (-349.866) (-346.549) -- 0:00:33
447000 -- (-348.012) (-346.392) (-347.489) [-346.444] * (-346.423) (-345.318) [-345.974] (-347.320) -- 0:00:33
447500 -- [-346.873] (-349.652) (-348.440) (-347.502) * (-347.050) (-347.117) [-346.549] (-350.277) -- 0:00:33
448000 -- (-353.672) [-346.989] (-348.815) (-346.223) * [-345.783] (-352.676) (-349.862) (-349.183) -- 0:00:33
448500 -- (-345.332) (-346.019) [-346.096] (-347.336) * (-346.753) (-345.880) [-349.109] (-348.483) -- 0:00:33
449000 -- [-347.326] (-345.279) (-352.626) (-347.480) * [-346.758] (-347.209) (-345.883) (-350.184) -- 0:00:33
449500 -- (-345.872) [-349.594] (-348.943) (-347.717) * [-348.913] (-346.690) (-350.903) (-346.871) -- 0:00:33
450000 -- (-349.055) [-348.997] (-347.094) (-347.952) * (-349.159) (-345.324) (-349.302) [-346.494] -- 0:00:33
Average standard deviation of split frequencies: 0.008891
450500 -- [-345.762] (-346.095) (-345.752) (-346.552) * (-347.592) (-345.771) [-348.596] (-345.555) -- 0:00:32
451000 -- (-352.091) (-346.805) [-346.668] (-348.396) * [-346.143] (-346.898) (-350.375) (-347.885) -- 0:00:32
451500 -- (-349.730) (-347.559) (-345.834) [-347.208] * (-347.855) (-345.548) (-349.327) [-347.595] -- 0:00:32
452000 -- (-348.372) (-348.637) (-347.447) [-347.715] * [-346.650] (-347.126) (-347.395) (-346.297) -- 0:00:32
452500 -- (-346.094) (-348.668) (-345.842) [-346.363] * (-345.372) [-346.225] (-345.756) (-347.390) -- 0:00:32
453000 -- [-345.710] (-348.581) (-345.102) (-346.987) * (-346.315) (-345.677) [-347.916] (-346.295) -- 0:00:32
453500 -- [-347.513] (-346.231) (-346.393) (-345.856) * (-346.996) (-352.673) [-347.011] (-346.915) -- 0:00:32
454000 -- [-348.585] (-345.521) (-351.254) (-349.749) * (-350.204) (-348.962) (-349.000) [-346.354] -- 0:00:33
454500 -- [-345.834] (-347.808) (-346.515) (-346.489) * (-346.035) (-349.882) (-346.150) [-345.894] -- 0:00:33
455000 -- [-345.264] (-346.214) (-349.940) (-346.704) * [-345.415] (-348.618) (-348.111) (-350.375) -- 0:00:33
Average standard deviation of split frequencies: 0.009189
455500 -- [-346.109] (-348.436) (-351.980) (-351.647) * (-346.751) (-350.083) [-348.178] (-347.326) -- 0:00:33
456000 -- [-346.427] (-347.198) (-347.231) (-349.576) * (-345.086) [-349.866] (-349.142) (-346.635) -- 0:00:33
456500 -- [-345.451] (-345.574) (-346.780) (-348.011) * (-345.453) (-350.374) [-346.114] (-349.146) -- 0:00:33
457000 -- (-345.390) (-345.581) (-347.051) [-348.230] * (-347.388) (-347.178) (-346.370) [-349.033] -- 0:00:33
457500 -- (-345.929) (-350.885) (-349.221) [-348.362] * (-350.606) (-347.940) [-347.190] (-350.614) -- 0:00:33
458000 -- (-347.517) (-354.432) (-348.938) [-345.763] * (-348.678) (-347.349) [-347.073] (-350.923) -- 0:00:33
458500 -- (-346.495) (-349.605) [-348.366] (-348.129) * (-350.714) (-345.347) (-346.046) [-352.038] -- 0:00:33
459000 -- (-345.440) (-350.348) (-348.440) [-347.866] * (-352.356) (-348.109) [-346.091] (-349.820) -- 0:00:33
459500 -- (-348.626) (-348.475) [-345.290] (-346.776) * (-347.181) [-345.743] (-346.685) (-350.289) -- 0:00:32
460000 -- (-351.419) (-348.833) (-349.886) [-346.462] * (-345.948) (-347.622) [-348.421] (-350.227) -- 0:00:32
Average standard deviation of split frequencies: 0.009096
460500 -- (-348.484) [-346.234] (-351.132) (-346.604) * (-345.326) (-349.896) (-346.930) [-349.725] -- 0:00:32
461000 -- (-351.804) (-347.090) [-347.430] (-348.024) * (-345.810) (-348.025) (-345.399) [-347.423] -- 0:00:32
461500 -- (-346.436) [-346.546] (-349.512) (-346.763) * (-345.620) (-345.610) [-345.732] (-348.662) -- 0:00:32
462000 -- [-347.951] (-345.555) (-345.110) (-345.572) * (-349.473) (-346.036) (-345.159) [-346.251] -- 0:00:32
462500 -- (-345.922) (-346.601) (-348.703) [-346.369] * (-347.281) [-345.861] (-348.010) (-351.001) -- 0:00:32
463000 -- [-347.812] (-345.670) (-346.354) (-344.866) * (-346.467) (-346.683) (-348.500) [-349.232] -- 0:00:32
463500 -- (-346.462) [-346.229] (-346.544) (-346.112) * (-345.755) (-351.874) (-346.718) [-345.507] -- 0:00:32
464000 -- (-347.144) (-345.921) [-347.404] (-345.727) * (-346.914) (-348.813) [-346.872] (-345.083) -- 0:00:32
464500 -- [-345.252] (-346.118) (-349.649) (-345.295) * (-352.537) [-345.272] (-345.665) (-345.242) -- 0:00:32
465000 -- (-346.746) [-345.190] (-347.087) (-346.492) * [-350.000] (-347.928) (-346.841) (-345.236) -- 0:00:32
Average standard deviation of split frequencies: 0.008655
465500 -- [-347.482] (-346.986) (-345.765) (-346.927) * (-351.529) (-351.574) (-348.088) [-347.748] -- 0:00:32
466000 -- (-345.821) (-347.637) [-346.464] (-347.362) * (-345.443) [-347.424] (-347.208) (-345.011) -- 0:00:32
466500 -- (-346.213) [-346.148] (-352.435) (-347.934) * (-349.197) [-346.455] (-346.434) (-347.013) -- 0:00:32
467000 -- (-349.865) (-346.013) [-350.876] (-346.097) * (-345.119) [-350.537] (-347.670) (-347.196) -- 0:00:31
467500 -- [-347.327] (-346.766) (-347.028) (-345.563) * [-346.735] (-347.832) (-346.500) (-349.092) -- 0:00:31
468000 -- (-348.831) (-350.938) (-354.110) [-346.935] * [-346.688] (-350.978) (-350.748) (-349.435) -- 0:00:31
468500 -- (-347.823) (-346.707) (-349.701) [-346.489] * [-345.937] (-347.461) (-349.688) (-347.879) -- 0:00:31
469000 -- (-347.674) (-348.781) [-349.975] (-346.115) * [-345.400] (-348.919) (-348.747) (-346.692) -- 0:00:31
469500 -- [-345.840] (-346.677) (-355.467) (-345.365) * (-345.153) (-345.703) (-347.806) [-346.008] -- 0:00:31
470000 -- (-346.461) (-350.751) [-348.574] (-348.308) * (-345.837) (-346.048) (-346.196) [-348.657] -- 0:00:31
Average standard deviation of split frequencies: 0.007957
470500 -- [-347.459] (-348.515) (-347.887) (-346.586) * (-347.027) (-346.535) (-349.903) [-347.718] -- 0:00:31
471000 -- (-347.795) (-348.396) (-348.055) [-346.390] * [-346.366] (-347.816) (-346.299) (-345.812) -- 0:00:32
471500 -- (-346.239) (-350.488) [-348.906] (-344.996) * [-347.217] (-350.939) (-346.462) (-347.443) -- 0:00:32
472000 -- (-347.462) [-346.311] (-346.508) (-345.527) * (-348.287) [-346.167] (-345.144) (-346.031) -- 0:00:32
472500 -- (-348.669) (-345.922) [-344.905] (-347.130) * (-346.404) (-348.275) (-346.927) [-347.852] -- 0:00:32
473000 -- (-346.560) (-346.334) [-346.254] (-346.239) * (-345.210) [-344.690] (-348.623) (-344.697) -- 0:00:32
473500 -- (-347.939) (-347.645) (-348.147) [-344.691] * (-346.788) [-344.863] (-348.829) (-346.755) -- 0:00:32
474000 -- (-347.353) [-345.316] (-355.498) (-345.119) * (-347.476) [-346.869] (-347.003) (-349.375) -- 0:00:32
474500 -- (-346.636) (-347.303) (-348.325) [-345.230] * [-345.704] (-348.222) (-346.897) (-348.511) -- 0:00:32
475000 -- [-345.665] (-347.494) (-349.660) (-347.756) * [-347.088] (-344.754) (-346.870) (-347.836) -- 0:00:32
Average standard deviation of split frequencies: 0.007428
475500 -- (-346.586) (-347.526) (-348.031) [-345.530] * (-349.400) (-346.028) (-349.053) [-348.167] -- 0:00:31
476000 -- (-351.041) (-345.651) [-349.964] (-347.175) * (-350.413) [-348.129] (-350.395) (-345.640) -- 0:00:31
476500 -- (-347.301) (-345.660) (-346.587) [-346.399] * (-349.459) (-348.336) [-347.918] (-345.677) -- 0:00:31
477000 -- (-347.394) (-350.489) [-346.416] (-354.162) * (-348.114) [-347.389] (-349.287) (-345.166) -- 0:00:31
477500 -- [-347.288] (-346.551) (-345.122) (-347.829) * (-345.399) (-346.690) [-345.738] (-346.731) -- 0:00:31
478000 -- [-347.321] (-348.765) (-344.843) (-346.931) * (-347.560) (-347.743) [-346.187] (-346.760) -- 0:00:31
478500 -- (-347.544) (-350.332) [-346.127] (-348.959) * [-347.856] (-349.783) (-347.978) (-349.719) -- 0:00:31
479000 -- (-346.872) [-346.344] (-346.510) (-347.864) * [-348.591] (-348.930) (-347.041) (-350.070) -- 0:00:31
479500 -- (-357.110) [-346.119] (-347.131) (-349.008) * (-350.314) [-347.807] (-345.999) (-347.120) -- 0:00:31
480000 -- (-345.396) [-346.536] (-347.780) (-345.601) * (-352.248) (-347.274) [-346.793] (-347.157) -- 0:00:31
Average standard deviation of split frequencies: 0.007682
480500 -- (-348.491) (-347.595) (-347.191) [-346.388] * [-346.402] (-346.993) (-348.036) (-347.070) -- 0:00:31
481000 -- (-345.905) (-348.981) (-349.089) [-346.451] * (-345.912) (-349.172) [-349.064] (-346.631) -- 0:00:31
481500 -- (-346.161) (-347.082) [-345.870] (-350.143) * (-347.265) (-349.211) (-346.180) [-345.978] -- 0:00:31
482000 -- (-345.114) (-347.670) [-345.861] (-347.675) * [-350.104] (-348.134) (-345.470) (-347.764) -- 0:00:31
482500 -- (-346.848) [-345.817] (-348.862) (-349.324) * (-346.906) [-346.793] (-353.209) (-348.038) -- 0:00:31
483000 -- (-349.394) [-345.259] (-345.203) (-350.606) * (-348.101) (-349.114) [-345.503] (-347.122) -- 0:00:31
483500 -- (-347.936) [-344.915] (-348.008) (-345.921) * (-346.690) (-345.851) [-346.394] (-345.628) -- 0:00:30
484000 -- (-348.740) (-345.636) [-346.396] (-345.109) * (-347.744) (-347.526) [-350.856] (-345.838) -- 0:00:30
484500 -- [-347.650] (-348.122) (-348.440) (-346.826) * [-347.876] (-350.299) (-347.406) (-347.808) -- 0:00:30
485000 -- [-347.485] (-347.860) (-350.022) (-346.153) * (-346.480) (-348.138) (-351.466) [-346.615] -- 0:00:30
Average standard deviation of split frequencies: 0.007598
485500 -- (-348.076) (-348.355) (-345.764) [-348.203] * [-350.511] (-351.151) (-347.887) (-348.151) -- 0:00:30
486000 -- (-347.388) (-349.346) (-346.404) [-347.965] * (-345.866) [-346.285] (-346.842) (-347.014) -- 0:00:30
486500 -- [-345.015] (-346.835) (-346.211) (-347.191) * (-348.784) [-345.333] (-346.759) (-348.175) -- 0:00:30
487000 -- (-348.943) (-346.102) [-345.289] (-345.075) * (-345.757) (-345.280) [-346.389] (-350.130) -- 0:00:30
487500 -- (-346.187) (-346.301) (-344.706) [-346.202] * (-346.622) (-348.188) [-346.353] (-347.559) -- 0:00:30
488000 -- (-348.053) [-345.318] (-348.910) (-344.754) * (-345.562) (-345.321) [-345.851] (-350.552) -- 0:00:30
488500 -- (-346.039) (-346.488) (-346.178) [-348.254] * (-345.673) [-349.898] (-346.392) (-346.935) -- 0:00:31
489000 -- (-346.111) (-345.562) (-346.049) [-346.873] * (-345.035) (-349.008) (-346.426) [-345.812] -- 0:00:31
489500 -- [-345.925] (-345.886) (-345.912) (-350.014) * (-347.266) (-348.888) [-350.500] (-347.010) -- 0:00:31
490000 -- (-348.452) [-347.240] (-347.646) (-346.348) * (-345.175) (-345.174) (-348.552) [-346.982] -- 0:00:31
Average standard deviation of split frequencies: 0.007579
490500 -- (-345.751) (-346.881) (-347.718) [-345.611] * [-345.851] (-347.002) (-345.767) (-349.039) -- 0:00:31
491000 -- (-345.858) [-346.215] (-346.779) (-345.414) * (-346.601) (-349.477) (-345.893) [-348.032] -- 0:00:31
491500 -- (-346.971) (-347.152) (-345.502) [-346.417] * (-350.589) (-345.784) [-348.299] (-349.139) -- 0:00:31
492000 -- [-347.586] (-348.690) (-349.709) (-347.458) * (-350.686) [-345.158] (-347.480) (-347.426) -- 0:00:30
492500 -- (-353.342) (-348.836) (-348.466) [-347.352] * (-346.353) [-345.170] (-346.887) (-348.665) -- 0:00:30
493000 -- [-346.799] (-347.193) (-346.869) (-348.974) * (-351.096) (-345.129) [-345.544] (-346.470) -- 0:00:30
493500 -- (-347.847) (-348.862) (-345.984) [-347.016] * (-346.729) [-346.556] (-346.087) (-346.978) -- 0:00:30
494000 -- (-346.912) (-346.713) [-345.369] (-346.951) * (-350.628) [-346.317] (-345.354) (-345.124) -- 0:00:30
494500 -- (-345.226) [-346.340] (-347.954) (-347.923) * (-351.620) (-348.250) [-348.604] (-345.686) -- 0:00:30
495000 -- (-346.161) (-347.681) (-350.628) [-346.491] * (-345.538) (-348.638) [-347.094] (-346.400) -- 0:00:30
Average standard deviation of split frequencies: 0.007815
495500 -- [-346.568] (-350.420) (-351.183) (-348.487) * (-347.784) (-348.619) (-347.232) [-347.324] -- 0:00:30
496000 -- (-345.581) (-346.636) (-348.486) [-347.151] * (-346.119) [-345.665] (-345.726) (-349.437) -- 0:00:30
496500 -- (-346.045) (-346.100) [-347.096] (-347.220) * (-346.596) (-348.605) (-352.874) [-345.778] -- 0:00:30
497000 -- [-346.385] (-348.656) (-347.286) (-347.257) * (-345.101) [-348.240] (-348.992) (-346.928) -- 0:00:30
497500 -- (-345.918) (-345.388) [-345.478] (-347.085) * (-345.372) (-346.036) (-346.063) [-348.102] -- 0:00:30
498000 -- (-344.674) (-349.145) [-348.954] (-347.209) * (-347.445) (-347.984) [-345.039] (-345.254) -- 0:00:30
498500 -- (-347.629) (-348.748) (-346.770) [-344.919] * (-350.585) [-350.963] (-345.885) (-345.350) -- 0:00:30
499000 -- (-345.245) (-350.695) [-346.523] (-345.047) * (-350.161) [-349.173] (-344.889) (-350.415) -- 0:00:30
499500 -- (-347.493) (-347.071) [-346.174] (-344.864) * (-347.390) (-352.362) [-344.676] (-345.936) -- 0:00:30
500000 -- [-346.774] (-346.880) (-345.225) (-345.090) * (-347.308) (-352.745) [-346.052] (-345.887) -- 0:00:30
Average standard deviation of split frequencies: 0.007323
500500 -- [-346.888] (-345.799) (-345.672) (-345.177) * (-345.218) (-345.497) [-345.734] (-348.294) -- 0:00:29
501000 -- (-345.687) (-346.803) [-349.181] (-346.467) * [-347.943] (-347.155) (-344.886) (-345.811) -- 0:00:29
501500 -- (-346.710) (-345.176) [-347.501] (-346.946) * (-350.922) [-349.608] (-346.732) (-347.462) -- 0:00:29
502000 -- (-349.605) [-346.347] (-351.968) (-351.413) * [-346.130] (-347.826) (-346.603) (-348.218) -- 0:00:29
502500 -- (-347.626) (-347.881) (-350.796) [-345.139] * (-349.942) [-347.080] (-348.885) (-349.332) -- 0:00:29
503000 -- (-346.962) (-347.520) [-347.172] (-349.785) * [-347.779] (-346.473) (-354.378) (-347.470) -- 0:00:29
503500 -- (-346.329) (-350.771) [-345.833] (-346.344) * (-347.329) [-347.590] (-347.432) (-345.956) -- 0:00:29
504000 -- (-347.896) (-350.666) [-346.048] (-347.176) * (-347.265) [-346.295] (-345.871) (-345.838) -- 0:00:29
504500 -- (-346.467) (-345.986) [-347.249] (-346.351) * (-345.432) [-347.747] (-345.253) (-350.272) -- 0:00:29
505000 -- (-347.227) (-354.853) [-347.733] (-347.933) * [-345.592] (-346.774) (-345.885) (-346.845) -- 0:00:29
Average standard deviation of split frequencies: 0.007992
505500 -- (-347.603) (-345.600) (-348.164) [-346.252] * (-345.983) (-348.585) (-346.575) [-345.235] -- 0:00:30
506000 -- (-347.356) (-345.026) [-346.254] (-346.778) * (-348.840) (-354.668) [-348.569] (-345.269) -- 0:00:30
506500 -- [-347.441] (-346.529) (-345.365) (-347.965) * (-347.863) (-350.828) [-347.391] (-348.597) -- 0:00:30
507000 -- (-344.875) [-349.454] (-345.722) (-350.137) * (-346.625) (-348.309) (-346.174) [-349.113] -- 0:00:30
507500 -- [-345.617] (-349.431) (-345.843) (-350.160) * (-346.080) (-346.808) (-346.376) [-346.788] -- 0:00:30
508000 -- (-345.335) (-347.405) [-345.746] (-345.355) * (-345.481) (-347.788) [-345.918] (-355.370) -- 0:00:30
508500 -- (-349.600) (-347.915) (-345.537) [-344.688] * (-346.447) (-347.665) (-345.685) [-347.762] -- 0:00:29
509000 -- (-350.860) (-347.594) (-349.482) [-345.830] * [-348.642] (-350.814) (-345.448) (-349.284) -- 0:00:29
509500 -- [-350.218] (-349.293) (-346.685) (-345.061) * (-346.351) (-351.208) [-346.860] (-347.171) -- 0:00:29
510000 -- [-348.189] (-353.604) (-349.455) (-349.226) * (-347.670) (-349.437) (-347.405) [-345.713] -- 0:00:29
Average standard deviation of split frequencies: 0.008462
510500 -- [-346.552] (-348.258) (-346.132) (-345.860) * (-345.243) (-345.804) (-345.644) [-346.463] -- 0:00:29
511000 -- (-347.022) [-345.822] (-348.222) (-349.900) * [-347.923] (-347.145) (-346.052) (-344.826) -- 0:00:29
511500 -- (-347.949) (-346.814) [-346.708] (-346.265) * (-345.706) [-346.107] (-347.364) (-345.866) -- 0:00:29
512000 -- (-347.724) (-347.562) [-345.141] (-345.274) * [-346.179] (-346.826) (-345.995) (-347.466) -- 0:00:29
512500 -- (-348.377) (-349.845) (-346.102) [-350.440] * [-348.287] (-347.136) (-347.771) (-345.293) -- 0:00:29
513000 -- (-348.688) [-347.576] (-352.398) (-346.783) * (-350.584) (-346.569) (-344.928) [-350.243] -- 0:00:29
513500 -- (-345.754) (-345.896) (-346.668) [-345.946] * (-349.704) (-346.775) [-346.808] (-348.877) -- 0:00:29
514000 -- (-345.170) [-347.406] (-350.357) (-347.034) * (-347.677) [-345.291] (-345.819) (-347.092) -- 0:00:29
514500 -- (-346.120) [-346.048] (-350.414) (-348.826) * [-346.556] (-345.372) (-348.992) (-345.904) -- 0:00:29
515000 -- (-346.155) (-346.209) [-346.505] (-347.309) * (-347.337) (-344.862) [-346.795] (-345.299) -- 0:00:29
Average standard deviation of split frequencies: 0.008171
515500 -- (-344.845) (-346.347) (-348.982) [-347.436] * (-351.695) (-346.312) [-347.056] (-347.098) -- 0:00:29
516000 -- (-345.029) [-345.961] (-350.734) (-347.297) * (-346.849) (-348.047) (-348.540) [-347.382] -- 0:00:29
516500 -- (-350.134) [-345.165] (-347.195) (-348.199) * (-347.214) (-348.137) (-348.553) [-346.291] -- 0:00:29
517000 -- (-350.043) [-345.084] (-346.913) (-348.132) * (-346.458) (-349.368) [-347.303] (-344.849) -- 0:00:28
517500 -- [-347.431] (-350.852) (-346.552) (-348.094) * (-346.927) (-352.613) [-345.829] (-345.357) -- 0:00:28
518000 -- (-347.809) [-347.383] (-346.566) (-347.082) * [-345.965] (-350.178) (-345.426) (-349.460) -- 0:00:28
518500 -- (-347.118) (-349.101) (-348.446) [-345.169] * (-345.292) [-346.931] (-347.068) (-346.430) -- 0:00:28
519000 -- (-345.407) (-347.573) (-345.676) [-346.632] * (-349.976) (-347.594) (-348.493) [-345.152] -- 0:00:28
519500 -- (-348.941) (-346.963) [-345.278] (-346.955) * [-348.709] (-347.366) (-346.563) (-345.515) -- 0:00:28
520000 -- [-351.561] (-347.883) (-345.113) (-348.953) * [-346.989] (-347.792) (-345.807) (-348.209) -- 0:00:28
Average standard deviation of split frequencies: 0.007897
520500 -- (-350.820) [-346.540] (-345.722) (-347.233) * (-346.276) (-347.736) [-351.873] (-346.348) -- 0:00:28
521000 -- (-348.282) (-347.111) (-345.512) [-348.181] * (-346.068) (-347.198) [-346.711] (-346.025) -- 0:00:28
521500 -- [-345.938] (-348.847) (-350.306) (-346.598) * (-346.965) [-345.226] (-345.843) (-345.410) -- 0:00:28
522000 -- (-349.645) (-346.642) [-346.122] (-346.951) * (-347.781) (-345.305) [-346.423] (-349.269) -- 0:00:28
522500 -- (-346.605) (-346.723) [-346.683] (-348.159) * (-346.974) (-345.721) [-345.832] (-347.419) -- 0:00:28
523000 -- (-345.738) (-346.841) [-350.009] (-347.351) * (-346.528) (-346.452) [-347.811] (-348.040) -- 0:00:29
523500 -- (-344.878) (-346.830) [-347.816] (-345.522) * (-347.480) (-347.551) [-345.542] (-346.848) -- 0:00:29
524000 -- (-345.868) (-347.392) [-345.548] (-346.517) * (-348.580) [-346.373] (-346.960) (-347.111) -- 0:00:29
524500 -- [-345.451] (-349.907) (-346.123) (-352.629) * [-347.684] (-348.571) (-347.330) (-345.434) -- 0:00:29
525000 -- [-348.396] (-349.358) (-346.438) (-346.227) * (-351.853) (-349.238) [-348.657] (-346.733) -- 0:00:28
Average standard deviation of split frequencies: 0.007547
525500 -- (-347.377) (-346.624) (-346.865) [-348.468] * (-347.211) (-352.582) (-344.960) [-347.507] -- 0:00:28
526000 -- (-350.476) (-345.085) (-346.329) [-345.830] * (-347.847) [-345.938] (-344.996) (-347.185) -- 0:00:28
526500 -- (-345.614) (-346.864) (-347.541) [-345.394] * [-348.416] (-346.753) (-345.903) (-345.877) -- 0:00:28
527000 -- (-345.614) (-349.148) (-346.665) [-345.871] * (-345.605) (-345.951) (-345.760) [-347.061] -- 0:00:28
527500 -- (-347.639) (-345.218) (-350.527) [-346.217] * (-349.792) [-347.166] (-347.490) (-346.464) -- 0:00:28
528000 -- [-347.377] (-345.721) (-350.812) (-346.972) * [-348.577] (-349.912) (-351.446) (-346.447) -- 0:00:28
528500 -- [-347.752] (-347.542) (-349.656) (-348.473) * (-345.641) (-346.214) (-347.434) [-345.730] -- 0:00:28
529000 -- (-345.224) (-348.939) [-346.961] (-345.692) * (-344.940) (-348.093) [-347.550] (-346.595) -- 0:00:28
529500 -- (-344.940) (-347.154) [-347.387] (-347.803) * [-347.227] (-345.960) (-352.122) (-348.573) -- 0:00:28
530000 -- [-345.342] (-345.871) (-345.370) (-348.560) * (-347.866) (-345.533) (-351.667) [-346.610] -- 0:00:28
Average standard deviation of split frequencies: 0.007434
530500 -- (-347.085) (-345.271) (-345.717) [-349.391] * (-346.664) (-346.901) (-347.149) [-345.401] -- 0:00:28
531000 -- (-346.822) [-345.209] (-347.411) (-349.266) * (-348.687) [-348.757] (-346.874) (-346.094) -- 0:00:28
531500 -- (-347.538) (-348.774) [-347.644] (-347.173) * (-345.426) (-347.656) [-346.902] (-348.996) -- 0:00:28
532000 -- (-347.278) (-347.310) (-347.409) [-346.895] * (-345.238) (-351.491) [-346.189] (-350.678) -- 0:00:28
532500 -- (-349.281) (-347.004) [-347.595] (-352.493) * [-348.163] (-346.888) (-346.416) (-348.966) -- 0:00:28
533000 -- (-347.874) (-347.443) [-347.843] (-349.145) * (-347.493) (-345.196) [-345.317] (-353.727) -- 0:00:28
533500 -- [-346.988] (-348.014) (-350.167) (-348.001) * (-345.762) (-347.126) (-346.265) [-346.220] -- 0:00:27
534000 -- (-350.491) [-346.713] (-353.818) (-346.469) * (-346.835) [-345.322] (-349.262) (-345.462) -- 0:00:27
534500 -- (-346.683) (-348.555) (-349.558) [-346.308] * (-346.799) (-347.810) (-352.031) [-349.196] -- 0:00:27
535000 -- (-346.866) (-345.220) [-347.994] (-349.525) * (-345.523) (-346.128) [-348.449] (-348.705) -- 0:00:27
Average standard deviation of split frequencies: 0.007398
535500 -- (-347.864) (-353.292) [-347.648] (-352.460) * (-348.159) (-349.200) (-348.036) [-347.210] -- 0:00:27
536000 -- [-347.033] (-354.836) (-347.003) (-349.459) * (-346.107) (-346.422) (-346.420) [-347.995] -- 0:00:27
536500 -- (-353.291) (-345.458) [-348.453] (-347.281) * (-351.120) (-344.730) (-345.662) [-351.936] -- 0:00:27
537000 -- [-346.881] (-353.174) (-348.610) (-346.635) * (-347.039) (-348.121) (-345.794) [-345.708] -- 0:00:27
537500 -- (-351.953) (-345.905) [-345.024] (-345.130) * (-350.599) [-345.997] (-347.713) (-344.868) -- 0:00:27
538000 -- [-345.924] (-346.817) (-346.044) (-345.222) * (-346.727) (-346.392) [-347.315] (-345.592) -- 0:00:27
538500 -- (-347.534) (-347.193) (-346.589) [-347.866] * (-347.405) (-350.930) (-350.683) [-347.267] -- 0:00:27
539000 -- [-346.250] (-345.692) (-346.636) (-350.192) * (-347.393) (-347.522) [-346.375] (-347.415) -- 0:00:27
539500 -- (-345.113) [-346.565] (-346.457) (-345.361) * (-348.507) [-347.409] (-347.202) (-345.861) -- 0:00:27
540000 -- [-346.598] (-347.596) (-347.162) (-347.071) * (-347.031) [-350.183] (-348.871) (-346.063) -- 0:00:27
Average standard deviation of split frequencies: 0.006719
540500 -- (-347.406) (-351.887) [-348.234] (-347.163) * [-349.949] (-346.604) (-349.562) (-348.041) -- 0:00:28
541000 -- (-346.760) (-347.000) [-348.495] (-347.515) * (-347.585) (-351.742) (-349.802) [-346.148] -- 0:00:27
541500 -- (-347.126) [-345.576] (-346.500) (-350.001) * (-347.571) (-347.407) (-348.776) [-346.207] -- 0:00:27
542000 -- (-346.632) [-345.112] (-347.629) (-350.328) * (-347.415) (-349.039) [-348.669] (-345.227) -- 0:00:27
542500 -- (-348.432) [-347.305] (-346.761) (-347.796) * (-347.920) (-352.389) (-346.576) [-346.113] -- 0:00:27
543000 -- (-351.412) [-346.918] (-348.856) (-347.416) * (-347.620) (-345.650) [-347.014] (-347.038) -- 0:00:27
543500 -- (-349.992) (-348.242) [-345.581] (-345.930) * [-346.713] (-350.756) (-347.056) (-349.916) -- 0:00:27
544000 -- (-351.593) [-348.786] (-346.746) (-345.909) * (-346.678) (-349.656) [-348.205] (-350.291) -- 0:00:27
544500 -- (-347.067) (-352.231) (-348.084) [-346.555] * [-345.881] (-348.277) (-347.492) (-347.274) -- 0:00:27
545000 -- (-347.543) [-347.245] (-346.004) (-347.916) * [-347.845] (-349.000) (-346.787) (-351.171) -- 0:00:27
Average standard deviation of split frequencies: 0.006399
545500 -- (-347.936) (-346.113) [-347.154] (-347.664) * [-350.142] (-346.685) (-349.824) (-344.683) -- 0:00:27
546000 -- (-348.489) (-347.661) [-350.671] (-348.848) * [-348.535] (-347.769) (-347.611) (-348.108) -- 0:00:27
546500 -- (-345.816) (-348.576) [-347.806] (-349.164) * [-348.524] (-349.816) (-348.138) (-346.646) -- 0:00:27
547000 -- (-347.501) (-347.210) (-347.334) [-346.552] * [-347.252] (-350.241) (-345.401) (-346.369) -- 0:00:27
547500 -- (-346.371) [-350.643] (-347.244) (-353.092) * (-347.663) (-344.900) (-345.430) [-345.862] -- 0:00:27
548000 -- [-347.760] (-349.531) (-346.536) (-345.194) * (-346.237) [-346.855] (-348.918) (-346.385) -- 0:00:27
548500 -- (-348.041) (-346.810) [-348.970] (-345.972) * (-346.980) (-351.258) (-349.333) [-345.293] -- 0:00:27
549000 -- (-347.382) (-346.892) (-351.551) [-346.436] * (-347.868) (-347.412) (-346.853) [-352.070] -- 0:00:27
549500 -- (-348.680) (-345.608) [-346.998] (-345.632) * (-346.130) [-350.287] (-346.427) (-350.298) -- 0:00:27
550000 -- [-347.926] (-345.987) (-347.599) (-346.617) * (-346.593) [-346.581] (-346.162) (-347.438) -- 0:00:27
Average standard deviation of split frequencies: 0.006194
550500 -- (-348.798) (-345.261) [-345.868] (-349.171) * [-346.162] (-349.302) (-348.743) (-346.811) -- 0:00:26
551000 -- (-346.193) [-349.527] (-347.826) (-349.607) * [-346.960] (-348.045) (-346.197) (-348.072) -- 0:00:26
551500 -- (-346.512) (-348.433) (-349.587) [-345.505] * [-347.027] (-349.037) (-346.714) (-356.955) -- 0:00:26
552000 -- [-346.473] (-346.244) (-347.204) (-345.795) * [-349.828] (-346.655) (-346.947) (-348.381) -- 0:00:26
552500 -- [-345.592] (-345.846) (-349.114) (-346.891) * [-345.597] (-350.872) (-345.537) (-346.366) -- 0:00:26
553000 -- (-346.624) (-346.691) [-350.784] (-345.602) * (-344.985) [-347.683] (-349.412) (-347.916) -- 0:00:26
553500 -- (-347.480) [-347.356] (-345.897) (-347.519) * (-347.995) (-345.087) [-346.802] (-347.576) -- 0:00:26
554000 -- [-348.377] (-349.537) (-347.229) (-346.490) * (-345.276) (-346.221) (-348.735) [-346.694] -- 0:00:26
554500 -- (-346.513) (-345.066) (-354.903) [-348.620] * (-349.582) [-350.214] (-347.270) (-346.326) -- 0:00:26
555000 -- (-348.782) [-346.291] (-346.551) (-348.112) * (-347.255) [-353.790] (-346.060) (-346.976) -- 0:00:26
Average standard deviation of split frequencies: 0.005885
555500 -- (-347.354) (-345.579) (-346.391) [-344.998] * (-345.962) [-346.904] (-348.854) (-348.567) -- 0:00:26
556000 -- (-347.872) [-345.065] (-346.459) (-345.744) * (-347.525) (-346.834) [-346.568] (-346.619) -- 0:00:26
556500 -- [-349.103] (-345.915) (-346.334) (-346.110) * (-346.618) (-347.570) [-345.991] (-354.472) -- 0:00:26
557000 -- (-347.079) (-347.918) [-346.314] (-345.649) * (-345.437) (-346.965) (-349.334) [-346.037] -- 0:00:26
557500 -- (-348.812) [-347.177] (-350.648) (-346.135) * (-346.145) [-345.261] (-346.869) (-346.413) -- 0:00:26
558000 -- (-345.503) (-347.081) (-347.367) [-346.423] * (-347.399) (-348.241) [-345.227] (-346.327) -- 0:00:26
558500 -- [-346.041] (-347.300) (-347.892) (-348.186) * (-347.312) [-345.192] (-346.360) (-345.574) -- 0:00:26
559000 -- [-349.721] (-345.957) (-347.249) (-345.213) * (-348.649) (-346.379) (-345.038) [-345.694] -- 0:00:26
559500 -- (-346.814) [-347.699] (-348.820) (-347.480) * (-350.724) [-346.529] (-351.958) (-346.903) -- 0:00:26
560000 -- (-348.718) [-348.745] (-346.120) (-352.625) * [-354.573] (-348.914) (-350.566) (-347.885) -- 0:00:26
Average standard deviation of split frequencies: 0.007023
560500 -- (-346.841) (-348.332) (-347.149) [-345.432] * (-346.733) (-352.219) [-346.645] (-347.246) -- 0:00:26
561000 -- (-346.563) [-347.420] (-346.853) (-347.472) * (-346.725) (-346.558) [-347.928] (-349.727) -- 0:00:26
561500 -- (-349.458) [-346.009] (-345.496) (-350.795) * [-345.722] (-347.504) (-345.741) (-345.689) -- 0:00:26
562000 -- (-353.714) [-353.279] (-348.964) (-347.696) * [-345.891] (-346.478) (-346.976) (-348.393) -- 0:00:26
562500 -- (-347.185) [-346.495] (-346.521) (-346.955) * (-346.030) (-346.206) (-345.196) [-346.732] -- 0:00:26
563000 -- (-348.252) [-345.549] (-347.083) (-346.764) * (-348.993) (-346.376) (-346.199) [-347.080] -- 0:00:26
563500 -- (-347.436) (-349.648) [-347.661] (-346.961) * (-351.623) (-348.815) [-344.845] (-347.096) -- 0:00:26
564000 -- (-348.556) (-344.953) [-348.184] (-347.010) * (-346.341) (-347.621) (-346.512) [-347.612] -- 0:00:26
564500 -- (-347.387) (-347.511) (-350.709) [-348.744] * (-345.429) (-348.091) [-347.720] (-348.397) -- 0:00:26
565000 -- (-347.254) (-345.715) [-345.045] (-348.076) * [-345.104] (-348.680) (-347.671) (-346.626) -- 0:00:26
Average standard deviation of split frequencies: 0.006663
565500 -- (-346.563) (-348.282) (-345.958) [-345.157] * (-345.913) (-346.892) (-346.891) [-347.491] -- 0:00:26
566000 -- (-346.019) [-348.376] (-346.546) (-346.909) * (-347.232) (-345.052) [-347.189] (-351.426) -- 0:00:26
566500 -- (-346.288) (-345.724) [-345.572] (-346.613) * (-346.993) (-346.378) (-347.382) [-347.120] -- 0:00:26
567000 -- (-347.595) (-345.981) [-345.592] (-347.847) * (-346.306) [-351.407] (-346.094) (-349.067) -- 0:00:25
567500 -- (-348.256) (-349.756) (-345.525) [-347.711] * (-347.407) (-350.490) [-345.632] (-347.974) -- 0:00:25
568000 -- (-347.320) [-347.332] (-348.459) (-347.437) * [-345.808] (-347.730) (-348.046) (-346.522) -- 0:00:25
568500 -- (-344.997) (-346.288) (-351.461) [-347.812] * (-345.517) (-347.166) [-346.175] (-348.044) -- 0:00:25
569000 -- (-345.709) [-345.829] (-347.631) (-346.992) * (-345.994) [-349.478] (-347.437) (-349.832) -- 0:00:25
569500 -- (-346.455) [-344.789] (-346.485) (-349.453) * [-347.026] (-348.485) (-350.937) (-345.151) -- 0:00:25
570000 -- [-345.769] (-345.982) (-346.108) (-348.412) * (-346.234) (-347.765) [-349.800] (-345.642) -- 0:00:25
Average standard deviation of split frequencies: 0.006379
570500 -- (-348.581) (-349.671) [-347.331] (-345.575) * (-347.441) (-346.142) [-346.870] (-351.387) -- 0:00:25
571000 -- (-346.819) (-345.707) [-345.737] (-345.399) * (-347.473) (-346.459) [-345.830] (-347.821) -- 0:00:25
571500 -- [-346.376] (-351.220) (-345.674) (-345.461) * (-347.931) (-349.685) (-345.636) [-347.578] -- 0:00:25
572000 -- (-347.611) (-346.456) [-348.556] (-345.851) * (-346.342) (-347.982) [-346.441] (-347.612) -- 0:00:25
572500 -- (-350.843) (-348.289) (-348.331) [-348.011] * [-346.396] (-346.126) (-348.366) (-348.393) -- 0:00:25
573000 -- (-347.182) (-346.892) [-351.597] (-347.245) * (-347.274) (-346.791) [-347.633] (-347.406) -- 0:00:25
573500 -- (-345.497) [-347.344] (-346.066) (-349.301) * [-347.505] (-351.066) (-347.253) (-344.978) -- 0:00:25
574000 -- (-345.721) (-347.445) [-347.737] (-346.290) * [-345.907] (-353.199) (-347.209) (-345.830) -- 0:00:25
574500 -- (-345.698) (-350.372) [-349.791] (-349.202) * (-348.176) (-347.761) [-345.213] (-349.382) -- 0:00:25
575000 -- (-346.604) [-347.262] (-346.210) (-344.977) * (-345.486) [-345.428] (-345.939) (-350.261) -- 0:00:25
Average standard deviation of split frequencies: 0.006820
575500 -- (-348.611) [-345.070] (-350.000) (-345.967) * [-345.511] (-348.009) (-348.909) (-346.800) -- 0:00:25
576000 -- [-347.080] (-344.814) (-347.481) (-346.520) * (-345.540) (-346.500) (-346.614) [-346.882] -- 0:00:25
576500 -- (-351.149) [-346.308] (-350.196) (-349.153) * [-348.015] (-347.688) (-345.418) (-346.254) -- 0:00:25
577000 -- [-347.486] (-350.005) (-349.210) (-347.836) * (-348.733) (-345.347) [-347.667] (-347.554) -- 0:00:25
577500 -- (-349.846) (-350.372) (-346.283) [-345.800] * (-346.146) (-345.497) [-350.151] (-345.476) -- 0:00:25
578000 -- (-348.402) (-346.321) [-345.929] (-346.507) * (-349.984) [-346.645] (-347.107) (-345.433) -- 0:00:25
578500 -- (-347.286) (-345.438) (-347.578) [-347.523] * (-345.337) [-346.610] (-347.363) (-345.254) -- 0:00:25
579000 -- (-346.197) (-346.586) (-346.558) [-345.162] * (-345.872) [-349.144] (-346.027) (-346.518) -- 0:00:25
579500 -- (-346.411) [-346.405] (-345.697) (-346.346) * (-346.661) [-346.654] (-349.264) (-354.209) -- 0:00:25
580000 -- (-347.935) (-347.825) (-344.948) [-346.376] * [-348.345] (-346.461) (-349.013) (-348.067) -- 0:00:25
Average standard deviation of split frequencies: 0.006991
580500 -- (-347.755) [-346.643] (-346.508) (-347.815) * (-346.217) [-345.435] (-347.217) (-348.250) -- 0:00:25
581000 -- [-346.030] (-345.950) (-347.337) (-350.239) * (-346.310) (-346.096) (-348.860) [-345.404] -- 0:00:25
581500 -- (-347.263) (-345.448) (-346.345) [-345.512] * [-350.322] (-346.889) (-345.852) (-346.686) -- 0:00:25
582000 -- [-348.991] (-346.546) (-349.641) (-345.631) * (-346.798) [-345.655] (-347.090) (-350.542) -- 0:00:25
582500 -- (-346.496) [-346.108] (-349.663) (-347.648) * (-348.911) (-345.534) [-346.303] (-351.053) -- 0:00:25
583000 -- (-346.945) [-346.262] (-348.465) (-346.036) * (-348.449) (-347.014) [-345.772] (-345.867) -- 0:00:25
583500 -- (-348.159) [-345.116] (-349.650) (-349.256) * (-348.132) (-347.442) (-347.765) [-345.502] -- 0:00:24
584000 -- (-348.640) [-345.473] (-349.054) (-347.671) * (-346.400) (-345.871) (-351.285) [-345.986] -- 0:00:24
584500 -- (-347.549) (-347.584) [-346.525] (-345.754) * (-347.062) [-346.892] (-347.435) (-346.296) -- 0:00:24
585000 -- (-348.264) [-346.535] (-346.316) (-345.871) * (-349.190) (-350.913) [-347.716] (-345.486) -- 0:00:24
Average standard deviation of split frequencies: 0.006570
585500 -- (-349.079) (-346.966) (-348.272) [-346.340] * (-347.463) (-347.617) [-346.200] (-346.044) -- 0:00:24
586000 -- (-348.858) [-348.203] (-350.423) (-346.630) * (-347.258) (-346.819) [-348.180] (-346.577) -- 0:00:24
586500 -- (-346.316) (-348.524) (-346.287) [-352.997] * (-345.280) [-349.887] (-345.146) (-347.125) -- 0:00:24
587000 -- (-351.726) (-350.032) [-346.641] (-348.055) * [-345.416] (-350.737) (-344.854) (-350.702) -- 0:00:24
587500 -- [-348.439] (-346.641) (-350.916) (-347.964) * (-346.025) [-349.906] (-350.138) (-350.057) -- 0:00:24
588000 -- (-347.014) (-345.329) (-349.362) [-345.086] * (-347.330) [-346.861] (-348.736) (-347.688) -- 0:00:24
588500 -- (-346.860) (-347.137) [-347.386] (-345.938) * (-347.452) (-348.654) [-347.580] (-345.611) -- 0:00:24
589000 -- [-346.178] (-347.145) (-346.067) (-346.781) * (-346.484) [-345.726] (-345.799) (-345.823) -- 0:00:24
589500 -- [-346.240] (-345.603) (-345.055) (-345.413) * (-347.389) (-345.717) [-345.853] (-346.460) -- 0:00:24
590000 -- (-346.382) (-347.383) (-344.632) [-347.030] * (-347.554) [-345.458] (-348.182) (-346.156) -- 0:00:24
Average standard deviation of split frequencies: 0.006695
590500 -- [-346.320] (-351.466) (-345.889) (-348.657) * (-349.428) (-346.630) [-345.687] (-355.312) -- 0:00:24
591000 -- [-346.384] (-347.767) (-346.437) (-346.755) * (-345.546) (-349.985) (-346.472) [-349.267] -- 0:00:24
591500 -- (-348.311) (-346.443) [-349.823] (-346.182) * (-345.676) (-348.961) [-345.556] (-349.329) -- 0:00:24
592000 -- (-347.020) [-345.959] (-355.543) (-347.413) * (-346.345) (-348.024) (-345.685) [-348.635] -- 0:00:24
592500 -- (-345.652) [-345.217] (-347.123) (-347.299) * (-348.420) [-347.115] (-344.999) (-346.481) -- 0:00:24
593000 -- (-348.322) (-346.596) [-347.746] (-348.445) * (-351.139) (-348.253) (-347.828) [-350.128] -- 0:00:24
593500 -- (-348.160) (-350.373) [-347.623] (-348.494) * (-350.271) [-345.275] (-346.696) (-348.932) -- 0:00:24
594000 -- (-346.557) [-347.355] (-348.122) (-351.032) * (-347.473) (-347.164) (-349.494) [-347.251] -- 0:00:24
594500 -- (-345.756) [-344.846] (-348.169) (-352.925) * (-346.380) (-349.083) [-346.468] (-349.248) -- 0:00:24
595000 -- (-347.566) [-347.509] (-345.970) (-351.367) * (-347.463) [-348.212] (-349.381) (-348.917) -- 0:00:24
Average standard deviation of split frequencies: 0.006372
595500 -- (-345.858) [-346.555] (-349.192) (-345.009) * (-347.669) [-348.087] (-351.015) (-347.979) -- 0:00:24
596000 -- (-347.956) [-346.996] (-346.125) (-347.033) * [-350.516] (-347.627) (-347.915) (-350.324) -- 0:00:24
596500 -- (-346.071) [-348.963] (-346.279) (-346.760) * (-345.356) (-349.025) [-347.317] (-353.376) -- 0:00:24
597000 -- (-345.929) [-351.771] (-346.264) (-347.404) * (-349.647) [-348.800] (-347.434) (-350.358) -- 0:00:24
597500 -- (-345.187) (-346.919) [-344.997] (-347.439) * (-348.319) (-351.347) [-345.672] (-346.018) -- 0:00:24
598000 -- [-345.630] (-347.060) (-347.977) (-348.340) * (-346.726) (-348.511) [-347.315] (-346.526) -- 0:00:24
598500 -- (-346.780) [-346.214] (-346.737) (-349.316) * (-348.048) (-344.972) (-345.008) [-350.495] -- 0:00:24
599000 -- (-344.813) (-354.868) (-348.740) [-346.627] * (-352.531) [-345.111] (-346.150) (-346.023) -- 0:00:24
599500 -- (-349.079) (-352.922) [-347.041] (-346.695) * (-345.662) (-345.779) (-347.018) [-345.482] -- 0:00:24
600000 -- (-347.149) (-347.599) [-349.695] (-347.729) * (-345.923) (-346.560) (-349.107) [-345.002] -- 0:00:24
Average standard deviation of split frequencies: 0.006627
600500 -- [-346.473] (-347.454) (-346.414) (-349.573) * (-347.132) (-346.309) (-345.608) [-349.731] -- 0:00:23
601000 -- (-346.955) [-347.959] (-347.868) (-349.845) * (-346.338) [-346.863] (-346.983) (-350.086) -- 0:00:23
601500 -- [-346.486] (-347.072) (-349.348) (-345.702) * (-345.826) (-347.371) (-346.874) [-349.012] -- 0:00:23
602000 -- (-350.174) (-346.211) (-347.457) [-347.870] * (-348.332) (-348.600) (-346.150) [-347.907] -- 0:00:23
602500 -- (-350.856) [-346.014] (-351.406) (-345.622) * (-346.741) (-348.520) [-346.909] (-347.936) -- 0:00:23
603000 -- [-347.798] (-346.917) (-346.070) (-348.447) * (-347.664) (-354.311) [-349.134] (-346.004) -- 0:00:23
603500 -- [-347.396] (-349.007) (-346.743) (-346.624) * (-345.257) (-351.173) (-345.657) [-347.298] -- 0:00:23
604000 -- [-349.299] (-347.185) (-352.233) (-346.739) * (-361.159) (-346.841) (-350.400) [-345.489] -- 0:00:23
604500 -- (-347.125) [-346.405] (-351.906) (-346.077) * (-357.162) (-348.293) (-348.732) [-346.311] -- 0:00:23
605000 -- (-351.322) (-346.979) (-350.456) [-351.313] * (-347.616) (-351.235) (-346.692) [-349.417] -- 0:00:23
Average standard deviation of split frequencies: 0.006915
605500 -- (-348.594) [-346.593] (-348.158) (-348.045) * (-347.689) (-346.199) [-347.608] (-347.173) -- 0:00:23
606000 -- (-348.197) (-345.965) (-345.594) [-345.950] * (-346.660) (-346.053) (-349.594) [-347.921] -- 0:00:23
606500 -- [-346.796] (-346.236) (-345.983) (-350.037) * (-349.555) [-346.908] (-350.487) (-346.775) -- 0:00:23
607000 -- (-345.217) (-349.142) [-345.984] (-346.937) * (-345.546) (-348.227) (-346.399) [-345.693] -- 0:00:23
607500 -- [-347.817] (-346.069) (-345.680) (-351.329) * (-347.712) [-350.782] (-348.265) (-345.410) -- 0:00:23
608000 -- [-345.471] (-346.149) (-347.531) (-346.972) * (-348.937) [-348.956] (-351.553) (-347.702) -- 0:00:23
608500 -- (-347.438) [-346.349] (-351.395) (-345.612) * (-346.052) (-351.403) (-349.965) [-348.139] -- 0:00:23
609000 -- [-346.550] (-346.070) (-347.939) (-347.227) * (-348.023) (-350.051) [-345.349] (-345.419) -- 0:00:23
609500 -- [-347.377] (-348.567) (-349.349) (-345.207) * [-345.527] (-345.755) (-345.439) (-348.939) -- 0:00:23
610000 -- [-347.731] (-346.728) (-350.724) (-347.701) * (-346.562) (-349.326) [-345.460] (-348.625) -- 0:00:23
Average standard deviation of split frequencies: 0.006519
610500 -- [-347.879] (-346.258) (-346.552) (-346.310) * [-346.595] (-346.665) (-346.435) (-345.695) -- 0:00:23
611000 -- (-346.663) (-345.751) [-347.839] (-347.135) * (-347.794) (-347.705) (-345.010) [-348.247] -- 0:00:23
611500 -- (-345.942) (-347.673) (-346.175) [-346.377] * (-345.670) [-344.815] (-345.789) (-345.805) -- 0:00:23
612000 -- (-348.392) [-347.586] (-348.084) (-345.616) * [-348.043] (-346.973) (-347.224) (-349.774) -- 0:00:23
612500 -- (-347.254) (-346.390) (-346.351) [-345.541] * [-346.541] (-346.824) (-345.705) (-345.582) -- 0:00:23
613000 -- (-348.748) (-348.172) [-346.420] (-346.829) * (-351.298) (-345.808) (-345.563) [-346.028] -- 0:00:23
613500 -- (-347.854) (-347.907) [-345.799] (-347.195) * (-353.744) (-348.883) [-348.699] (-347.810) -- 0:00:23
614000 -- (-346.522) (-345.664) [-350.535] (-348.733) * [-346.973] (-346.758) (-348.346) (-348.637) -- 0:00:23
614500 -- (-348.584) (-346.831) (-347.137) [-347.410] * [-348.590] (-346.589) (-352.370) (-346.085) -- 0:00:23
615000 -- (-346.623) (-346.149) [-347.828] (-350.165) * (-346.997) [-347.605] (-347.584) (-346.555) -- 0:00:23
Average standard deviation of split frequencies: 0.006420
615500 -- (-345.800) [-346.399] (-345.369) (-349.047) * (-347.414) (-347.357) [-346.012] (-347.217) -- 0:00:23
616000 -- (-346.396) (-347.109) [-345.571] (-346.848) * [-345.099] (-348.016) (-345.555) (-349.336) -- 0:00:23
616500 -- (-345.115) (-348.333) [-347.080] (-347.425) * [-345.746] (-346.422) (-347.331) (-346.259) -- 0:00:23
617000 -- [-345.037] (-345.714) (-348.587) (-348.475) * (-350.270) (-345.882) (-348.020) [-345.262] -- 0:00:22
617500 -- (-345.060) [-347.711] (-346.689) (-348.035) * (-345.594) [-345.886] (-347.717) (-348.599) -- 0:00:22
618000 -- [-346.895] (-344.846) (-348.231) (-350.530) * (-349.441) (-347.688) [-349.135] (-349.968) -- 0:00:22
618500 -- (-346.644) [-346.189] (-345.640) (-349.434) * (-349.155) [-347.153] (-352.011) (-347.045) -- 0:00:22
619000 -- (-346.674) (-348.605) (-347.641) [-347.721] * (-349.073) [-347.139] (-349.244) (-347.634) -- 0:00:22
619500 -- (-347.141) (-348.389) [-351.179] (-347.224) * (-350.321) [-346.546] (-345.780) (-347.768) -- 0:00:22
620000 -- (-349.950) (-345.978) [-347.965] (-347.201) * (-346.753) [-347.639] (-345.177) (-349.969) -- 0:00:22
Average standard deviation of split frequencies: 0.006160
620500 -- (-347.257) (-348.034) (-348.174) [-345.618] * (-345.706) (-347.108) [-346.190] (-351.201) -- 0:00:22
621000 -- [-346.570] (-349.760) (-347.082) (-355.462) * (-349.064) (-348.049) (-350.836) [-349.293] -- 0:00:22
621500 -- (-348.529) (-347.141) (-349.188) [-351.527] * (-346.279) (-349.558) [-353.982] (-348.099) -- 0:00:22
622000 -- (-346.705) [-347.288] (-346.093) (-352.373) * [-346.494] (-351.191) (-349.433) (-346.360) -- 0:00:22
622500 -- (-346.202) [-348.136] (-345.828) (-347.481) * [-347.972] (-350.330) (-348.589) (-346.928) -- 0:00:22
623000 -- (-347.582) (-346.867) (-345.464) [-345.664] * [-349.660] (-346.131) (-347.451) (-351.681) -- 0:00:22
623500 -- (-352.540) (-347.400) (-347.532) [-346.201] * (-347.079) [-348.920] (-345.964) (-348.283) -- 0:00:22
624000 -- (-346.772) (-346.569) [-345.956] (-346.753) * (-349.147) [-345.328] (-346.064) (-346.457) -- 0:00:22
624500 -- (-345.977) (-348.276) [-346.267] (-345.401) * (-346.120) (-345.253) [-347.397] (-347.814) -- 0:00:22
625000 -- [-345.665] (-347.572) (-346.082) (-344.830) * [-347.207] (-350.634) (-346.910) (-345.529) -- 0:00:22
Average standard deviation of split frequencies: 0.006443
625500 -- (-351.583) (-348.220) (-347.311) [-345.536] * [-348.697] (-349.767) (-345.448) (-347.562) -- 0:00:22
626000 -- [-345.797] (-349.296) (-346.104) (-348.994) * [-350.158] (-346.307) (-350.905) (-348.900) -- 0:00:22
626500 -- (-345.822) [-346.868] (-346.823) (-350.287) * (-351.708) [-346.845] (-349.211) (-346.137) -- 0:00:22
627000 -- (-349.049) (-345.438) (-347.759) [-350.555] * (-346.334) [-345.162] (-349.993) (-350.837) -- 0:00:22
627500 -- (-346.178) (-345.461) (-347.631) [-347.604] * [-348.764] (-346.207) (-346.352) (-348.094) -- 0:00:22
628000 -- (-347.932) (-347.135) (-348.581) [-347.962] * (-345.364) (-345.595) (-349.107) [-346.478] -- 0:00:22
628500 -- (-349.223) [-346.163] (-345.449) (-353.626) * [-345.169] (-350.355) (-348.925) (-347.767) -- 0:00:22
629000 -- (-347.126) [-347.401] (-346.465) (-349.079) * (-346.757) (-356.824) (-350.132) [-346.102] -- 0:00:22
629500 -- (-346.956) (-346.233) [-347.331] (-345.226) * (-347.678) (-348.812) (-348.879) [-347.853] -- 0:00:22
630000 -- (-350.260) (-347.444) (-346.689) [-346.347] * (-348.083) [-350.279] (-348.165) (-346.060) -- 0:00:22
Average standard deviation of split frequencies: 0.006561
630500 -- (-346.569) (-346.271) (-345.791) [-346.411] * (-347.762) (-347.389) [-349.789] (-347.330) -- 0:00:22
631000 -- (-346.411) [-348.600] (-346.749) (-345.531) * (-346.760) (-349.225) [-345.945] (-345.812) -- 0:00:22
631500 -- (-346.845) (-346.914) [-345.702] (-360.165) * (-346.907) [-347.250] (-347.595) (-344.984) -- 0:00:22
632000 -- (-348.152) (-350.040) [-348.216] (-349.028) * (-346.366) [-347.253] (-346.068) (-345.588) -- 0:00:22
632500 -- [-345.481] (-345.229) (-346.014) (-350.989) * [-347.268] (-345.187) (-349.682) (-346.929) -- 0:00:22
633000 -- (-347.851) (-346.307) [-345.693] (-349.726) * (-347.873) (-345.013) (-350.307) [-345.323] -- 0:00:22
633500 -- [-345.399] (-345.629) (-347.145) (-348.837) * (-350.941) (-346.201) [-345.820] (-345.593) -- 0:00:21
634000 -- (-346.752) (-351.066) (-345.645) [-348.257] * (-349.082) [-346.080] (-344.830) (-348.146) -- 0:00:21
634500 -- (-349.086) [-345.852] (-345.100) (-346.387) * (-345.534) [-347.201] (-345.511) (-347.473) -- 0:00:21
635000 -- (-361.631) (-348.941) (-347.794) [-345.087] * (-348.759) [-346.731] (-348.890) (-346.227) -- 0:00:21
Average standard deviation of split frequencies: 0.006496
635500 -- (-355.420) (-346.148) (-346.702) [-346.421] * (-345.194) (-346.810) (-347.264) [-348.082] -- 0:00:21
636000 -- (-348.045) (-346.238) [-345.013] (-345.690) * (-347.325) (-353.344) (-348.606) [-347.260] -- 0:00:21
636500 -- (-346.250) [-347.202] (-347.215) (-350.105) * [-345.684] (-346.145) (-346.438) (-347.456) -- 0:00:21
637000 -- (-346.806) (-347.737) (-345.750) [-347.918] * (-348.270) [-346.201] (-346.245) (-349.180) -- 0:00:21
637500 -- (-345.539) (-345.819) [-348.678] (-348.402) * (-345.606) [-345.584] (-347.948) (-348.192) -- 0:00:21
638000 -- (-345.965) [-345.805] (-347.132) (-345.720) * (-347.804) (-348.370) (-348.747) [-346.317] -- 0:00:21
638500 -- (-346.696) (-346.006) [-346.209] (-347.933) * (-345.520) [-348.556] (-346.204) (-346.529) -- 0:00:21
639000 -- (-347.310) [-346.883] (-352.269) (-346.789) * [-348.999] (-346.976) (-345.963) (-345.262) -- 0:00:21
639500 -- (-346.432) (-348.833) (-348.193) [-347.186] * (-345.182) (-347.629) [-344.745] (-348.719) -- 0:00:21
640000 -- (-350.538) (-346.734) [-347.715] (-346.030) * (-348.259) (-347.632) [-348.512] (-346.348) -- 0:00:21
Average standard deviation of split frequencies: 0.006418
640500 -- (-347.441) (-349.391) (-347.115) [-345.065] * (-348.555) (-349.199) [-346.370] (-347.293) -- 0:00:21
641000 -- (-347.690) (-349.461) [-348.390] (-346.615) * (-346.161) (-346.280) [-348.535] (-348.351) -- 0:00:21
641500 -- (-346.063) (-348.116) (-346.901) [-346.173] * (-345.691) (-352.679) [-347.108] (-350.468) -- 0:00:21
642000 -- (-345.464) (-350.107) [-346.059] (-344.814) * (-348.531) (-345.311) (-346.059) [-344.941] -- 0:00:21
642500 -- [-346.050] (-349.186) (-345.700) (-347.485) * (-347.224) (-346.940) (-351.040) [-347.174] -- 0:00:21
643000 -- [-346.223] (-348.490) (-350.058) (-345.758) * (-345.932) (-346.161) (-346.383) [-345.774] -- 0:00:21
643500 -- (-346.190) [-346.667] (-348.008) (-345.640) * (-345.537) [-349.074] (-352.866) (-348.501) -- 0:00:21
644000 -- (-346.634) (-348.927) [-347.464] (-347.601) * (-346.453) (-347.502) [-348.024] (-346.875) -- 0:00:21
644500 -- (-350.442) (-353.685) (-347.112) [-347.152] * [-346.458] (-347.554) (-345.012) (-349.268) -- 0:00:21
645000 -- (-347.857) (-347.998) (-349.405) [-348.219] * (-347.987) [-346.588] (-344.917) (-353.720) -- 0:00:21
Average standard deviation of split frequencies: 0.006041
645500 -- [-347.303] (-350.613) (-348.327) (-346.531) * [-346.746] (-345.711) (-346.086) (-347.701) -- 0:00:21
646000 -- (-347.094) (-348.021) (-349.344) [-346.780] * (-347.011) (-348.844) [-346.209] (-346.490) -- 0:00:21
646500 -- (-345.764) (-349.186) [-346.209] (-347.368) * [-348.096] (-348.664) (-345.639) (-345.958) -- 0:00:21
647000 -- (-345.692) (-348.855) (-349.084) [-346.694] * [-346.804] (-348.376) (-345.097) (-348.293) -- 0:00:21
647500 -- (-346.191) (-348.122) [-348.526] (-347.922) * (-346.594) (-347.547) (-347.113) [-345.558] -- 0:00:21
648000 -- (-344.942) (-348.262) (-346.806) [-344.776] * (-346.540) [-345.256] (-345.379) (-346.612) -- 0:00:21
648500 -- (-345.167) (-346.201) (-347.231) [-347.161] * (-348.049) (-347.217) (-347.550) [-346.855] -- 0:00:21
649000 -- (-345.395) [-345.065] (-345.941) (-345.454) * (-345.469) [-345.872] (-348.291) (-347.450) -- 0:00:21
649500 -- [-347.075] (-349.663) (-347.333) (-345.931) * (-347.449) (-346.706) (-346.355) [-346.574] -- 0:00:21
650000 -- (-345.766) (-347.949) [-346.732] (-346.216) * (-348.293) (-347.262) [-347.228] (-346.058) -- 0:00:21
Average standard deviation of split frequencies: 0.005876
650500 -- (-346.256) [-345.339] (-346.002) (-347.060) * (-347.449) [-346.891] (-349.934) (-346.494) -- 0:00:20
651000 -- (-347.670) [-346.875] (-347.655) (-345.478) * [-347.027] (-348.893) (-346.729) (-346.504) -- 0:00:20
651500 -- [-350.318] (-348.305) (-346.206) (-346.727) * (-345.862) (-352.227) [-346.185] (-345.118) -- 0:00:20
652000 -- (-345.310) (-347.101) [-345.680] (-352.529) * (-347.243) (-347.124) [-348.437] (-345.352) -- 0:00:20
652500 -- [-345.357] (-347.257) (-346.300) (-350.045) * (-348.676) [-346.809] (-350.080) (-345.327) -- 0:00:20
653000 -- (-352.109) (-346.862) [-346.451] (-353.478) * (-347.761) [-348.017] (-347.152) (-347.500) -- 0:00:20
653500 -- (-347.287) (-348.866) (-349.711) [-347.279] * [-346.081] (-348.944) (-347.932) (-345.985) -- 0:00:20
654000 -- (-344.779) (-346.667) (-350.970) [-349.370] * (-347.137) (-346.358) (-345.610) [-351.395] -- 0:00:20
654500 -- (-349.055) (-350.947) [-347.478] (-352.155) * [-347.514] (-347.812) (-347.216) (-351.089) -- 0:00:20
655000 -- [-348.922] (-350.281) (-346.515) (-349.381) * (-346.171) (-351.165) [-348.485] (-349.295) -- 0:00:20
Average standard deviation of split frequencies: 0.005120
655500 -- (-346.509) (-346.893) [-346.479] (-347.282) * (-345.006) (-348.062) (-347.693) [-347.530] -- 0:00:20
656000 -- (-345.483) [-345.139] (-346.702) (-345.662) * (-346.514) (-347.758) [-348.230] (-345.929) -- 0:00:20
656500 -- (-350.649) [-346.339] (-345.827) (-349.447) * (-347.103) (-349.918) (-345.305) [-346.889] -- 0:00:20
657000 -- (-347.916) (-347.041) [-346.730] (-347.925) * [-345.312] (-348.247) (-346.562) (-346.316) -- 0:00:20
657500 -- (-346.870) (-345.793) [-346.802] (-346.255) * [-346.117] (-345.828) (-346.465) (-348.495) -- 0:00:20
658000 -- [-345.225] (-346.626) (-345.770) (-346.481) * [-345.250] (-346.632) (-345.802) (-344.833) -- 0:00:20
658500 -- (-346.723) [-346.970] (-346.605) (-346.822) * (-349.180) (-352.614) [-347.356] (-350.438) -- 0:00:20
659000 -- (-346.721) (-346.265) (-348.466) [-345.976] * (-347.334) (-344.787) (-350.843) [-349.193] -- 0:00:20
659500 -- [-345.718] (-346.344) (-345.536) (-346.919) * (-345.334) [-350.246] (-349.665) (-349.865) -- 0:00:20
660000 -- (-348.454) (-346.245) [-348.186] (-351.612) * [-345.138] (-352.650) (-345.870) (-351.207) -- 0:00:20
Average standard deviation of split frequencies: 0.005834
660500 -- (-346.242) (-348.784) [-347.055] (-347.891) * (-349.026) [-347.950] (-345.669) (-347.761) -- 0:00:20
661000 -- (-345.984) (-349.241) [-345.217] (-350.696) * (-346.233) (-346.966) (-347.064) [-349.709] -- 0:00:20
661500 -- [-345.629] (-350.252) (-345.953) (-346.956) * (-346.512) (-345.803) [-348.848] (-349.250) -- 0:00:20
662000 -- (-345.172) [-346.054] (-347.008) (-346.179) * [-348.108] (-349.672) (-346.403) (-347.902) -- 0:00:20
662500 -- [-345.476] (-347.879) (-347.356) (-348.942) * [-346.070] (-346.242) (-346.164) (-352.010) -- 0:00:20
663000 -- (-348.346) (-349.402) [-348.284] (-345.459) * (-349.265) (-352.320) (-345.286) [-349.662] -- 0:00:20
663500 -- [-350.561] (-345.538) (-348.376) (-347.892) * (-350.923) (-348.121) (-349.983) [-349.414] -- 0:00:20
664000 -- (-350.621) (-344.820) (-348.858) [-345.721] * (-351.060) [-346.424] (-347.978) (-346.297) -- 0:00:20
664500 -- (-348.115) (-346.702) (-345.383) [-347.117] * (-348.689) (-345.630) (-348.930) [-345.661] -- 0:00:20
665000 -- [-347.622] (-347.360) (-347.534) (-345.681) * [-352.292] (-347.009) (-345.570) (-345.843) -- 0:00:20
Average standard deviation of split frequencies: 0.005996
665500 -- (-347.065) (-346.910) [-348.672] (-346.318) * (-348.416) (-345.248) (-345.853) [-345.706] -- 0:00:20
666000 -- [-346.715] (-348.968) (-346.633) (-346.450) * (-347.705) (-349.221) [-347.093] (-348.253) -- 0:00:20
666500 -- (-347.123) [-346.510] (-346.742) (-347.390) * [-346.509] (-346.572) (-347.045) (-349.592) -- 0:00:20
667000 -- (-346.522) (-347.666) [-346.125] (-347.129) * (-345.860) (-349.873) [-346.708] (-346.068) -- 0:00:19
667500 -- (-349.091) (-348.937) [-347.907] (-349.195) * (-347.998) (-346.541) [-345.652] (-351.268) -- 0:00:19
668000 -- [-346.553] (-347.445) (-347.572) (-351.512) * (-352.678) (-349.500) [-349.014] (-349.648) -- 0:00:19
668500 -- (-350.639) (-345.576) [-345.093] (-350.649) * [-348.097] (-347.485) (-346.173) (-351.075) -- 0:00:19
669000 -- [-346.491] (-347.128) (-348.868) (-347.357) * (-348.518) (-345.957) (-349.272) [-345.802] -- 0:00:19
669500 -- (-347.135) [-348.795] (-348.310) (-352.371) * (-348.742) [-350.573] (-349.064) (-345.272) -- 0:00:19
670000 -- (-346.146) [-350.094] (-352.483) (-350.572) * (-348.474) [-346.171] (-347.317) (-347.319) -- 0:00:19
Average standard deviation of split frequencies: 0.005755
670500 -- [-346.592] (-347.140) (-346.630) (-351.952) * (-349.834) [-350.546] (-356.947) (-349.314) -- 0:00:19
671000 -- (-346.937) [-345.770] (-345.731) (-345.985) * (-347.795) (-349.445) (-351.073) [-347.580] -- 0:00:19
671500 -- (-346.147) (-349.130) (-346.704) [-345.900] * [-348.975] (-347.730) (-348.053) (-346.974) -- 0:00:19
672000 -- (-346.306) [-347.048] (-348.399) (-346.747) * (-346.699) (-351.699) (-347.098) [-349.170] -- 0:00:19
672500 -- (-346.465) [-350.408] (-351.610) (-345.880) * (-350.626) [-346.531] (-347.008) (-349.406) -- 0:00:19
673000 -- (-347.987) [-346.471] (-346.325) (-346.061) * (-347.232) (-347.309) (-347.741) [-346.375] -- 0:00:19
673500 -- (-347.249) [-348.049] (-345.754) (-345.390) * (-349.979) [-346.455] (-350.564) (-351.957) -- 0:00:19
674000 -- (-347.253) (-347.512) (-346.376) [-346.394] * (-348.190) (-347.381) [-347.621] (-353.681) -- 0:00:19
674500 -- (-348.986) (-349.030) (-349.904) [-347.944] * (-345.258) [-352.092] (-346.279) (-346.366) -- 0:00:19
675000 -- (-345.287) (-349.407) [-347.911] (-347.913) * (-350.653) (-351.582) (-347.100) [-345.468] -- 0:00:19
Average standard deviation of split frequencies: 0.005884
675500 -- (-345.165) [-347.671] (-348.239) (-349.473) * [-346.772] (-347.621) (-346.033) (-345.738) -- 0:00:19
676000 -- (-346.357) [-347.213] (-345.984) (-348.181) * (-348.814) [-345.521] (-349.307) (-346.520) -- 0:00:19
676500 -- (-347.362) [-347.880] (-346.740) (-347.696) * [-347.927] (-345.582) (-345.655) (-350.039) -- 0:00:19
677000 -- (-346.840) (-349.119) (-348.193) [-347.957] * (-347.318) [-348.538] (-345.805) (-347.937) -- 0:00:19
677500 -- (-348.260) (-348.368) [-346.661] (-348.286) * [-345.660] (-349.388) (-349.107) (-346.275) -- 0:00:19
678000 -- (-349.176) [-345.769] (-346.634) (-346.714) * (-345.307) [-350.348] (-345.832) (-346.935) -- 0:00:19
678500 -- (-346.639) [-347.848] (-347.439) (-345.896) * (-345.315) (-349.497) (-348.552) [-348.876] -- 0:00:19
679000 -- (-348.013) (-349.067) (-348.467) [-348.946] * [-346.568] (-347.284) (-346.236) (-346.367) -- 0:00:19
679500 -- [-349.626] (-345.762) (-349.729) (-349.005) * (-346.999) (-349.706) (-347.806) [-346.800] -- 0:00:19
680000 -- (-348.180) (-345.014) (-345.322) [-348.179] * [-345.079] (-346.737) (-347.606) (-347.972) -- 0:00:19
Average standard deviation of split frequencies: 0.005541
680500 -- (-352.159) (-345.652) (-347.290) [-346.973] * [-345.986] (-346.423) (-348.952) (-350.981) -- 0:00:19
681000 -- (-349.184) (-346.686) [-347.384] (-347.380) * [-346.652] (-347.893) (-348.658) (-348.642) -- 0:00:19
681500 -- (-346.039) [-348.097] (-348.922) (-345.720) * [-349.092] (-346.396) (-347.658) (-347.456) -- 0:00:19
682000 -- (-349.551) [-351.808] (-346.379) (-344.803) * [-348.840] (-345.656) (-347.917) (-348.677) -- 0:00:19
682500 -- (-346.743) (-349.791) [-347.291] (-346.411) * [-345.986] (-347.319) (-346.456) (-347.859) -- 0:00:19
683000 -- (-348.451) [-351.901] (-347.435) (-346.473) * [-346.411] (-349.287) (-347.020) (-345.812) -- 0:00:19
683500 -- (-346.970) (-347.295) (-346.067) [-346.099] * (-350.771) (-346.308) [-349.673] (-347.546) -- 0:00:18
684000 -- (-346.754) (-347.458) (-349.315) [-346.266] * (-345.178) (-346.175) (-346.598) [-346.866] -- 0:00:18
684500 -- [-345.394] (-350.892) (-345.290) (-347.118) * (-346.339) (-348.417) [-346.961] (-346.926) -- 0:00:18
685000 -- (-346.526) (-347.857) [-345.026] (-346.765) * (-346.475) (-345.936) [-344.851] (-344.937) -- 0:00:18
Average standard deviation of split frequencies: 0.005755
685500 -- (-345.739) (-346.955) [-346.485] (-350.322) * (-348.681) [-345.764] (-347.031) (-346.566) -- 0:00:18
686000 -- (-352.345) (-345.642) [-345.960] (-347.512) * (-346.258) [-347.754] (-348.910) (-346.563) -- 0:00:18
686500 -- [-347.531] (-345.232) (-347.685) (-344.892) * [-347.047] (-347.846) (-347.026) (-345.809) -- 0:00:18
687000 -- [-346.537] (-348.086) (-347.250) (-345.746) * (-354.731) [-347.169] (-350.740) (-347.761) -- 0:00:18
687500 -- (-354.471) (-347.484) [-346.141] (-347.792) * (-351.004) (-346.240) (-346.621) [-348.938] -- 0:00:18
688000 -- (-350.513) (-347.449) (-347.945) [-346.959] * [-348.713] (-346.342) (-346.265) (-347.482) -- 0:00:18
688500 -- (-350.371) [-345.352] (-346.242) (-345.160) * [-348.911] (-347.296) (-347.148) (-346.253) -- 0:00:18
689000 -- (-347.287) (-348.885) (-346.238) [-346.708] * (-346.943) (-347.575) (-346.546) [-349.764] -- 0:00:18
689500 -- [-347.767] (-345.458) (-349.543) (-349.771) * [-346.974] (-346.522) (-345.963) (-347.658) -- 0:00:18
690000 -- [-346.791] (-349.290) (-348.620) (-347.999) * (-350.069) [-347.370] (-349.639) (-351.323) -- 0:00:18
Average standard deviation of split frequencies: 0.006356
690500 -- (-349.527) (-350.260) [-347.579] (-351.371) * (-347.927) [-349.736] (-346.308) (-345.612) -- 0:00:18
691000 -- (-346.575) [-346.195] (-345.700) (-349.731) * [-346.172] (-350.621) (-349.195) (-346.130) -- 0:00:18
691500 -- [-345.705] (-347.214) (-346.235) (-347.475) * (-351.658) (-352.427) (-348.958) [-347.003] -- 0:00:18
692000 -- [-347.302] (-346.970) (-345.630) (-347.225) * (-350.197) (-345.487) (-346.076) [-349.344] -- 0:00:18
692500 -- (-345.874) (-345.676) [-347.505] (-353.197) * (-347.667) (-347.674) [-349.265] (-346.002) -- 0:00:18
693000 -- (-347.477) (-347.299) [-349.116] (-350.263) * (-346.949) (-347.384) [-346.057] (-348.484) -- 0:00:18
693500 -- (-347.828) [-349.430] (-350.990) (-349.608) * (-345.663) (-347.120) [-347.087] (-348.502) -- 0:00:18
694000 -- (-347.345) (-347.442) (-348.114) [-345.911] * (-345.354) (-349.809) (-348.813) [-345.681] -- 0:00:18
694500 -- (-347.306) [-351.192] (-346.203) (-349.941) * (-347.885) [-346.428] (-346.408) (-350.441) -- 0:00:18
695000 -- [-345.168] (-349.547) (-345.542) (-350.807) * [-346.696] (-347.871) (-349.383) (-347.892) -- 0:00:18
Average standard deviation of split frequencies: 0.004877
695500 -- (-345.795) (-352.243) (-347.464) [-347.345] * (-345.094) (-346.423) [-346.087] (-347.698) -- 0:00:18
696000 -- (-345.650) [-345.999] (-348.567) (-347.857) * (-347.305) (-347.274) (-345.938) [-347.668] -- 0:00:18
696500 -- (-345.191) [-345.589] (-345.164) (-347.291) * (-347.737) (-346.767) (-347.431) [-345.367] -- 0:00:18
697000 -- (-346.401) (-348.954) [-346.124] (-346.092) * (-349.782) [-352.962] (-346.121) (-346.951) -- 0:00:18
697500 -- (-346.907) (-348.751) [-345.818] (-346.379) * [-349.386] (-350.608) (-345.516) (-346.247) -- 0:00:18
698000 -- (-349.152) [-346.869] (-345.394) (-347.744) * (-346.231) [-349.797] (-350.225) (-349.353) -- 0:00:18
698500 -- (-346.746) [-345.413] (-346.905) (-345.285) * (-345.615) [-348.117] (-348.289) (-349.808) -- 0:00:18
699000 -- (-346.196) [-346.253] (-347.503) (-345.416) * [-349.042] (-346.537) (-348.691) (-348.850) -- 0:00:18
699500 -- [-346.119] (-345.015) (-349.481) (-345.260) * (-345.923) (-345.055) [-348.787] (-353.280) -- 0:00:18
700000 -- (-348.100) (-347.550) (-353.852) [-346.224] * (-347.629) (-350.985) (-346.790) [-347.268] -- 0:00:18
Average standard deviation of split frequencies: 0.005845
700500 -- (-348.108) [-345.182] (-346.682) (-347.925) * (-349.950) [-345.873] (-345.539) (-347.271) -- 0:00:17
701000 -- [-346.461] (-345.678) (-346.196) (-346.759) * (-351.435) (-346.197) (-346.718) [-345.823] -- 0:00:17
701500 -- (-347.478) (-346.416) (-348.176) [-344.755] * [-345.926] (-348.850) (-345.584) (-347.613) -- 0:00:17
702000 -- (-345.017) (-345.048) [-348.145] (-347.341) * [-347.722] (-345.890) (-349.637) (-346.147) -- 0:00:17
702500 -- [-347.603] (-344.918) (-356.894) (-351.176) * (-346.437) (-346.530) [-345.209] (-349.058) -- 0:00:17
703000 -- (-345.638) (-346.020) (-347.701) [-347.740] * (-347.278) (-345.841) (-347.869) [-346.254] -- 0:00:17
703500 -- (-346.160) (-346.291) [-347.931] (-346.352) * (-348.384) (-348.519) [-346.947] (-344.821) -- 0:00:17
704000 -- [-346.239] (-347.850) (-345.959) (-346.932) * (-346.061) [-346.776] (-345.721) (-346.553) -- 0:00:17
704500 -- [-349.857] (-345.661) (-348.431) (-347.177) * (-346.668) [-346.891] (-352.089) (-347.327) -- 0:00:17
705000 -- (-345.559) (-346.576) (-346.491) [-345.938] * (-346.984) (-351.449) (-350.523) [-347.546] -- 0:00:17
Average standard deviation of split frequencies: 0.006127
705500 -- (-346.302) [-346.109] (-345.200) (-347.742) * [-345.136] (-347.923) (-345.277) (-346.606) -- 0:00:17
706000 -- (-345.923) [-345.139] (-345.411) (-346.510) * (-345.776) (-346.639) [-347.418] (-345.729) -- 0:00:17
706500 -- (-347.806) (-348.655) (-348.551) [-347.945] * (-347.175) (-347.634) [-347.061] (-351.465) -- 0:00:17
707000 -- (-347.817) [-344.746] (-350.634) (-346.255) * (-347.446) (-348.106) [-344.728] (-350.421) -- 0:00:17
707500 -- (-346.621) (-346.920) [-350.224] (-350.022) * (-350.307) (-346.344) [-346.648] (-348.579) -- 0:00:17
708000 -- (-346.812) (-348.189) [-348.573] (-347.991) * [-346.161] (-345.544) (-346.620) (-346.541) -- 0:00:17
708500 -- (-347.265) (-347.895) (-349.547) [-347.015] * (-345.087) [-347.883] (-345.983) (-349.232) -- 0:00:17
709000 -- (-348.095) [-347.590] (-348.267) (-346.964) * (-345.626) (-349.446) [-346.023] (-349.116) -- 0:00:17
709500 -- (-347.178) (-345.516) [-345.685] (-347.494) * (-346.318) [-345.221] (-345.638) (-345.277) -- 0:00:17
710000 -- (-348.920) (-346.601) (-346.678) [-347.198] * (-345.706) (-348.129) (-349.355) [-345.323] -- 0:00:17
Average standard deviation of split frequencies: 0.005721
710500 -- (-349.220) (-345.750) [-346.467] (-348.931) * (-349.065) (-350.196) [-349.778] (-346.855) -- 0:00:17
711000 -- (-345.342) (-347.648) (-346.740) [-348.615] * [-346.740] (-346.881) (-355.330) (-347.166) -- 0:00:17
711500 -- [-347.608] (-347.489) (-354.323) (-349.033) * [-347.173] (-348.689) (-351.698) (-351.657) -- 0:00:17
712000 -- (-350.188) [-346.948] (-346.450) (-346.917) * [-349.121] (-347.339) (-349.321) (-346.381) -- 0:00:17
712500 -- (-347.766) (-349.555) (-346.609) [-345.088] * (-346.239) (-347.998) (-345.649) [-346.788] -- 0:00:17
713000 -- (-346.641) [-346.337] (-345.516) (-348.749) * (-350.306) (-349.268) (-345.166) [-347.153] -- 0:00:17
713500 -- (-346.306) (-347.452) [-351.126] (-347.717) * [-346.706] (-346.951) (-347.988) (-346.214) -- 0:00:17
714000 -- (-349.862) (-346.328) [-348.471] (-348.292) * [-346.293] (-349.640) (-347.296) (-345.846) -- 0:00:17
714500 -- (-347.039) [-347.086] (-346.923) (-345.545) * (-348.023) (-346.168) (-349.156) [-348.281] -- 0:00:17
715000 -- (-346.576) (-347.126) (-348.904) [-346.194] * (-348.249) (-345.801) [-346.688] (-346.981) -- 0:00:17
Average standard deviation of split frequencies: 0.005349
715500 -- (-346.999) [-349.882] (-346.372) (-348.689) * [-347.640] (-345.800) (-348.959) (-347.325) -- 0:00:17
716000 -- (-347.061) [-350.841] (-346.686) (-350.876) * (-347.787) [-345.514] (-345.917) (-348.039) -- 0:00:17
716500 -- (-347.863) [-348.293] (-351.700) (-345.163) * (-347.198) (-348.443) [-346.687] (-345.748) -- 0:00:17
717000 -- (-352.702) [-346.612] (-349.160) (-348.210) * [-353.277] (-348.579) (-350.605) (-348.259) -- 0:00:16
717500 -- (-347.363) (-347.357) (-346.106) [-348.332] * (-348.342) (-348.138) (-350.615) [-345.335] -- 0:00:16
718000 -- (-353.118) [-347.739] (-345.392) (-346.997) * (-346.039) [-345.789] (-346.104) (-350.650) -- 0:00:16
718500 -- (-344.792) (-348.749) (-346.837) [-346.956] * (-346.311) [-345.796] (-349.795) (-347.284) -- 0:00:16
719000 -- (-347.612) [-347.935] (-345.948) (-348.847) * (-346.405) [-346.093] (-346.524) (-348.153) -- 0:00:16
719500 -- (-346.513) (-349.765) (-348.038) [-348.221] * (-347.789) [-348.732] (-346.634) (-348.262) -- 0:00:16
720000 -- (-346.738) (-349.550) (-347.901) [-346.059] * (-350.014) (-346.461) [-348.242] (-345.601) -- 0:00:16
Average standard deviation of split frequencies: 0.005277
720500 -- (-347.155) [-348.279] (-347.324) (-347.301) * (-354.546) (-350.206) [-346.491] (-348.372) -- 0:00:16
721000 -- (-350.328) (-346.500) (-345.231) [-348.664] * (-345.135) (-346.498) [-347.088] (-347.690) -- 0:00:16
721500 -- (-347.627) [-345.242] (-347.065) (-347.710) * (-347.298) (-346.792) (-348.215) [-345.662] -- 0:00:16
722000 -- (-347.543) (-346.661) (-347.845) [-347.498] * (-345.296) (-346.171) [-345.806] (-346.591) -- 0:00:16
722500 -- [-345.970] (-348.013) (-347.522) (-347.050) * (-345.559) (-345.211) (-348.208) [-344.866] -- 0:00:16
723000 -- (-346.256) (-347.161) (-349.702) [-349.622] * (-348.992) [-345.541] (-347.578) (-345.826) -- 0:00:16
723500 -- (-346.433) (-352.965) (-346.711) [-345.059] * (-349.563) [-346.626] (-347.737) (-344.995) -- 0:00:16
724000 -- (-349.660) (-348.838) (-345.934) [-344.783] * (-346.425) (-346.439) [-348.278] (-346.671) -- 0:00:16
724500 -- (-346.294) (-349.294) (-346.806) [-344.892] * (-350.713) [-348.048] (-348.666) (-351.556) -- 0:00:16
725000 -- (-349.760) (-347.169) (-347.109) [-344.676] * (-347.724) (-350.274) (-349.007) [-345.884] -- 0:00:16
Average standard deviation of split frequencies: 0.005729
725500 -- (-347.053) (-350.811) [-349.301] (-345.481) * (-345.858) [-346.758] (-351.625) (-346.155) -- 0:00:16
726000 -- [-347.112] (-346.787) (-345.451) (-346.622) * [-346.796] (-345.336) (-349.491) (-348.395) -- 0:00:16
726500 -- (-347.849) (-349.199) (-346.877) [-349.926] * (-350.007) (-345.537) (-346.130) [-346.826] -- 0:00:16
727000 -- (-347.599) (-345.644) [-345.380] (-347.939) * (-348.321) (-346.546) [-349.091] (-350.768) -- 0:00:16
727500 -- (-349.765) [-346.740] (-346.017) (-348.358) * (-345.860) [-349.855] (-349.111) (-347.789) -- 0:00:16
728000 -- (-345.476) [-348.479] (-345.933) (-346.423) * (-345.068) (-345.368) (-350.548) [-348.745] -- 0:00:16
728500 -- (-345.516) (-346.823) [-347.277] (-345.686) * (-347.643) (-346.831) [-349.785] (-347.065) -- 0:00:16
729000 -- (-346.690) [-350.386] (-348.688) (-345.264) * (-346.977) (-350.772) (-350.056) [-349.608] -- 0:00:16
729500 -- (-345.129) [-348.862] (-349.670) (-345.608) * (-349.234) [-347.765] (-347.670) (-346.168) -- 0:00:16
730000 -- (-346.333) [-350.573] (-350.884) (-347.122) * (-347.238) (-347.867) (-348.679) [-347.617] -- 0:00:16
Average standard deviation of split frequencies: 0.005769
730500 -- (-351.555) (-351.648) (-347.371) [-345.118] * [-346.022] (-347.977) (-345.100) (-347.595) -- 0:00:16
731000 -- (-348.953) [-349.911] (-345.537) (-346.069) * (-346.812) (-345.696) (-347.216) [-347.323] -- 0:00:16
731500 -- (-347.686) [-345.295] (-345.375) (-347.490) * (-347.484) (-347.595) [-347.165] (-348.188) -- 0:00:16
732000 -- (-348.867) (-347.016) [-347.677] (-355.316) * (-346.101) (-346.277) (-347.208) [-346.030] -- 0:00:16
732500 -- (-346.771) (-345.164) [-345.663] (-348.493) * [-345.580] (-345.885) (-346.097) (-347.301) -- 0:00:16
733000 -- (-350.726) (-345.361) (-352.386) [-348.760] * (-345.560) (-345.277) (-346.460) [-349.087] -- 0:00:16
733500 -- (-347.669) [-345.158] (-346.904) (-347.919) * (-348.526) [-344.907] (-345.324) (-347.639) -- 0:00:15
734000 -- (-348.087) [-347.262] (-345.583) (-347.946) * (-348.545) [-345.487] (-346.826) (-346.262) -- 0:00:15
734500 -- (-347.526) (-348.520) [-346.612] (-347.188) * (-347.366) (-344.958) [-345.796] (-345.840) -- 0:00:15
735000 -- [-348.050] (-352.979) (-347.244) (-347.555) * (-346.579) [-344.686] (-344.894) (-346.914) -- 0:00:15
Average standard deviation of split frequencies: 0.006156
735500 -- (-348.523) (-346.736) (-347.513) [-346.164] * (-350.829) [-347.474] (-345.905) (-348.532) -- 0:00:15
736000 -- (-344.837) [-347.317] (-345.124) (-346.761) * (-347.924) (-346.775) (-346.038) [-347.215] -- 0:00:15
736500 -- [-346.078] (-345.151) (-346.917) (-346.961) * [-346.169] (-345.359) (-345.423) (-348.834) -- 0:00:15
737000 -- (-346.207) [-348.542] (-348.409) (-348.487) * [-345.261] (-344.913) (-351.799) (-346.427) -- 0:00:15
737500 -- [-346.019] (-347.053) (-350.028) (-349.152) * (-346.669) (-345.532) (-349.584) [-346.509] -- 0:00:15
738000 -- (-346.086) (-346.327) [-346.606] (-345.619) * (-345.429) (-346.938) [-346.794] (-345.544) -- 0:00:15
738500 -- (-347.659) [-346.075] (-352.100) (-345.249) * [-345.242] (-348.735) (-345.843) (-346.844) -- 0:00:15
739000 -- [-346.271] (-347.409) (-350.751) (-346.887) * [-346.027] (-353.056) (-345.082) (-347.288) -- 0:00:15
739500 -- (-345.495) (-350.295) [-349.126] (-346.582) * (-346.873) (-345.911) [-346.973] (-345.368) -- 0:00:15
740000 -- [-347.195] (-349.393) (-348.905) (-346.124) * (-346.964) [-347.832] (-346.817) (-347.025) -- 0:00:15
Average standard deviation of split frequencies: 0.005251
740500 -- (-346.154) (-350.074) [-346.524] (-346.883) * [-346.056] (-345.156) (-347.899) (-352.718) -- 0:00:15
741000 -- (-347.508) (-348.267) [-345.355] (-347.069) * (-346.954) (-346.138) [-345.116] (-352.550) -- 0:00:15
741500 -- [-346.209] (-346.158) (-348.318) (-347.105) * [-346.013] (-349.473) (-348.672) (-347.717) -- 0:00:15
742000 -- (-345.141) [-346.164] (-346.036) (-347.076) * [-349.215] (-345.066) (-345.169) (-346.906) -- 0:00:15
742500 -- (-348.595) (-350.061) (-350.049) [-348.303] * (-346.065) [-347.842] (-345.537) (-346.006) -- 0:00:15
743000 -- (-348.621) (-349.287) (-348.080) [-346.301] * (-345.606) (-345.609) [-345.554] (-347.177) -- 0:00:15
743500 -- (-345.434) (-353.000) [-348.754] (-347.147) * (-349.365) (-348.493) [-346.395] (-345.178) -- 0:00:15
744000 -- (-350.282) [-345.812] (-345.695) (-351.051) * (-346.259) (-348.941) [-346.009] (-345.851) -- 0:00:15
744500 -- (-346.509) (-347.733) [-345.764] (-347.216) * (-345.723) [-346.869] (-345.568) (-348.190) -- 0:00:15
745000 -- (-349.848) (-349.449) (-346.292) [-347.410] * [-346.487] (-348.797) (-347.095) (-345.997) -- 0:00:15
Average standard deviation of split frequencies: 0.005292
745500 -- (-347.474) (-349.972) [-347.901] (-348.598) * (-348.127) (-347.234) [-345.421] (-345.964) -- 0:00:15
746000 -- (-345.822) (-349.069) (-349.047) [-347.044] * [-347.090] (-347.110) (-346.957) (-351.573) -- 0:00:15
746500 -- (-349.313) [-346.209] (-347.429) (-346.085) * [-347.806] (-348.621) (-347.735) (-346.238) -- 0:00:15
747000 -- (-350.336) [-346.365] (-350.933) (-349.825) * (-346.487) (-345.574) [-346.891] (-349.074) -- 0:00:15
747500 -- (-347.254) [-351.283] (-348.017) (-345.460) * (-345.939) (-346.041) (-348.382) [-346.577] -- 0:00:15
748000 -- (-345.507) [-348.389] (-348.606) (-348.174) * [-348.266] (-345.955) (-354.969) (-348.306) -- 0:00:15
748500 -- (-345.843) (-348.126) [-347.696] (-356.842) * (-349.571) [-346.190] (-348.590) (-345.649) -- 0:00:15
749000 -- (-345.624) (-346.196) (-347.533) [-350.720] * (-350.063) (-346.493) (-348.891) [-351.094] -- 0:00:15
749500 -- [-348.175] (-345.051) (-346.893) (-352.259) * (-347.747) [-348.262] (-348.361) (-347.879) -- 0:00:15
750000 -- (-350.128) (-346.516) [-347.295] (-347.636) * (-350.431) (-346.683) (-347.911) [-346.035] -- 0:00:15
Average standard deviation of split frequencies: 0.005259
750500 -- (-346.859) (-345.883) (-347.055) [-349.102] * [-349.477] (-347.962) (-346.757) (-346.631) -- 0:00:14
751000 -- (-345.598) [-346.444] (-348.215) (-346.331) * [-348.954] (-346.580) (-348.536) (-349.989) -- 0:00:14
751500 -- (-345.661) (-345.570) (-346.962) [-348.638] * (-346.334) (-349.387) [-347.178] (-346.706) -- 0:00:14
752000 -- (-347.005) (-348.889) [-346.112] (-348.771) * [-345.023] (-346.106) (-346.657) (-346.485) -- 0:00:14
752500 -- (-347.340) (-345.772) [-349.989] (-347.999) * (-348.720) (-349.236) (-350.760) [-345.045] -- 0:00:14
753000 -- (-347.484) [-350.454] (-346.425) (-348.155) * (-345.058) [-348.331] (-352.659) (-349.213) -- 0:00:14
753500 -- [-345.786] (-347.071) (-346.204) (-350.046) * (-346.812) [-346.570] (-352.363) (-347.383) -- 0:00:14
754000 -- [-345.621] (-345.462) (-347.262) (-347.241) * (-347.729) (-346.799) (-347.005) [-345.692] -- 0:00:14
754500 -- (-347.106) [-345.382] (-346.201) (-352.212) * [-348.511] (-347.076) (-349.589) (-345.852) -- 0:00:14
755000 -- (-348.682) [-345.430] (-346.906) (-353.752) * [-350.947] (-347.567) (-350.029) (-346.478) -- 0:00:14
Average standard deviation of split frequencies: 0.005905
755500 -- (-346.218) [-345.450] (-347.083) (-353.336) * (-347.033) (-345.312) [-349.512] (-347.249) -- 0:00:14
756000 -- (-345.821) (-346.999) [-345.637] (-351.653) * (-345.450) [-344.921] (-345.576) (-349.125) -- 0:00:14
756500 -- [-346.631] (-350.025) (-345.093) (-353.334) * [-347.211] (-347.127) (-348.106) (-345.825) -- 0:00:14
757000 -- [-346.044] (-348.103) (-346.124) (-347.092) * [-345.909] (-347.020) (-347.019) (-349.636) -- 0:00:14
757500 -- (-350.256) (-345.439) [-346.588] (-348.961) * [-346.582] (-346.664) (-349.739) (-345.984) -- 0:00:14
758000 -- (-345.065) (-346.954) [-346.719] (-345.699) * (-348.137) (-345.889) [-350.559] (-352.718) -- 0:00:14
758500 -- (-348.711) (-349.910) (-345.481) [-346.106] * (-350.494) (-346.089) (-348.424) [-350.814] -- 0:00:14
759000 -- (-349.911) [-346.785] (-346.317) (-347.663) * [-345.952] (-346.441) (-352.432) (-348.509) -- 0:00:14
759500 -- (-346.725) (-345.854) (-345.711) [-347.307] * (-347.659) (-345.488) (-348.941) [-346.701] -- 0:00:14
760000 -- (-346.178) (-346.224) [-346.040] (-346.280) * (-346.782) (-347.691) (-348.135) [-347.505] -- 0:00:14
Average standard deviation of split frequencies: 0.005743
760500 -- (-345.240) (-347.335) [-345.770] (-349.776) * (-347.244) (-345.153) [-346.525] (-346.656) -- 0:00:14
761000 -- (-344.819) [-347.652] (-348.914) (-346.456) * (-345.547) [-345.682] (-348.787) (-346.292) -- 0:00:14
761500 -- [-347.463] (-347.629) (-346.464) (-345.758) * (-346.563) [-346.706] (-345.468) (-347.953) -- 0:00:14
762000 -- (-347.208) [-346.459] (-345.722) (-346.429) * (-347.653) [-347.978] (-345.193) (-353.458) -- 0:00:14
762500 -- (-347.992) [-346.500] (-346.447) (-351.263) * [-345.689] (-346.533) (-346.788) (-347.499) -- 0:00:14
763000 -- [-346.037] (-348.860) (-352.185) (-349.314) * (-346.748) (-346.639) (-346.210) [-347.741] -- 0:00:13
763500 -- (-345.965) [-348.091] (-346.945) (-347.567) * (-346.380) (-352.410) (-347.224) [-348.510] -- 0:00:14
764000 -- (-345.965) (-346.915) [-347.220] (-347.688) * [-346.839] (-350.482) (-349.703) (-348.372) -- 0:00:14
764500 -- (-344.886) (-350.487) (-353.917) [-346.069] * (-346.327) (-349.368) (-347.483) [-348.775] -- 0:00:14
765000 -- (-346.619) [-348.306] (-351.290) (-348.565) * (-348.430) (-350.101) (-348.697) [-345.832] -- 0:00:14
Average standard deviation of split frequencies: 0.006116
765500 -- (-346.928) (-347.782) (-347.193) [-348.024] * [-345.823] (-346.814) (-348.780) (-348.649) -- 0:00:14
766000 -- (-345.719) [-346.519] (-347.208) (-348.076) * [-345.876] (-348.112) (-349.806) (-348.551) -- 0:00:14
766500 -- (-350.207) (-345.629) [-347.313] (-353.066) * (-348.827) (-345.004) [-348.077] (-347.681) -- 0:00:14
767000 -- [-349.657] (-347.976) (-350.375) (-351.165) * (-346.214) (-345.994) (-348.295) [-347.447] -- 0:00:13
767500 -- [-347.335] (-346.218) (-346.805) (-348.233) * (-350.452) (-346.593) (-351.719) [-348.633] -- 0:00:13
768000 -- (-349.151) (-350.887) (-346.330) [-346.604] * [-347.324] (-345.741) (-348.580) (-349.537) -- 0:00:13
768500 -- (-351.164) (-347.173) (-345.152) [-348.121] * (-347.657) (-346.134) [-347.853] (-349.351) -- 0:00:13
769000 -- (-345.870) (-346.666) (-346.647) [-347.133] * (-346.380) [-345.448] (-346.271) (-346.565) -- 0:00:13
769500 -- (-346.998) (-346.496) [-348.831] (-346.239) * (-345.582) [-346.789] (-346.138) (-345.780) -- 0:00:13
770000 -- (-346.550) (-347.685) (-347.553) [-350.618] * (-349.109) [-346.350] (-347.290) (-345.648) -- 0:00:13
Average standard deviation of split frequencies: 0.006576
770500 -- (-346.772) (-345.310) [-347.669] (-348.111) * (-345.941) (-346.227) (-346.225) [-345.979] -- 0:00:13
771000 -- (-348.163) (-348.314) (-347.709) [-346.669] * [-347.897] (-346.950) (-348.668) (-348.458) -- 0:00:13
771500 -- (-349.079) (-348.271) (-345.308) [-345.541] * [-346.160] (-346.906) (-347.071) (-347.394) -- 0:00:13
772000 -- (-353.022) (-347.405) (-350.631) [-346.094] * [-345.581] (-347.136) (-350.923) (-347.759) -- 0:00:13
772500 -- (-356.421) (-345.889) [-345.559] (-345.467) * (-351.210) [-344.991] (-346.984) (-347.174) -- 0:00:13
773000 -- (-347.894) (-346.667) (-347.782) [-349.029] * [-349.043] (-346.068) (-346.679) (-349.465) -- 0:00:13
773500 -- (-346.175) [-346.058] (-345.552) (-346.788) * (-346.887) [-347.354] (-345.240) (-348.563) -- 0:00:13
774000 -- (-349.796) (-348.359) (-346.236) [-345.754] * (-347.963) (-345.918) [-348.146] (-346.507) -- 0:00:13
774500 -- (-347.865) (-347.149) [-346.021] (-345.944) * (-347.019) (-348.538) (-346.535) [-345.155] -- 0:00:13
775000 -- (-344.881) (-346.928) [-348.470] (-346.157) * (-346.681) (-351.661) (-347.728) [-346.917] -- 0:00:13
Average standard deviation of split frequencies: 0.006303
775500 -- (-348.751) (-346.910) [-345.753] (-347.317) * [-347.565] (-347.415) (-347.382) (-345.429) -- 0:00:13
776000 -- (-345.874) (-350.659) [-345.467] (-354.311) * (-347.031) (-346.430) [-346.323] (-345.878) -- 0:00:13
776500 -- [-347.542] (-349.351) (-345.705) (-351.983) * (-347.307) (-346.593) [-348.219] (-347.189) -- 0:00:13
777000 -- [-346.473] (-347.062) (-349.350) (-347.978) * [-345.294] (-348.362) (-347.478) (-348.368) -- 0:00:13
777500 -- [-346.908] (-345.714) (-345.972) (-348.493) * (-345.766) [-346.458] (-349.974) (-347.575) -- 0:00:13
778000 -- (-345.760) [-345.632] (-347.408) (-347.086) * (-346.893) (-349.932) [-346.203] (-346.834) -- 0:00:13
778500 -- (-345.526) (-349.348) [-345.250] (-348.777) * (-346.288) (-348.276) [-348.416] (-346.309) -- 0:00:13
779000 -- (-346.407) (-346.471) (-348.796) [-347.034] * [-348.463] (-346.114) (-349.200) (-346.036) -- 0:00:13
779500 -- (-351.431) [-347.078] (-347.967) (-347.085) * [-352.854] (-346.625) (-347.683) (-346.020) -- 0:00:13
780000 -- (-346.397) (-347.164) [-345.424] (-350.708) * (-353.846) [-345.539] (-345.734) (-345.748) -- 0:00:12
Average standard deviation of split frequencies: 0.007057
780500 -- [-347.577] (-348.879) (-345.422) (-347.143) * (-351.336) (-345.612) (-346.089) [-347.516] -- 0:00:13
781000 -- (-352.245) (-347.319) [-347.414] (-350.611) * (-347.944) (-347.765) [-346.130] (-347.719) -- 0:00:13
781500 -- (-347.713) (-346.413) [-345.520] (-350.621) * (-346.037) [-346.207] (-347.818) (-351.639) -- 0:00:13
782000 -- (-345.983) (-349.143) (-346.969) [-351.391] * (-345.163) (-345.441) (-348.113) [-349.207] -- 0:00:13
782500 -- (-346.892) (-345.061) [-347.403] (-347.765) * [-345.610] (-347.551) (-347.809) (-348.113) -- 0:00:13
783000 -- (-351.242) (-347.629) [-346.281] (-345.841) * [-345.480] (-347.771) (-352.894) (-346.758) -- 0:00:13
783500 -- (-346.397) (-346.684) [-346.396] (-346.287) * [-348.626] (-350.229) (-350.259) (-345.449) -- 0:00:12
784000 -- (-348.770) (-346.236) [-346.279] (-346.872) * (-350.304) (-346.917) (-350.163) [-345.798] -- 0:00:12
784500 -- (-347.392) (-355.133) [-346.844] (-347.511) * (-345.934) (-349.623) [-349.011] (-346.166) -- 0:00:12
785000 -- [-352.332] (-346.015) (-345.166) (-347.507) * (-346.048) (-351.316) [-346.902] (-345.539) -- 0:00:12
Average standard deviation of split frequencies: 0.006972
785500 -- (-351.931) [-347.249] (-345.196) (-346.590) * [-345.170] (-348.694) (-351.261) (-347.827) -- 0:00:12
786000 -- (-349.671) (-348.049) [-345.506] (-352.498) * (-346.073) (-346.528) [-349.521] (-346.645) -- 0:00:12
786500 -- [-348.303] (-349.598) (-349.459) (-346.828) * (-344.860) (-346.851) [-347.686] (-346.671) -- 0:00:12
787000 -- (-345.991) (-346.685) (-349.397) [-347.500] * (-350.281) (-346.844) (-347.185) [-347.121] -- 0:00:12
787500 -- (-345.235) (-351.753) [-348.190] (-345.804) * (-350.547) (-346.715) [-345.908] (-347.736) -- 0:00:12
788000 -- (-345.116) [-345.253] (-346.032) (-346.787) * (-349.733) [-345.881] (-344.677) (-346.944) -- 0:00:12
788500 -- (-346.843) (-345.006) [-346.251] (-347.087) * (-348.009) (-347.697) (-345.950) [-346.943] -- 0:00:12
789000 -- (-345.442) (-348.357) [-346.244] (-347.628) * (-349.893) (-346.036) [-346.482] (-348.779) -- 0:00:12
789500 -- [-346.687] (-346.359) (-349.716) (-348.548) * (-350.277) (-347.759) [-347.944] (-345.951) -- 0:00:12
790000 -- (-346.806) (-347.139) (-347.605) [-347.000] * (-345.792) (-345.621) (-344.897) [-345.048] -- 0:00:12
Average standard deviation of split frequencies: 0.006148
790500 -- (-347.442) (-346.681) [-345.394] (-346.918) * (-347.500) [-345.450] (-351.624) (-347.325) -- 0:00:12
791000 -- (-346.016) (-344.972) [-348.453] (-348.721) * (-347.888) (-347.001) (-351.613) [-347.934] -- 0:00:12
791500 -- (-346.436) [-346.568] (-347.292) (-345.316) * (-347.374) (-346.658) [-349.587] (-346.880) -- 0:00:12
792000 -- (-345.657) (-346.358) (-345.894) [-346.210] * (-348.121) (-348.454) (-348.425) [-345.168] -- 0:00:12
792500 -- [-347.968] (-344.826) (-345.574) (-346.650) * (-349.354) (-346.736) (-346.178) [-346.849] -- 0:00:12
793000 -- (-344.973) (-345.332) (-348.849) [-346.451] * (-345.831) (-347.147) [-346.786] (-348.107) -- 0:00:12
793500 -- [-345.021] (-347.166) (-350.238) (-347.401) * (-346.603) (-349.004) (-350.388) [-345.838] -- 0:00:12
794000 -- (-349.792) (-347.901) [-349.728] (-352.044) * (-347.101) [-346.004] (-345.908) (-347.402) -- 0:00:12
794500 -- (-344.940) (-348.837) (-351.821) [-346.407] * (-346.012) (-345.250) [-346.542] (-346.104) -- 0:00:12
795000 -- (-347.271) (-346.107) (-349.401) [-348.317] * (-347.530) (-345.813) [-346.182] (-346.956) -- 0:00:12
Average standard deviation of split frequencies: 0.005811
795500 -- [-345.653] (-347.623) (-345.184) (-348.598) * (-348.067) (-348.513) [-345.915] (-347.710) -- 0:00:12
796000 -- (-347.475) [-348.293] (-347.693) (-347.865) * [-348.636] (-348.679) (-347.723) (-345.111) -- 0:00:12
796500 -- [-345.970] (-345.913) (-345.454) (-347.306) * [-354.642] (-352.775) (-346.327) (-346.359) -- 0:00:12
797000 -- (-346.531) [-345.845] (-347.614) (-345.063) * (-349.299) [-347.342] (-347.855) (-347.064) -- 0:00:11
797500 -- (-344.920) [-348.722] (-348.362) (-348.073) * (-346.930) (-349.383) [-347.994] (-346.866) -- 0:00:11
798000 -- (-347.315) (-347.807) [-346.668] (-348.911) * (-345.881) (-346.589) (-349.004) [-344.826] -- 0:00:12
798500 -- (-346.023) [-350.112] (-350.601) (-348.155) * [-347.614] (-347.120) (-350.674) (-345.925) -- 0:00:12
799000 -- (-348.516) [-350.050] (-349.637) (-347.935) * (-345.768) (-345.932) (-351.157) [-345.295] -- 0:00:12
799500 -- [-347.402] (-350.022) (-350.013) (-345.570) * (-350.589) [-346.367] (-347.543) (-345.920) -- 0:00:12
800000 -- (-351.101) (-346.618) [-346.589] (-349.665) * (-350.510) (-345.615) [-348.282] (-346.434) -- 0:00:12
Average standard deviation of split frequencies: 0.005534
800500 -- (-350.186) [-346.752] (-348.056) (-349.941) * (-346.780) (-347.739) (-345.487) [-347.030] -- 0:00:11
801000 -- (-348.125) [-345.758] (-347.021) (-349.847) * (-346.023) (-347.353) [-345.409] (-357.158) -- 0:00:11
801500 -- (-349.718) [-353.778] (-346.747) (-346.763) * [-347.638] (-346.618) (-346.927) (-346.424) -- 0:00:11
802000 -- [-347.550] (-350.746) (-347.132) (-346.667) * (-348.696) [-348.595] (-347.169) (-347.984) -- 0:00:11
802500 -- (-348.531) [-346.976] (-347.949) (-348.010) * [-346.204] (-344.725) (-348.573) (-348.432) -- 0:00:11
803000 -- (-349.112) (-347.607) [-350.935] (-347.099) * (-349.457) (-345.982) [-346.511] (-348.439) -- 0:00:11
803500 -- (-345.377) (-348.655) [-347.860] (-346.038) * (-346.290) (-344.834) (-352.498) [-347.626] -- 0:00:11
804000 -- [-347.423] (-344.959) (-347.756) (-349.703) * (-345.370) (-345.243) (-348.202) [-346.794] -- 0:00:11
804500 -- (-346.266) [-345.135] (-349.480) (-348.586) * (-348.718) (-345.628) [-345.808] (-346.365) -- 0:00:11
805000 -- (-346.842) (-345.357) [-345.585] (-351.440) * [-346.688] (-346.291) (-345.888) (-348.056) -- 0:00:11
Average standard deviation of split frequencies: 0.005300
805500 -- (-348.681) (-346.723) [-346.478] (-348.557) * (-345.769) [-347.546] (-349.774) (-352.473) -- 0:00:11
806000 -- (-346.159) [-346.200] (-347.882) (-348.056) * (-346.667) (-346.949) [-350.263] (-348.555) -- 0:00:11
806500 -- (-345.498) (-350.154) (-350.377) [-347.133] * (-346.928) [-349.607] (-350.847) (-347.984) -- 0:00:11
807000 -- (-347.732) (-351.251) (-351.281) [-346.724] * (-347.428) (-347.948) [-351.746] (-347.909) -- 0:00:11
807500 -- (-345.483) (-347.947) (-349.707) [-347.436] * (-347.995) [-347.373] (-347.186) (-351.965) -- 0:00:11
808000 -- [-345.307] (-347.879) (-352.152) (-346.214) * [-346.087] (-347.687) (-345.853) (-347.992) -- 0:00:11
808500 -- (-350.036) [-346.040] (-349.334) (-346.872) * (-346.230) (-350.550) (-345.777) [-345.943] -- 0:00:11
809000 -- (-345.728) [-350.506] (-351.936) (-347.263) * [-346.492] (-348.314) (-350.062) (-346.337) -- 0:00:11
809500 -- [-349.519] (-350.274) (-347.641) (-347.868) * (-348.484) (-348.139) (-346.740) [-349.187] -- 0:00:11
810000 -- (-349.946) [-349.664] (-347.432) (-348.496) * (-345.490) (-349.405) (-346.245) [-347.088] -- 0:00:11
Average standard deviation of split frequencies: 0.004768
810500 -- (-347.248) [-348.841] (-347.515) (-345.676) * (-345.837) (-347.323) (-352.548) [-348.641] -- 0:00:11
811000 -- (-347.425) (-346.818) (-348.346) [-346.779] * (-352.984) [-348.145] (-350.741) (-347.306) -- 0:00:11
811500 -- (-348.068) (-347.551) (-346.436) [-345.192] * (-347.972) (-348.838) (-351.912) [-345.903] -- 0:00:11
812000 -- (-346.730) (-350.658) (-345.790) [-345.403] * (-346.702) (-350.866) (-348.954) [-345.210] -- 0:00:11
812500 -- (-345.501) (-351.952) [-346.750] (-345.706) * (-346.483) [-346.803] (-345.496) (-345.220) -- 0:00:11
813000 -- (-346.111) (-347.099) [-344.850] (-345.110) * (-346.508) [-346.959] (-346.303) (-347.677) -- 0:00:11
813500 -- (-349.562) (-346.365) (-347.190) [-349.584] * [-344.994] (-349.484) (-345.614) (-349.264) -- 0:00:11
814000 -- (-350.511) [-347.048] (-346.935) (-350.454) * (-349.468) (-347.371) (-353.792) [-353.118] -- 0:00:10
814500 -- [-345.401] (-346.687) (-345.377) (-348.091) * [-345.952] (-345.702) (-347.659) (-349.752) -- 0:00:10
815000 -- [-346.540] (-349.657) (-347.600) (-349.483) * (-349.518) (-346.500) [-345.895] (-346.341) -- 0:00:11
Average standard deviation of split frequencies: 0.004583
815500 -- (-347.248) (-346.199) [-345.548] (-348.818) * [-347.265] (-346.200) (-346.252) (-345.099) -- 0:00:11
816000 -- (-347.230) [-348.158] (-346.789) (-348.118) * (-346.218) [-346.544] (-345.890) (-346.449) -- 0:00:11
816500 -- [-351.107] (-348.051) (-346.465) (-347.217) * (-348.236) (-345.365) (-349.423) [-346.212] -- 0:00:11
817000 -- (-347.636) (-347.626) (-345.445) [-347.269] * (-347.135) (-346.782) [-350.952] (-350.853) -- 0:00:10
817500 -- (-346.128) (-347.471) (-346.484) [-346.788] * (-346.754) (-345.666) (-346.469) [-345.376] -- 0:00:10
818000 -- [-347.978] (-348.501) (-352.274) (-348.241) * (-347.961) (-345.586) (-345.945) [-345.776] -- 0:00:10
818500 -- (-348.013) (-345.663) [-347.142] (-349.993) * (-347.940) (-348.017) [-345.525] (-346.729) -- 0:00:10
819000 -- (-348.511) [-346.003] (-348.987) (-346.972) * (-348.581) [-347.671] (-347.595) (-345.651) -- 0:00:10
819500 -- (-345.951) [-345.911] (-347.111) (-347.082) * (-346.807) [-346.548] (-345.792) (-345.092) -- 0:00:10
820000 -- (-346.475) (-348.028) [-345.943] (-345.438) * [-347.287] (-350.590) (-346.083) (-345.798) -- 0:00:10
Average standard deviation of split frequencies: 0.003983
820500 -- (-346.388) (-346.604) [-346.038] (-346.363) * (-349.193) (-347.663) (-346.895) [-346.357] -- 0:00:10
821000 -- (-347.961) [-347.871] (-348.486) (-346.031) * (-349.938) [-348.772] (-346.971) (-346.601) -- 0:00:10
821500 -- (-347.846) [-346.857] (-348.747) (-345.380) * (-346.779) (-348.885) [-346.698] (-345.166) -- 0:00:10
822000 -- (-347.914) (-346.071) [-345.518] (-346.766) * [-347.091] (-345.830) (-346.430) (-345.304) -- 0:00:10
822500 -- (-348.582) (-345.182) (-347.804) [-346.827] * [-348.835] (-345.116) (-348.741) (-349.449) -- 0:00:10
823000 -- [-351.424] (-345.306) (-345.659) (-347.975) * (-347.748) (-345.002) (-350.263) [-347.611] -- 0:00:10
823500 -- [-349.013] (-345.444) (-346.607) (-348.693) * [-346.399] (-347.632) (-352.631) (-346.212) -- 0:00:10
824000 -- (-346.940) (-349.092) [-347.203] (-353.646) * (-345.337) [-345.348] (-347.126) (-345.678) -- 0:00:10
824500 -- (-349.378) [-349.352] (-345.595) (-347.563) * [-345.927] (-347.307) (-351.346) (-347.029) -- 0:00:10
825000 -- (-349.215) [-347.743] (-345.713) (-347.435) * [-345.553] (-348.326) (-346.268) (-345.472) -- 0:00:10
Average standard deviation of split frequencies: 0.004138
825500 -- (-344.915) (-348.235) (-346.880) [-344.849] * (-346.753) (-347.884) [-345.600] (-347.244) -- 0:00:10
826000 -- (-349.291) (-348.346) (-345.591) [-347.235] * (-348.076) (-347.981) [-347.071] (-347.097) -- 0:00:10
826500 -- (-346.288) (-348.786) (-348.824) [-344.793] * [-347.527] (-349.604) (-346.932) (-346.640) -- 0:00:10
827000 -- (-345.284) (-350.205) (-346.461) [-347.188] * (-346.932) (-348.307) (-345.608) [-349.437] -- 0:00:10
827500 -- (-354.498) (-353.348) [-346.178] (-351.269) * (-347.964) [-348.334] (-347.151) (-348.491) -- 0:00:10
828000 -- (-348.980) (-348.783) [-348.716] (-348.440) * [-348.092] (-349.578) (-345.748) (-347.466) -- 0:00:10
828500 -- [-348.344] (-347.820) (-348.188) (-345.733) * (-350.704) (-346.464) [-345.575] (-349.545) -- 0:00:10
829000 -- (-346.771) (-346.330) (-347.378) [-349.169] * [-345.824] (-349.706) (-345.052) (-351.093) -- 0:00:10
829500 -- (-346.666) (-346.092) (-346.640) [-347.667] * (-349.509) (-348.224) [-345.182] (-349.610) -- 0:00:10
830000 -- [-349.072] (-346.433) (-349.613) (-347.050) * (-348.218) (-346.691) [-345.433] (-346.514) -- 0:00:10
Average standard deviation of split frequencies: 0.004682
830500 -- (-345.624) (-347.927) [-347.213] (-350.172) * (-346.237) (-346.449) [-345.853] (-346.084) -- 0:00:10
831000 -- (-349.557) (-350.854) [-345.801] (-348.954) * (-345.577) (-346.288) [-347.030] (-346.080) -- 0:00:09
831500 -- (-347.882) (-346.596) [-347.084] (-345.299) * [-346.939] (-349.354) (-347.352) (-347.762) -- 0:00:09
832000 -- (-348.936) (-346.014) [-346.077] (-349.328) * (-347.609) (-346.010) (-349.795) [-347.327] -- 0:00:10
832500 -- (-347.971) [-350.455] (-345.807) (-347.378) * (-350.248) (-350.438) [-344.867] (-347.095) -- 0:00:10
833000 -- (-350.073) [-348.963] (-346.257) (-348.753) * (-348.104) [-346.926] (-347.214) (-345.003) -- 0:00:10
833500 -- (-347.595) [-349.644] (-345.300) (-349.874) * (-346.669) [-347.894] (-345.244) (-350.066) -- 0:00:09
834000 -- (-345.130) (-347.027) (-347.144) [-348.497] * (-347.216) (-348.634) [-348.364] (-350.898) -- 0:00:09
834500 -- (-347.255) (-345.349) [-347.217] (-351.906) * [-346.778] (-348.864) (-348.697) (-346.108) -- 0:00:09
835000 -- (-347.209) [-345.350] (-345.682) (-351.464) * (-350.540) (-346.903) (-350.180) [-346.501] -- 0:00:09
Average standard deviation of split frequencies: 0.004173
835500 -- (-346.365) (-346.884) [-347.382] (-354.091) * [-349.801] (-349.547) (-346.189) (-346.745) -- 0:00:09
836000 -- (-345.943) [-346.043] (-346.922) (-352.228) * (-346.254) (-347.497) [-347.085] (-346.549) -- 0:00:09
836500 -- (-344.942) [-347.275] (-349.644) (-346.730) * [-347.847] (-346.059) (-347.410) (-346.979) -- 0:00:09
837000 -- (-345.226) (-346.811) (-345.926) [-346.872] * (-347.685) (-347.269) (-346.696) [-347.097] -- 0:00:09
837500 -- (-348.326) [-347.557] (-347.666) (-346.565) * (-346.071) (-348.615) [-347.044] (-347.506) -- 0:00:09
838000 -- (-347.362) (-350.068) [-348.452] (-346.081) * [-345.874] (-347.845) (-346.752) (-344.888) -- 0:00:09
838500 -- (-346.190) (-347.550) [-346.958] (-348.171) * (-345.571) (-347.870) [-347.498] (-348.059) -- 0:00:09
839000 -- (-344.993) [-348.786] (-347.639) (-349.618) * (-347.008) (-348.808) [-349.929] (-346.480) -- 0:00:09
839500 -- [-347.789] (-347.035) (-351.889) (-347.296) * (-348.423) [-346.423] (-348.160) (-347.528) -- 0:00:09
840000 -- (-349.874) [-347.486] (-347.299) (-349.320) * (-349.879) (-347.471) [-346.098] (-347.268) -- 0:00:09
Average standard deviation of split frequencies: 0.004598
840500 -- (-347.260) [-345.919] (-349.666) (-345.806) * [-348.078] (-347.214) (-347.041) (-345.393) -- 0:00:09
841000 -- (-346.923) [-345.030] (-347.393) (-345.860) * (-346.516) (-348.804) [-346.147] (-345.820) -- 0:00:09
841500 -- (-349.904) (-346.413) [-346.087] (-351.422) * (-347.554) [-347.081] (-346.570) (-348.862) -- 0:00:09
842000 -- (-349.734) (-346.639) [-347.961] (-345.141) * (-345.386) [-346.062] (-345.582) (-346.116) -- 0:00:09
842500 -- (-349.433) (-345.469) (-352.276) [-345.318] * [-345.510] (-350.329) (-345.930) (-346.217) -- 0:00:09
843000 -- (-350.707) (-347.270) (-350.717) [-345.897] * [-346.798] (-345.209) (-349.859) (-347.884) -- 0:00:09
843500 -- [-345.318] (-354.611) (-347.496) (-349.251) * [-346.678] (-350.756) (-350.131) (-346.909) -- 0:00:09
844000 -- (-345.101) (-347.684) [-346.063] (-346.124) * [-345.598] (-355.506) (-349.451) (-347.938) -- 0:00:09
844500 -- (-345.546) [-345.002] (-346.900) (-345.199) * (-347.392) (-347.444) [-346.356] (-348.727) -- 0:00:09
845000 -- (-345.668) (-347.465) [-345.905] (-347.139) * (-347.706) [-347.477] (-347.541) (-346.734) -- 0:00:09
Average standard deviation of split frequencies: 0.004309
845500 -- (-347.223) (-348.527) [-347.983] (-351.846) * (-348.239) [-346.142] (-345.047) (-347.868) -- 0:00:09
846000 -- (-347.109) [-346.827] (-347.921) (-351.598) * [-345.732] (-347.886) (-345.838) (-348.688) -- 0:00:09
846500 -- [-347.296] (-345.528) (-348.530) (-350.590) * (-348.526) (-348.934) (-347.924) [-348.216] -- 0:00:09
847000 -- (-347.421) (-346.569) [-345.771] (-348.809) * (-348.827) (-347.979) (-348.240) [-347.043] -- 0:00:09
847500 -- (-346.799) (-347.055) (-345.498) [-345.102] * (-350.554) [-346.539] (-352.767) (-344.997) -- 0:00:08
848000 -- (-345.639) (-346.435) [-352.016] (-348.486) * [-345.125] (-346.722) (-347.832) (-347.495) -- 0:00:08
848500 -- (-351.066) (-346.697) (-350.462) [-345.445] * [-349.377] (-349.347) (-351.191) (-351.817) -- 0:00:08
849000 -- [-347.474] (-345.160) (-345.596) (-347.399) * (-348.630) (-347.004) (-346.916) [-345.593] -- 0:00:08
849500 -- (-348.522) [-346.450] (-348.618) (-346.064) * (-346.531) (-347.698) [-346.360] (-346.041) -- 0:00:09
850000 -- (-346.597) (-347.623) [-345.280] (-348.132) * [-346.188] (-346.522) (-345.900) (-349.564) -- 0:00:09
Average standard deviation of split frequencies: 0.003916
850500 -- (-353.211) (-347.333) (-348.218) [-346.201] * (-345.432) (-347.384) (-345.526) [-349.239] -- 0:00:08
851000 -- [-350.052] (-351.226) (-347.755) (-347.956) * (-346.831) (-348.448) (-347.595) [-348.411] -- 0:00:08
851500 -- (-346.803) (-347.801) (-346.769) [-347.845] * (-347.259) (-351.037) [-347.398] (-346.918) -- 0:00:08
852000 -- [-350.167] (-347.642) (-345.715) (-349.145) * (-347.029) [-346.920] (-348.978) (-345.544) -- 0:00:08
852500 -- (-345.626) (-348.389) [-347.610] (-349.035) * [-346.165] (-346.112) (-353.715) (-347.122) -- 0:00:08
853000 -- [-345.887] (-350.383) (-347.343) (-347.117) * (-346.868) (-346.028) (-346.117) [-346.091] -- 0:00:08
853500 -- (-346.455) [-345.798] (-346.351) (-346.198) * (-346.283) (-350.547) [-346.497] (-345.591) -- 0:00:08
854000 -- (-348.713) [-346.324] (-349.329) (-346.423) * [-347.043] (-347.485) (-346.677) (-349.203) -- 0:00:08
854500 -- (-347.483) (-345.875) [-347.357] (-347.600) * (-347.721) (-350.641) (-347.641) [-346.419] -- 0:00:08
855000 -- (-347.301) (-349.730) (-347.385) [-345.573] * (-345.988) [-349.549] (-347.821) (-346.882) -- 0:00:08
Average standard deviation of split frequencies: 0.003928
855500 -- (-354.508) (-346.392) (-347.926) [-346.310] * (-349.149) [-346.338] (-350.967) (-346.522) -- 0:00:08
856000 -- (-345.118) (-347.399) [-345.934] (-347.183) * (-349.345) (-348.074) (-346.461) [-344.884] -- 0:00:08
856500 -- (-345.076) (-347.399) (-347.904) [-347.959] * (-346.347) [-346.804] (-347.809) (-345.856) -- 0:00:08
857000 -- (-347.696) (-348.268) (-346.770) [-347.758] * (-346.313) [-345.272] (-347.438) (-345.519) -- 0:00:08
857500 -- (-347.058) (-347.071) (-347.361) [-347.455] * (-349.078) (-346.851) [-350.070] (-346.373) -- 0:00:08
858000 -- [-345.276] (-346.452) (-349.518) (-345.662) * [-347.435] (-349.766) (-348.171) (-346.746) -- 0:00:08
858500 -- (-346.816) (-345.196) [-347.217] (-346.728) * [-345.901] (-344.933) (-347.234) (-347.933) -- 0:00:08
859000 -- (-346.316) (-347.272) [-346.524] (-349.170) * (-349.569) [-344.903] (-347.721) (-346.804) -- 0:00:08
859500 -- (-350.443) [-345.517] (-347.985) (-347.711) * (-348.941) [-346.941] (-349.161) (-346.286) -- 0:00:08
860000 -- (-346.055) [-345.031] (-347.703) (-347.472) * (-348.148) (-347.273) [-347.035] (-347.900) -- 0:00:08
Average standard deviation of split frequencies: 0.003944
860500 -- [-347.566] (-346.486) (-347.801) (-346.507) * (-346.202) (-348.095) [-346.820] (-347.213) -- 0:00:08
861000 -- (-346.235) (-346.343) [-347.208] (-348.218) * (-345.134) (-349.013) (-345.673) [-348.680] -- 0:00:08
861500 -- (-345.589) [-345.756] (-348.735) (-347.605) * (-345.172) (-346.185) [-347.395] (-347.143) -- 0:00:08
862000 -- [-345.649] (-346.218) (-349.466) (-350.039) * (-345.483) (-349.857) [-346.071] (-349.191) -- 0:00:08
862500 -- [-346.048] (-347.896) (-345.896) (-345.380) * (-346.934) (-349.493) [-344.990] (-345.918) -- 0:00:08
863000 -- [-346.557] (-348.765) (-348.819) (-348.057) * (-345.439) (-347.863) (-346.259) [-345.439] -- 0:00:08
863500 -- (-345.701) [-345.417] (-352.200) (-346.500) * [-345.215] (-346.609) (-345.598) (-346.436) -- 0:00:08
864000 -- (-346.475) (-348.119) [-346.221] (-346.574) * (-345.443) [-345.223] (-348.534) (-349.624) -- 0:00:08
864500 -- (-346.536) (-347.412) (-349.451) [-347.139] * (-349.922) (-345.810) (-346.731) [-347.418] -- 0:00:07
865000 -- [-347.076] (-350.465) (-345.633) (-348.309) * [-349.099] (-345.566) (-346.400) (-347.546) -- 0:00:07
Average standard deviation of split frequencies: 0.004049
865500 -- (-354.872) (-347.707) [-350.313] (-348.221) * (-348.022) (-348.605) [-346.521] (-345.778) -- 0:00:07
866000 -- (-349.980) (-346.982) [-346.271] (-349.447) * (-346.796) (-349.040) (-345.698) [-345.561] -- 0:00:07
866500 -- (-348.854) (-346.370) [-347.045] (-346.144) * (-345.269) (-347.057) (-346.099) [-347.003] -- 0:00:08
867000 -- (-349.910) (-347.163) (-344.766) [-348.093] * (-345.682) [-345.511] (-345.296) (-346.194) -- 0:00:07
867500 -- (-348.969) (-346.257) [-345.426] (-351.038) * (-347.003) (-347.201) [-350.237] (-348.036) -- 0:00:07
868000 -- (-349.629) (-348.102) (-345.704) [-347.786] * (-345.293) (-345.906) (-347.817) [-346.358] -- 0:00:07
868500 -- (-349.796) [-346.115] (-345.302) (-346.864) * (-346.415) [-347.013] (-347.180) (-350.723) -- 0:00:07
869000 -- (-348.174) [-346.378] (-345.663) (-345.750) * [-348.644] (-346.951) (-346.171) (-352.451) -- 0:00:07
869500 -- (-346.605) [-346.643] (-345.979) (-348.867) * [-345.742] (-345.966) (-345.980) (-348.761) -- 0:00:07
870000 -- (-346.546) (-346.026) [-348.058] (-347.330) * [-344.718] (-347.592) (-346.196) (-348.137) -- 0:00:07
Average standard deviation of split frequencies: 0.004223
870500 -- (-345.787) [-346.585] (-353.508) (-346.094) * [-344.968] (-346.319) (-346.862) (-347.367) -- 0:00:07
871000 -- (-349.205) (-346.245) (-347.529) [-346.606] * [-346.280] (-344.945) (-347.199) (-348.145) -- 0:00:07
871500 -- (-349.582) (-347.387) (-345.820) [-349.099] * (-349.172) [-346.116] (-347.599) (-346.302) -- 0:00:07
872000 -- (-350.744) (-348.445) (-346.034) [-346.803] * (-352.705) (-345.065) [-347.069] (-346.176) -- 0:00:07
872500 -- (-354.900) [-345.496] (-347.824) (-348.286) * [-349.875] (-349.522) (-346.410) (-345.623) -- 0:00:07
873000 -- (-348.363) (-347.114) [-347.046] (-348.222) * (-345.927) (-347.664) (-346.157) [-345.263] -- 0:00:07
873500 -- (-345.837) (-348.347) [-345.475] (-350.240) * [-345.970] (-345.913) (-348.184) (-346.635) -- 0:00:07
874000 -- (-345.555) (-349.045) [-345.296] (-346.702) * (-344.876) [-346.009] (-347.211) (-351.870) -- 0:00:07
874500 -- [-345.086] (-349.110) (-347.836) (-346.975) * (-345.471) [-345.798] (-346.679) (-348.181) -- 0:00:07
875000 -- [-345.933] (-345.665) (-345.499) (-352.764) * (-346.752) [-348.626] (-346.783) (-346.476) -- 0:00:07
Average standard deviation of split frequencies: 0.004305
875500 -- (-345.659) [-345.396] (-348.519) (-347.936) * [-348.808] (-347.942) (-346.246) (-348.451) -- 0:00:07
876000 -- (-346.852) (-348.427) (-352.380) [-350.816] * [-347.403] (-346.853) (-346.088) (-345.450) -- 0:00:07
876500 -- (-345.947) (-349.337) (-355.366) [-347.797] * (-348.353) (-346.507) [-346.957] (-345.985) -- 0:00:07
877000 -- (-346.684) [-347.798] (-354.868) (-347.165) * (-346.919) (-349.997) [-346.493] (-346.882) -- 0:00:07
877500 -- (-348.584) (-347.374) (-356.698) [-348.108] * [-345.215] (-346.856) (-345.889) (-347.422) -- 0:00:07
878000 -- (-348.255) (-348.549) [-351.121] (-347.976) * [-346.343] (-348.694) (-347.783) (-346.218) -- 0:00:07
878500 -- (-350.464) (-346.760) (-345.181) [-347.496] * [-346.926] (-347.934) (-349.727) (-347.837) -- 0:00:07
879000 -- (-346.102) (-346.934) (-346.885) [-345.374] * (-345.291) [-348.057] (-347.529) (-346.035) -- 0:00:07
879500 -- (-349.219) (-351.033) (-346.687) [-346.865] * (-347.416) [-345.744] (-348.247) (-345.143) -- 0:00:07
880000 -- (-348.294) [-346.034] (-345.323) (-346.996) * (-347.684) [-346.736] (-346.848) (-345.217) -- 0:00:07
Average standard deviation of split frequencies: 0.004140
880500 -- [-347.772] (-351.066) (-349.785) (-347.493) * (-349.874) (-350.424) [-345.826] (-345.795) -- 0:00:07
881000 -- (-347.756) (-349.079) (-346.114) [-347.663] * [-346.191] (-350.228) (-348.326) (-344.847) -- 0:00:07
881500 -- (-348.044) (-348.242) (-347.031) [-347.700] * (-347.296) [-346.418] (-344.876) (-344.756) -- 0:00:06
882000 -- (-350.582) [-345.772] (-346.665) (-345.052) * (-345.708) [-348.485] (-345.840) (-346.949) -- 0:00:06
882500 -- [-348.542] (-347.063) (-347.520) (-346.350) * (-350.153) [-346.913] (-346.650) (-345.382) -- 0:00:06
883000 -- (-348.810) (-350.571) (-348.945) [-347.353] * [-351.295] (-348.385) (-347.623) (-347.795) -- 0:00:06
883500 -- [-347.910] (-346.203) (-345.796) (-345.866) * (-345.283) (-346.300) (-350.288) [-346.208] -- 0:00:06
884000 -- [-347.261] (-348.261) (-346.237) (-348.812) * [-346.248] (-346.476) (-350.006) (-346.400) -- 0:00:06
884500 -- (-345.690) (-347.747) (-345.670) [-346.130] * (-346.686) (-347.956) (-354.775) [-347.131] -- 0:00:06
885000 -- (-346.394) (-349.128) [-346.538] (-346.986) * [-346.974] (-348.015) (-347.053) (-346.116) -- 0:00:06
Average standard deviation of split frequencies: 0.004057
885500 -- (-348.076) [-348.667] (-348.039) (-346.123) * (-346.943) (-346.693) (-348.993) [-348.981] -- 0:00:06
886000 -- (-346.324) [-351.417] (-350.957) (-346.931) * (-346.724) (-345.698) [-344.990] (-345.377) -- 0:00:06
886500 -- (-347.088) (-348.507) [-349.686] (-346.615) * (-347.703) [-346.715] (-346.450) (-347.134) -- 0:00:06
887000 -- [-346.280] (-346.145) (-350.812) (-347.372) * (-346.829) (-346.238) (-346.581) [-346.103] -- 0:00:06
887500 -- (-347.244) [-348.536] (-347.619) (-346.418) * (-352.396) [-347.305] (-346.848) (-346.153) -- 0:00:06
888000 -- (-346.306) (-348.521) [-347.883] (-347.361) * [-345.547] (-346.079) (-347.163) (-348.959) -- 0:00:06
888500 -- (-346.722) (-345.790) (-349.403) [-344.793] * [-345.151] (-344.818) (-348.889) (-348.606) -- 0:00:06
889000 -- [-345.840] (-346.426) (-347.482) (-346.593) * (-346.586) [-346.238] (-347.994) (-347.434) -- 0:00:06
889500 -- (-347.852) [-346.483] (-348.638) (-351.148) * (-350.134) (-345.571) [-346.397] (-347.175) -- 0:00:06
890000 -- (-345.569) (-345.826) [-347.004] (-348.183) * (-349.138) [-345.558] (-348.217) (-345.816) -- 0:00:06
Average standard deviation of split frequencies: 0.004701
890500 -- (-348.027) (-345.561) (-346.955) [-346.595] * (-347.423) (-346.057) (-347.649) [-346.016] -- 0:00:06
891000 -- [-347.997] (-346.701) (-345.950) (-345.532) * (-346.498) [-344.837] (-349.599) (-348.391) -- 0:00:06
891500 -- (-347.791) (-349.430) [-345.610] (-346.134) * (-346.908) (-347.714) (-347.461) [-345.648] -- 0:00:06
892000 -- (-349.488) [-350.645] (-346.387) (-349.424) * [-346.693] (-349.560) (-346.646) (-349.639) -- 0:00:06
892500 -- (-349.620) [-347.103] (-346.358) (-351.014) * (-346.855) (-349.653) (-346.910) [-346.708] -- 0:00:06
893000 -- (-346.303) [-345.205] (-348.447) (-347.649) * (-348.540) (-346.653) (-345.332) [-346.007] -- 0:00:06
893500 -- (-346.228) [-345.074] (-348.723) (-347.111) * (-345.724) (-346.635) [-345.274] (-349.292) -- 0:00:06
894000 -- (-347.397) [-346.915] (-350.969) (-346.408) * (-346.110) [-346.388] (-347.957) (-345.275) -- 0:00:06
894500 -- (-345.600) (-346.363) [-347.121] (-347.838) * (-348.843) [-347.282] (-351.383) (-345.320) -- 0:00:06
895000 -- (-346.486) (-346.021) (-346.955) [-346.539] * (-348.126) (-349.698) (-351.976) [-349.340] -- 0:00:06
Average standard deviation of split frequencies: 0.004571
895500 -- [-349.451] (-346.346) (-348.789) (-347.380) * [-347.474] (-345.057) (-351.971) (-345.849) -- 0:00:06
896000 -- (-347.189) [-346.775] (-345.210) (-346.262) * (-352.470) (-345.246) (-348.383) [-348.901] -- 0:00:06
896500 -- (-346.872) (-346.522) [-344.796] (-347.479) * (-345.135) (-348.818) (-346.342) [-345.934] -- 0:00:06
897000 -- (-351.162) (-346.750) (-345.008) [-348.871] * (-346.596) [-345.600] (-346.875) (-348.104) -- 0:00:06
897500 -- (-348.265) (-346.142) [-345.494] (-349.100) * [-346.608] (-346.923) (-351.390) (-347.457) -- 0:00:06
898000 -- (-347.340) (-348.657) [-347.586] (-353.082) * (-347.365) (-345.721) [-347.265] (-347.396) -- 0:00:06
898500 -- (-345.460) (-348.736) [-347.470] (-346.805) * (-345.752) (-347.921) (-347.958) [-345.361] -- 0:00:05
899000 -- (-346.725) [-345.974] (-348.079) (-352.760) * (-352.811) [-345.554] (-348.253) (-346.563) -- 0:00:05
899500 -- [-348.329] (-347.874) (-348.251) (-356.954) * (-350.777) (-347.698) (-347.657) [-348.857] -- 0:00:05
900000 -- (-346.038) (-349.641) [-346.404] (-355.579) * (-353.288) (-346.978) (-348.050) [-349.153] -- 0:00:05
Average standard deviation of split frequencies: 0.004449
900500 -- (-349.382) (-347.033) [-345.245] (-347.007) * (-347.248) (-345.961) [-348.264] (-351.049) -- 0:00:05
901000 -- (-346.321) (-347.537) [-346.858] (-346.535) * (-347.359) [-348.276] (-345.524) (-348.222) -- 0:00:05
901500 -- (-347.277) [-347.296] (-348.365) (-345.610) * [-347.606] (-348.117) (-348.074) (-351.978) -- 0:00:05
902000 -- (-348.884) (-346.051) (-347.686) [-345.852] * [-345.913] (-350.965) (-348.634) (-350.981) -- 0:00:05
902500 -- (-350.209) (-350.808) [-347.192] (-349.907) * (-345.962) [-345.834] (-346.052) (-347.641) -- 0:00:05
903000 -- [-346.558] (-354.486) (-349.399) (-348.907) * (-346.932) (-351.732) (-348.112) [-345.612] -- 0:00:05
903500 -- (-345.160) (-348.396) (-347.980) [-344.899] * (-346.464) (-350.941) (-345.284) [-345.488] -- 0:00:05
904000 -- (-348.528) [-346.368] (-347.292) (-344.808) * (-346.791) (-349.004) (-347.029) [-344.957] -- 0:00:05
904500 -- (-348.432) [-347.277] (-349.422) (-350.098) * (-347.440) [-347.411] (-346.914) (-346.738) -- 0:00:05
905000 -- [-348.152] (-346.762) (-350.210) (-347.951) * [-346.449] (-347.293) (-345.689) (-346.148) -- 0:00:05
Average standard deviation of split frequencies: 0.004195
905500 -- (-347.894) (-345.192) (-346.023) [-345.363] * (-347.161) (-346.288) (-347.960) [-346.163] -- 0:00:05
906000 -- (-346.231) (-345.006) [-348.051] (-350.336) * [-348.116] (-350.348) (-351.679) (-346.493) -- 0:00:05
906500 -- (-349.514) (-345.476) [-346.707] (-346.414) * (-345.108) (-345.464) (-347.131) [-348.144] -- 0:00:05
907000 -- [-349.690] (-347.111) (-349.259) (-350.062) * (-347.450) [-345.927] (-347.081) (-346.173) -- 0:00:05
907500 -- (-348.678) (-345.473) [-348.695] (-347.287) * (-351.285) (-345.306) [-345.989] (-347.030) -- 0:00:05
908000 -- [-346.347] (-350.994) (-348.494) (-345.614) * [-346.299] (-346.621) (-347.976) (-346.972) -- 0:00:05
908500 -- (-346.867) (-345.815) (-347.399) [-347.019] * [-348.684] (-346.149) (-348.412) (-346.740) -- 0:00:05
909000 -- (-350.315) (-349.265) [-346.642] (-347.834) * (-351.152) [-348.437] (-346.740) (-348.901) -- 0:00:05
909500 -- (-345.055) (-348.909) [-345.278] (-346.989) * (-346.505) (-345.586) (-345.735) [-349.032] -- 0:00:05
910000 -- (-345.494) [-346.398] (-345.875) (-348.375) * (-345.432) (-348.926) (-346.791) [-350.567] -- 0:00:05
Average standard deviation of split frequencies: 0.004562
910500 -- [-346.265] (-346.941) (-348.481) (-349.344) * (-346.374) [-349.137] (-345.165) (-351.038) -- 0:00:05
911000 -- (-346.005) [-349.350] (-345.920) (-351.735) * (-346.441) (-345.848) (-355.555) [-345.188] -- 0:00:05
911500 -- [-346.410] (-354.216) (-348.363) (-347.199) * (-347.135) (-351.416) [-347.677] (-345.295) -- 0:00:05
912000 -- (-346.016) (-352.875) [-346.697] (-349.314) * [-347.657] (-347.749) (-350.314) (-347.186) -- 0:00:05
912500 -- (-346.437) (-347.412) [-345.581] (-345.621) * [-345.738] (-346.252) (-348.700) (-346.264) -- 0:00:05
913000 -- (-345.511) (-347.824) (-345.614) [-345.332] * (-350.898) (-350.064) [-345.880] (-346.841) -- 0:00:05
913500 -- [-346.600] (-348.269) (-346.716) (-345.306) * [-344.875] (-346.116) (-348.515) (-345.707) -- 0:00:05
914000 -- (-347.402) [-346.531] (-347.489) (-347.742) * [-346.552] (-349.199) (-347.475) (-347.145) -- 0:00:05
914500 -- (-346.223) (-350.278) (-346.567) [-347.714] * (-348.105) (-350.854) [-346.010] (-349.294) -- 0:00:05
915000 -- (-347.363) (-348.913) [-345.323] (-350.444) * [-346.699] (-350.327) (-346.088) (-349.415) -- 0:00:05
Average standard deviation of split frequencies: 0.004535
915500 -- [-344.923] (-351.131) (-346.452) (-346.778) * [-345.849] (-345.618) (-345.686) (-345.882) -- 0:00:04
916000 -- (-345.220) (-346.803) (-345.789) [-344.913] * (-348.392) (-346.129) [-346.396] (-349.371) -- 0:00:04
916500 -- (-346.432) (-345.957) [-347.196] (-348.227) * (-346.100) (-344.903) [-344.909] (-349.550) -- 0:00:04
917000 -- (-348.926) (-345.942) (-345.383) [-346.243] * (-345.469) (-347.237) (-346.008) [-346.341] -- 0:00:04
917500 -- (-345.289) [-348.816] (-345.242) (-347.168) * (-348.787) (-348.517) (-348.884) [-345.640] -- 0:00:04
918000 -- (-346.996) [-347.259] (-346.923) (-346.907) * [-347.301] (-346.272) (-347.630) (-347.586) -- 0:00:04
918500 -- [-346.235] (-349.113) (-347.187) (-347.726) * (-349.780) [-346.568] (-347.745) (-347.937) -- 0:00:04
919000 -- (-345.133) (-345.712) [-345.520] (-345.625) * [-346.589] (-347.571) (-348.071) (-345.278) -- 0:00:04
919500 -- (-345.907) [-347.221] (-346.386) (-352.129) * (-344.954) [-345.133] (-345.612) (-347.328) -- 0:00:04
920000 -- [-349.561] (-347.026) (-349.394) (-357.037) * (-345.655) (-346.234) [-344.955] (-348.757) -- 0:00:04
Average standard deviation of split frequencies: 0.004512
920500 -- [-349.699] (-345.862) (-348.484) (-353.078) * [-346.048] (-345.720) (-346.907) (-349.149) -- 0:00:04
921000 -- [-346.738] (-346.359) (-352.124) (-349.283) * (-346.475) (-345.438) (-348.031) [-347.078] -- 0:00:04
921500 -- (-346.455) (-347.259) (-351.362) [-345.934] * (-347.940) (-345.188) [-351.989] (-346.411) -- 0:00:04
922000 -- (-346.165) [-346.223] (-347.505) (-345.940) * (-347.347) (-347.738) [-346.988] (-345.569) -- 0:00:04
922500 -- (-350.180) [-350.688] (-352.264) (-345.830) * (-346.427) (-348.738) (-348.046) [-347.428] -- 0:00:04
923000 -- [-348.255] (-347.213) (-346.569) (-347.089) * [-345.409] (-347.677) (-349.343) (-346.290) -- 0:00:04
923500 -- (-350.624) (-348.465) (-347.413) [-346.288] * (-350.628) (-345.598) [-346.455] (-348.379) -- 0:00:04
924000 -- (-351.599) [-344.982] (-347.867) (-345.950) * (-346.901) (-348.986) [-346.113] (-348.740) -- 0:00:04
924500 -- (-345.064) (-345.997) (-347.124) [-347.497] * (-347.242) [-345.186] (-346.555) (-353.808) -- 0:00:04
925000 -- (-349.769) (-345.699) [-346.552] (-351.405) * (-346.589) [-345.387] (-347.870) (-349.367) -- 0:00:04
Average standard deviation of split frequencies: 0.004582
925500 -- (-346.111) [-347.512] (-348.142) (-349.038) * [-347.142] (-347.823) (-345.393) (-345.484) -- 0:00:04
926000 -- (-354.888) [-344.759] (-346.324) (-348.617) * [-346.456] (-346.492) (-348.388) (-346.623) -- 0:00:04
926500 -- [-345.628] (-348.920) (-347.940) (-346.048) * (-349.728) [-346.346] (-348.556) (-347.913) -- 0:00:04
927000 -- (-348.335) [-348.307] (-348.263) (-347.121) * [-348.638] (-348.485) (-346.232) (-346.874) -- 0:00:04
927500 -- (-346.815) (-353.106) [-347.142] (-347.787) * (-348.088) (-349.748) (-345.951) [-348.477] -- 0:00:04
928000 -- [-349.477] (-348.254) (-346.813) (-349.095) * (-347.195) (-346.313) (-348.181) [-345.256] -- 0:00:04
928500 -- (-346.906) (-346.914) [-344.806] (-345.182) * (-345.563) [-347.147] (-345.435) (-346.878) -- 0:00:04
929000 -- (-346.526) (-346.003) (-346.912) [-345.983] * (-358.232) (-347.107) (-346.369) [-346.260] -- 0:00:04
929500 -- [-348.834] (-345.126) (-346.674) (-346.899) * (-353.509) (-348.917) (-349.586) [-345.288] -- 0:00:04
930000 -- (-349.462) (-346.768) [-346.549] (-349.117) * (-350.159) (-348.320) (-350.713) [-345.155] -- 0:00:04
Average standard deviation of split frequencies: 0.004559
930500 -- (-351.187) [-345.815] (-349.163) (-351.170) * (-346.814) [-346.518] (-349.586) (-345.202) -- 0:00:04
931000 -- (-348.881) [-346.845] (-352.028) (-347.027) * [-346.854] (-347.524) (-346.214) (-345.401) -- 0:00:04
931500 -- (-347.620) [-345.923] (-346.210) (-345.599) * (-347.279) (-348.545) (-345.109) [-346.155] -- 0:00:04
932000 -- (-348.697) (-346.702) [-347.488] (-346.377) * (-347.397) [-346.624] (-345.991) (-345.936) -- 0:00:04
932500 -- (-347.209) [-348.680] (-347.819) (-346.287) * (-348.010) (-348.545) [-346.118] (-346.230) -- 0:00:03
933000 -- (-347.226) [-346.044] (-347.416) (-347.573) * (-345.346) [-346.429] (-345.718) (-345.793) -- 0:00:03
933500 -- (-350.187) (-344.957) [-345.387] (-350.424) * [-346.988] (-345.934) (-354.678) (-346.869) -- 0:00:03
934000 -- (-347.549) (-346.287) [-347.973] (-346.212) * (-346.153) (-346.161) [-348.260] (-345.874) -- 0:00:03
934500 -- [-345.727] (-346.164) (-346.018) (-347.458) * (-346.090) [-347.664] (-349.660) (-351.759) -- 0:00:03
935000 -- [-346.041] (-346.960) (-345.999) (-349.932) * (-345.829) [-350.132] (-347.099) (-350.239) -- 0:00:03
Average standard deviation of split frequencies: 0.004407
935500 -- (-351.365) [-346.372] (-346.627) (-346.890) * (-346.825) [-347.816] (-346.896) (-348.466) -- 0:00:03
936000 -- (-349.065) (-347.141) (-347.763) [-346.040] * (-346.046) (-348.395) [-348.155] (-344.718) -- 0:00:03
936500 -- (-351.333) [-348.477] (-350.082) (-346.279) * [-345.703] (-348.105) (-350.176) (-347.099) -- 0:00:03
937000 -- (-347.888) (-346.039) (-345.438) [-346.148] * (-344.993) (-352.486) [-345.496] (-347.698) -- 0:00:03
937500 -- (-345.480) (-346.485) [-345.287] (-349.063) * (-351.421) [-345.172] (-347.220) (-348.498) -- 0:00:03
938000 -- (-347.919) (-347.287) [-347.644] (-346.968) * (-348.872) (-345.975) [-346.504] (-349.140) -- 0:00:03
938500 -- (-348.592) [-345.078] (-351.313) (-347.701) * [-350.086] (-349.100) (-347.952) (-344.789) -- 0:00:03
939000 -- (-348.542) (-345.434) (-348.150) [-347.653] * (-347.178) [-346.029] (-346.278) (-346.844) -- 0:00:03
939500 -- [-345.885] (-347.781) (-347.680) (-347.083) * [-346.093] (-348.601) (-346.138) (-345.317) -- 0:00:03
940000 -- (-348.343) [-345.822] (-346.593) (-345.829) * (-349.168) (-344.816) [-346.103] (-346.672) -- 0:00:03
Average standard deviation of split frequencies: 0.004573
940500 -- (-346.909) [-346.892] (-346.231) (-345.428) * (-345.888) (-346.346) (-348.376) [-349.831] -- 0:00:03
941000 -- (-346.020) (-347.103) (-348.566) [-345.723] * (-347.292) (-344.787) [-347.037] (-354.356) -- 0:00:03
941500 -- (-348.874) (-346.155) (-346.983) [-346.121] * (-351.974) [-346.369] (-345.457) (-346.685) -- 0:00:03
942000 -- (-346.954) (-345.227) [-350.359] (-345.688) * [-351.494] (-344.896) (-347.495) (-347.992) -- 0:00:03
942500 -- (-345.891) (-346.797) [-345.821] (-345.994) * (-346.788) (-345.762) [-354.852] (-346.062) -- 0:00:03
943000 -- (-345.697) [-346.385] (-350.413) (-346.482) * (-346.871) (-345.648) [-349.844] (-347.995) -- 0:00:03
943500 -- [-345.744] (-347.269) (-346.946) (-351.248) * [-350.213] (-346.538) (-346.683) (-346.533) -- 0:00:03
944000 -- [-346.399] (-349.390) (-353.113) (-348.483) * [-349.282] (-350.632) (-347.641) (-346.362) -- 0:00:03
944500 -- (-345.894) (-349.938) (-351.237) [-347.507] * (-352.679) [-348.881] (-346.129) (-348.124) -- 0:00:03
945000 -- (-351.353) (-348.376) (-348.791) [-345.322] * [-347.053] (-346.330) (-347.370) (-346.387) -- 0:00:03
Average standard deviation of split frequencies: 0.004049
945500 -- (-347.773) (-348.105) (-346.283) [-347.560] * (-346.832) [-347.180] (-350.208) (-346.907) -- 0:00:03
946000 -- (-356.401) (-346.075) [-344.785] (-347.534) * (-348.146) [-345.959] (-348.626) (-345.464) -- 0:00:03
946500 -- (-345.262) (-347.820) [-347.182] (-348.311) * [-345.558] (-348.971) (-348.614) (-345.198) -- 0:00:03
947000 -- (-345.847) (-351.526) (-345.347) [-347.743] * (-349.033) [-345.527] (-346.366) (-346.641) -- 0:00:03
947500 -- [-346.213] (-345.975) (-345.896) (-345.452) * (-346.578) (-345.035) (-347.374) [-349.002] -- 0:00:03
948000 -- [-348.603] (-346.237) (-354.231) (-345.452) * (-347.131) [-346.292] (-348.756) (-347.905) -- 0:00:03
948500 -- (-345.400) [-347.608] (-346.695) (-345.795) * [-346.541] (-351.735) (-345.990) (-348.335) -- 0:00:03
949000 -- (-347.114) (-345.148) [-346.916] (-346.898) * [-346.933] (-345.104) (-348.265) (-346.090) -- 0:00:03
949500 -- [-352.631] (-345.595) (-346.269) (-344.791) * (-348.980) [-344.902] (-346.600) (-348.358) -- 0:00:02
950000 -- (-348.743) (-346.173) (-346.216) [-346.738] * (-348.875) [-348.481] (-346.722) (-346.771) -- 0:00:02
Average standard deviation of split frequencies: 0.004215
950500 -- (-349.502) [-346.855] (-347.783) (-347.704) * (-351.871) (-347.374) [-347.567] (-348.116) -- 0:00:02
951000 -- (-351.899) (-346.112) (-344.914) [-345.944] * (-346.305) (-348.117) [-348.845] (-346.906) -- 0:00:02
951500 -- (-347.602) (-349.185) [-344.755] (-349.854) * (-346.399) [-346.280] (-346.779) (-346.104) -- 0:00:02
952000 -- [-347.247] (-349.140) (-346.153) (-344.937) * (-347.393) [-346.532] (-346.292) (-347.879) -- 0:00:02
952500 -- (-351.784) (-346.872) [-350.082] (-346.618) * [-345.336] (-345.896) (-348.186) (-349.986) -- 0:00:02
953000 -- (-347.135) (-349.420) (-351.621) [-346.467] * (-345.067) [-347.670] (-347.181) (-345.978) -- 0:00:02
953500 -- (-347.954) (-348.228) (-347.109) [-346.888] * (-346.079) (-346.510) (-346.499) [-346.258] -- 0:00:02
954000 -- [-347.176] (-347.452) (-346.569) (-347.114) * (-346.409) [-347.364] (-350.544) (-347.679) -- 0:00:02
954500 -- [-347.833] (-351.584) (-346.988) (-345.920) * [-345.950] (-350.498) (-346.261) (-346.248) -- 0:00:02
955000 -- (-346.978) (-345.420) [-348.613] (-348.892) * (-346.184) (-348.053) (-345.863) [-346.184] -- 0:00:02
Average standard deviation of split frequencies: 0.004191
955500 -- [-348.118] (-347.849) (-350.093) (-346.813) * (-349.562) (-345.750) (-351.038) [-346.822] -- 0:00:02
956000 -- (-348.523) [-349.709] (-346.820) (-346.940) * (-347.949) (-346.156) (-346.400) [-345.288] -- 0:00:02
956500 -- [-350.248] (-346.630) (-346.794) (-345.620) * (-345.204) (-346.123) [-346.987] (-348.339) -- 0:00:02
957000 -- [-347.080] (-345.746) (-346.049) (-345.870) * (-348.436) [-347.226] (-348.881) (-347.186) -- 0:00:02
957500 -- (-346.185) (-347.331) [-352.193] (-346.665) * (-347.802) (-347.153) (-345.664) [-350.611] -- 0:00:02
958000 -- [-345.652] (-348.284) (-347.232) (-348.642) * (-346.491) (-351.539) [-347.072] (-349.777) -- 0:00:02
958500 -- (-345.574) (-349.066) [-347.046] (-345.435) * (-348.169) (-347.613) (-348.770) [-347.049] -- 0:00:02
959000 -- (-346.519) (-347.197) [-345.592] (-346.198) * (-346.767) (-348.968) (-349.005) [-348.816] -- 0:00:02
959500 -- [-345.855] (-348.639) (-347.421) (-346.520) * [-346.249] (-347.901) (-348.444) (-347.378) -- 0:00:02
960000 -- (-350.269) (-351.807) [-345.969] (-346.152) * (-347.292) [-346.037] (-345.143) (-345.189) -- 0:00:02
Average standard deviation of split frequencies: 0.004294
960500 -- (-346.436) (-351.236) (-346.759) [-347.828] * (-347.297) (-345.607) (-347.966) [-347.956] -- 0:00:02
961000 -- (-345.780) (-347.105) (-345.761) [-347.076] * [-347.138] (-346.362) (-347.614) (-346.865) -- 0:00:02
961500 -- (-346.771) [-345.708] (-347.103) (-346.048) * (-347.680) (-345.748) (-348.143) [-350.781] -- 0:00:02
962000 -- (-348.963) (-345.392) (-346.993) [-346.844] * (-345.529) [-346.899] (-347.245) (-346.558) -- 0:00:02
962500 -- (-347.233) (-346.033) (-345.326) [-347.051] * [-345.513] (-346.128) (-346.372) (-347.684) -- 0:00:02
963000 -- (-345.586) (-345.727) [-344.985] (-346.997) * (-348.425) [-348.305] (-346.368) (-347.016) -- 0:00:02
963500 -- (-346.343) (-346.719) [-346.989] (-346.109) * (-347.863) [-347.353] (-347.928) (-345.073) -- 0:00:02
964000 -- (-346.040) [-347.531] (-345.935) (-345.674) * (-346.514) (-346.297) (-346.955) [-346.535] -- 0:00:02
964500 -- (-346.594) (-347.044) [-346.651] (-346.129) * (-350.666) [-347.299] (-346.799) (-349.130) -- 0:00:02
965000 -- (-350.297) [-348.760] (-348.871) (-346.318) * (-348.247) (-346.285) (-345.617) [-345.057] -- 0:00:02
Average standard deviation of split frequencies: 0.004117
965500 -- (-349.219) (-351.281) [-346.553] (-348.000) * (-345.838) (-352.640) (-345.775) [-349.092] -- 0:00:02
966000 -- [-351.631] (-348.600) (-345.816) (-346.759) * (-345.655) (-346.599) (-350.452) [-345.157] -- 0:00:02
966500 -- (-347.502) (-346.404) [-346.508] (-350.115) * [-347.919] (-349.401) (-352.025) (-349.893) -- 0:00:01
967000 -- (-346.770) (-346.958) (-346.497) [-344.863] * (-348.685) (-351.169) [-350.019] (-347.221) -- 0:00:01
967500 -- [-344.873] (-348.017) (-346.934) (-348.010) * (-345.401) (-347.332) [-345.924] (-348.269) -- 0:00:01
968000 -- (-345.579) (-348.394) (-345.094) [-352.230] * (-347.351) [-346.702] (-346.976) (-349.498) -- 0:00:01
968500 -- (-345.943) [-348.235] (-357.138) (-349.825) * (-347.759) (-345.375) [-347.024] (-346.713) -- 0:00:01
969000 -- (-348.574) (-347.671) (-348.320) [-345.876] * (-347.666) [-346.016] (-347.912) (-345.763) -- 0:00:01
969500 -- (-345.637) (-350.636) [-345.185] (-346.278) * [-348.414] (-349.351) (-347.271) (-346.565) -- 0:00:01
970000 -- (-349.901) [-347.195] (-345.454) (-346.197) * [-348.216] (-346.980) (-346.349) (-346.947) -- 0:00:01
Average standard deviation of split frequencies: 0.004219
970500 -- [-346.191] (-348.519) (-349.593) (-345.421) * (-348.740) (-348.314) [-348.905] (-351.098) -- 0:00:01
971000 -- (-350.195) (-352.714) [-347.304] (-345.345) * (-349.461) (-349.154) [-349.948] (-354.357) -- 0:00:01
971500 -- (-349.100) (-357.727) [-348.908] (-346.687) * (-347.501) [-348.291] (-350.566) (-350.333) -- 0:00:01
972000 -- (-351.644) (-347.360) (-348.960) [-351.485] * (-347.218) (-347.772) (-348.014) [-346.336] -- 0:00:01
972500 -- (-347.470) [-348.399] (-346.531) (-346.170) * (-346.145) (-347.455) [-345.802] (-345.951) -- 0:00:01
973000 -- (-350.130) [-348.596] (-346.256) (-346.857) * (-347.394) (-346.613) (-348.689) [-346.189] -- 0:00:01
973500 -- (-346.364) (-347.309) (-345.693) [-350.037] * (-347.829) (-345.935) (-347.699) [-345.995] -- 0:00:01
974000 -- (-350.380) (-346.893) (-346.858) [-347.134] * (-348.667) (-346.888) [-346.725] (-348.560) -- 0:00:01
974500 -- (-349.909) (-347.046) (-345.137) [-346.924] * (-348.639) (-349.266) (-349.825) [-345.385] -- 0:00:01
975000 -- [-347.618] (-345.608) (-347.006) (-345.957) * (-346.776) [-351.539] (-347.463) (-348.926) -- 0:00:01
Average standard deviation of split frequencies: 0.004407
975500 -- [-347.139] (-346.412) (-348.025) (-346.837) * (-347.610) (-346.474) [-347.955] (-346.221) -- 0:00:01
976000 -- [-345.754] (-346.061) (-346.075) (-345.923) * (-347.894) (-345.883) [-346.482] (-346.177) -- 0:00:01
976500 -- (-346.685) (-350.026) [-350.465] (-345.662) * [-345.359] (-345.782) (-345.412) (-346.104) -- 0:00:01
977000 -- (-347.168) (-347.074) (-348.409) [-345.520] * [-348.456] (-349.126) (-350.269) (-347.215) -- 0:00:01
977500 -- (-349.183) (-347.199) [-345.187] (-346.563) * (-345.171) (-348.780) (-348.450) [-347.230] -- 0:00:01
978000 -- (-350.574) (-350.477) (-345.066) [-348.557] * (-349.236) [-348.164] (-348.739) (-347.314) -- 0:00:01
978500 -- (-346.349) [-345.021] (-345.002) (-348.401) * (-345.788) (-348.081) (-346.810) [-347.906] -- 0:00:01
979000 -- (-345.480) (-347.367) [-345.932] (-347.582) * (-346.620) (-346.102) [-346.759] (-346.041) -- 0:00:01
979500 -- [-347.391] (-346.280) (-346.470) (-349.167) * (-347.519) (-346.771) [-349.165] (-347.426) -- 0:00:01
980000 -- (-346.956) (-348.340) (-345.611) [-348.925] * [-347.602] (-346.336) (-345.160) (-347.177) -- 0:00:01
Average standard deviation of split frequencies: 0.004446
980500 -- (-347.157) (-349.950) (-347.770) [-345.200] * (-349.400) (-351.126) [-347.875] (-349.229) -- 0:00:01
981000 -- (-345.844) (-350.266) [-345.165] (-346.469) * (-346.879) [-346.086] (-349.339) (-349.559) -- 0:00:01
981500 -- [-347.060] (-348.237) (-346.567) (-346.033) * (-348.036) (-352.104) [-347.832] (-348.680) -- 0:00:01
982000 -- (-347.159) (-347.589) (-347.735) [-346.948] * (-345.920) [-346.594] (-351.091) (-350.551) -- 0:00:01
982500 -- [-346.127] (-346.002) (-348.145) (-346.125) * [-346.538] (-353.807) (-350.391) (-345.959) -- 0:00:01
983000 -- (-346.468) (-349.999) (-347.930) [-347.512] * [-347.603] (-348.404) (-346.475) (-352.888) -- 0:00:01
983500 -- (-346.388) [-346.313] (-345.852) (-346.556) * [-348.293] (-347.153) (-347.164) (-346.311) -- 0:00:00
984000 -- (-345.818) [-347.172] (-346.508) (-347.787) * (-346.941) (-346.845) (-345.607) [-348.094] -- 0:00:00
984500 -- (-346.266) (-346.455) [-347.213] (-345.769) * [-346.070] (-348.771) (-345.587) (-346.962) -- 0:00:00
985000 -- [-346.572] (-346.475) (-345.771) (-349.653) * [-345.351] (-345.080) (-347.495) (-345.625) -- 0:00:00
Average standard deviation of split frequencies: 0.004333
985500 -- [-345.090] (-349.409) (-346.620) (-347.505) * (-350.374) [-348.485] (-345.070) (-344.957) -- 0:00:00
986000 -- [-345.095] (-352.589) (-348.518) (-348.689) * (-345.926) (-348.534) [-344.987] (-348.950) -- 0:00:00
986500 -- [-347.214] (-347.211) (-345.665) (-346.010) * (-347.260) (-346.296) [-345.703] (-350.087) -- 0:00:00
987000 -- (-345.673) (-345.455) [-348.026] (-355.167) * (-350.410) (-351.634) (-352.190) [-348.022] -- 0:00:00
987500 -- (-346.812) (-346.684) (-346.000) [-346.069] * (-347.901) [-345.417] (-348.057) (-348.852) -- 0:00:00
988000 -- (-350.782) (-348.214) [-355.706] (-345.273) * (-345.354) (-348.280) (-349.549) [-347.730] -- 0:00:00
988500 -- (-349.172) [-346.409] (-351.588) (-346.716) * (-347.913) (-348.540) (-346.021) [-348.166] -- 0:00:00
989000 -- [-347.750] (-345.968) (-350.758) (-357.717) * (-348.724) (-345.489) [-344.978] (-345.431) -- 0:00:00
989500 -- (-345.399) (-347.200) [-350.592] (-347.187) * (-351.969) (-346.586) (-345.662) [-347.758] -- 0:00:00
990000 -- (-348.520) (-346.516) [-346.880] (-346.674) * [-349.808] (-347.217) (-347.199) (-346.510) -- 0:00:00
Average standard deviation of split frequencies: 0.004253
990500 -- (-346.034) (-348.533) (-350.764) [-348.832] * (-347.942) [-346.257] (-348.761) (-345.256) -- 0:00:00
991000 -- [-346.347] (-345.899) (-350.404) (-347.363) * (-348.767) (-345.889) [-347.164] (-345.447) -- 0:00:00
991500 -- (-345.465) (-346.535) (-346.912) [-347.043] * [-346.019] (-346.772) (-346.795) (-347.509) -- 0:00:00
992000 -- (-349.223) (-347.108) [-347.755] (-348.263) * [-348.672] (-349.160) (-347.774) (-351.136) -- 0:00:00
992500 -- (-346.948) [-345.407] (-345.880) (-345.451) * (-345.171) (-347.030) (-345.810) [-346.408] -- 0:00:00
993000 -- (-350.732) (-345.322) (-345.487) [-345.517] * [-348.157] (-346.157) (-347.654) (-346.544) -- 0:00:00
993500 -- (-350.258) (-345.571) [-345.032] (-344.974) * [-350.274] (-347.859) (-349.680) (-348.744) -- 0:00:00
994000 -- (-346.583) (-347.215) (-353.878) [-346.809] * [-346.528] (-346.675) (-347.116) (-348.735) -- 0:00:00
994500 -- [-345.472] (-347.745) (-348.713) (-346.122) * (-349.484) (-347.015) (-345.866) [-345.774] -- 0:00:00
995000 -- (-345.482) (-346.195) (-345.642) [-351.768] * (-345.972) (-345.873) [-347.021] (-346.800) -- 0:00:00
Average standard deviation of split frequencies: 0.004467
995500 -- (-347.720) (-345.783) (-346.159) [-345.786] * (-350.018) [-346.154] (-347.144) (-348.388) -- 0:00:00
996000 -- [-349.544] (-348.349) (-350.745) (-349.148) * (-345.661) (-345.726) (-346.296) [-345.415] -- 0:00:00
996500 -- (-347.067) (-346.993) (-347.243) [-348.642] * (-345.306) (-349.225) (-347.348) [-346.853] -- 0:00:00
997000 -- (-346.819) (-348.655) (-347.814) [-346.579] * (-345.765) [-355.349] (-345.960) (-348.593) -- 0:00:00
997500 -- (-346.558) [-349.200] (-351.277) (-346.224) * [-350.599] (-350.796) (-344.937) (-346.359) -- 0:00:00
998000 -- (-347.729) (-347.676) [-347.118] (-347.133) * (-346.205) (-346.765) (-346.542) [-346.430] -- 0:00:00
998500 -- (-347.856) (-349.445) [-346.615] (-350.263) * (-346.423) (-348.725) [-345.302] (-346.408) -- 0:00:00
999000 -- (-346.876) [-350.456] (-348.393) (-352.060) * (-347.673) [-347.369] (-347.073) (-349.646) -- 0:00:00
999500 -- [-349.666] (-345.178) (-345.457) (-347.112) * (-345.562) [-347.310] (-346.071) (-347.529) -- 0:00:00
1000000 -- (-347.555) [-345.952] (-347.366) (-345.678) * (-348.122) (-346.080) (-346.665) [-348.592] -- 0:00:00
Average standard deviation of split frequencies: 0.004623
Analysis completed in 59 seconds
Analysis used 57.61 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -344.60
Likelihood of best state for "cold" chain of run 2 was -344.60
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
43.1 % ( 29 %) Dirichlet(Pi{all})
41.0 % ( 31 %) Slider(Pi{all})
78.9 % ( 59 %) Multiplier(Alpha{1,2})
77.6 % ( 50 %) Multiplier(Alpha{3})
26.3 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.3 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 21 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.6 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 78 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
43.6 % ( 34 %) Dirichlet(Pi{all})
41.3 % ( 23 %) Slider(Pi{all})
78.7 % ( 54 %) Multiplier(Alpha{1,2})
77.9 % ( 49 %) Multiplier(Alpha{3})
26.4 % ( 21 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.9 % ( 34 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166586 0.82 0.67
3 | 166630 166586 0.84
4 | 166961 167122 166115
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167397 0.82 0.67
3 | 166756 166495 0.84
4 | 166839 166421 166092
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -346.33
| 2 |
| * 1 2 2 |
| 1 1 2 |
| 1 111 211 1 1 |
|1 2 2 21* 1 2 1 21 1 112 |
| 2 22 1 1 * 1 2 2 2 2 2 1 1 |
| 1 2 2 1 22 1 *2 2 1 2 1 2 2 2 |
| 2 1 1 1 12 1 1 |
|2 * 2 2 2 2 2* 1 1 2 1 2 * |
| 1 1 1 2 1 2 11 2 * 1 2 |
| 2 2 1 2|
| 2 1 1 2 2 1 1 |
| 1 2 1|
| 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -348.05
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -346.32 -349.49
2 -346.36 -349.80
--------------------------------------
TOTAL -346.34 -349.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897479 0.088455 0.322916 1.476304 0.865055 1501.00 1501.00 1.000
r(A<->C){all} 0.155206 0.018281 0.000001 0.428306 0.117143 171.98 214.24 1.000
r(A<->G){all} 0.162364 0.018576 0.000137 0.440965 0.127915 192.56 241.79 1.001
r(A<->T){all} 0.188523 0.022540 0.000056 0.480304 0.154707 190.36 204.89 1.000
r(C<->G){all} 0.162757 0.020194 0.000148 0.458450 0.123171 145.88 204.27 1.000
r(C<->T){all} 0.161280 0.019924 0.000004 0.441566 0.121679 214.27 226.58 1.000
r(G<->T){all} 0.169870 0.020750 0.000010 0.460272 0.131502 101.21 148.05 1.000
pi(A){all} 0.230901 0.000699 0.180236 0.284478 0.230378 1108.88 1236.37 1.000
pi(C){all} 0.244033 0.000710 0.191083 0.293866 0.243810 1250.20 1337.54 1.000
pi(G){all} 0.276403 0.000802 0.224465 0.333880 0.276252 1254.58 1349.90 1.000
pi(T){all} 0.248663 0.000734 0.195568 0.301169 0.247734 1176.48 1300.71 1.001
alpha{1,2} 0.398603 0.207545 0.000128 1.286648 0.239216 1076.08 1200.62 1.000
alpha{3} 0.444125 0.241762 0.000113 1.387533 0.281861 1135.03 1218.99 1.000
pinvar{all} 0.993415 0.000057 0.977955 1.000000 0.995973 1077.48 1289.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.*..
8 -- .****.
9 -- .**...
10 -- .*.***
11 -- .*..*.
12 -- .**.**
13 -- ...*.*
14 -- ..*.*.
15 -- .***.*
16 -- ..*..*
17 -- .*...*
18 -- ....**
19 -- ..**..
20 -- ...**.
21 -- ..****
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 473 0.157562 0.003298 0.155230 0.159893 2
8 461 0.153564 0.006124 0.149234 0.157895 2
9 450 0.149900 0.000942 0.149234 0.150566 2
10 445 0.148235 0.008009 0.142572 0.153897 2
11 443 0.147568 0.001413 0.146569 0.148568 2
12 442 0.147235 0.004711 0.143904 0.150566 2
13 442 0.147235 0.001884 0.145903 0.148568 2
14 436 0.145237 0.000942 0.144570 0.145903 2
15 434 0.144570 0.000942 0.143904 0.145237 2
16 428 0.142572 0.013191 0.133245 0.151899 2
17 422 0.140573 0.003769 0.137908 0.143238 2
18 418 0.139241 0.003769 0.136576 0.141905 2
19 412 0.137242 0.001884 0.135909 0.138574 2
20 393 0.130913 0.004240 0.127915 0.133911 2
21 376 0.125250 0.002827 0.123251 0.127249 2
22 270 0.089940 0.016017 0.078614 0.101266 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097887 0.009414 0.000026 0.293284 0.066817 1.000 2
length{all}[2] 0.101938 0.010092 0.000003 0.303266 0.071148 1.000 2
length{all}[3] 0.100468 0.009419 0.000085 0.298816 0.070563 1.000 2
length{all}[4] 0.099690 0.009987 0.000032 0.293910 0.070962 1.000 2
length{all}[5] 0.100604 0.009449 0.000004 0.290983 0.072642 1.000 2
length{all}[6] 0.094730 0.009421 0.000003 0.282891 0.063815 1.000 2
length{all}[7] 0.108921 0.011873 0.000412 0.313057 0.075200 0.998 2
length{all}[8] 0.095576 0.009528 0.000023 0.261602 0.068634 0.998 2
length{all}[9] 0.102057 0.010487 0.000251 0.286789 0.070723 1.005 2
length{all}[10] 0.100134 0.010261 0.000114 0.280415 0.067012 0.998 2
length{all}[11] 0.093823 0.008546 0.000224 0.285903 0.063323 1.004 2
length{all}[12] 0.096650 0.009533 0.000034 0.279013 0.066910 0.999 2
length{all}[13] 0.103100 0.009671 0.000025 0.290985 0.073069 0.999 2
length{all}[14] 0.099889 0.010114 0.000143 0.304634 0.070885 0.998 2
length{all}[15] 0.105117 0.011521 0.000025 0.305607 0.074482 1.003 2
length{all}[16] 0.107334 0.012715 0.000402 0.325495 0.072525 0.998 2
length{all}[17] 0.102093 0.010727 0.000342 0.293119 0.070456 1.008 2
length{all}[18] 0.099836 0.009406 0.000182 0.288178 0.066155 0.998 2
length{all}[19] 0.101495 0.009832 0.000799 0.301493 0.071473 0.998 2
length{all}[20] 0.099448 0.009533 0.000370 0.297387 0.070765 0.998 2
length{all}[21] 0.117069 0.013020 0.000846 0.347371 0.076615 0.997 2
length{all}[22] 0.098519 0.009369 0.000306 0.292491 0.067388 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004623
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 249
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 44 patterns at 83 / 83 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 44 patterns at 83 / 83 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
42944 bytes for conP
3872 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.016042 0.016269 0.082326 0.086333 0.088229 0.084016 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -360.118078
Iterating by ming2
Initial: fx= 360.118078
x= 0.01604 0.01627 0.08233 0.08633 0.08823 0.08402 0.30000 1.30000
1 h-m-p 0.0000 0.0002 198.8713 +++ 352.362665 m 0.0002 14 | 1/8
2 h-m-p 0.0017 0.0169 20.4327 ------------.. | 1/8
3 h-m-p 0.0000 0.0000 181.7779 ++ 352.271162 m 0.0000 46 | 2/8
4 h-m-p 0.0000 0.0199 17.5851 ---------.. | 2/8
5 h-m-p 0.0000 0.0008 162.1584 ++++ 330.655101 m 0.0008 77 | 3/8
6 h-m-p 0.0069 0.0347 12.1986 -------------.. | 3/8
7 h-m-p 0.0000 0.0000 142.2046 ++ 330.232123 m 0.0000 110 | 4/8
8 h-m-p 0.0003 0.1576 7.6809 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 116.1230 ++ 329.845333 m 0.0000 140 | 5/8
10 h-m-p 0.0005 0.2547 5.3999 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 82.1330 ++ 329.687020 m 0.0000 171 | 6/8
12 h-m-p 0.0776 8.0000 0.0000 ----Y 329.687020 0 0.0001 186 | 6/8
13 h-m-p 0.0443 8.0000 0.0000 -----C 329.687020 0 0.0000 204
Out..
lnL = -329.687020
205 lfun, 205 eigenQcodon, 1230 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048534 0.036894 0.039799 0.018509 0.099183 0.105744 0.299877 0.711780 0.417134
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.398200
np = 9
lnL0 = -357.584369
Iterating by ming2
Initial: fx= 357.584369
x= 0.04853 0.03689 0.03980 0.01851 0.09918 0.10574 0.29988 0.71178 0.41713
1 h-m-p 0.0000 0.0002 191.8011 +++ 348.896256 m 0.0002 15 | 1/9
2 h-m-p 0.0002 0.0008 116.6869 ++ 341.410489 m 0.0008 27 | 2/9
3 h-m-p 0.0000 0.0000 460.5983 ++ 340.541660 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0001 515.1909 ++ 338.457735 m 0.0001 51 | 4/9
5 h-m-p 0.0001 0.0003 425.4975 ++ 330.268437 m 0.0003 63 | 5/9
6 h-m-p 0.0000 0.0002 195.1033 ++ 329.687020 m 0.0002 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0000 ++ 329.687020 m 8.0000 87 | 6/9
8 h-m-p 0.0160 8.0000 0.0046 +++++ 329.687020 m 8.0000 105 | 6/9
9 h-m-p 0.0284 0.7675 1.2926 ---------N 329.687020 0 0.0000 129 | 6/9
10 h-m-p 0.0160 8.0000 0.0000 +++++ 329.687020 m 8.0000 144 | 6/9
11 h-m-p 0.0116 5.7910 0.0363 +++++ 329.687019 m 5.7910 162 | 7/9
12 h-m-p 0.1606 4.0516 1.1273 ---------------.. | 7/9
13 h-m-p 0.0160 8.0000 0.0000 -Y 329.687019 0 0.0010 203 | 7/9
14 h-m-p 0.0160 8.0000 0.0000 -Y 329.687019 0 0.0010 218
Out..
lnL = -329.687019
219 lfun, 657 eigenQcodon, 2628 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038245 0.056764 0.028746 0.092585 0.085589 0.095585 0.077083 1.693486 0.197771 0.477387 1.377381
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.464089
np = 11
lnL0 = -361.134899
Iterating by ming2
Initial: fx= 361.134899
x= 0.03824 0.05676 0.02875 0.09259 0.08559 0.09559 0.07708 1.69349 0.19777 0.47739 1.37738
1 h-m-p 0.0000 0.0004 187.6142 +++ 347.858199 m 0.0004 17 | 1/11
2 h-m-p 0.0001 0.0004 110.0253 ++ 343.932581 m 0.0004 31 | 2/11
3 h-m-p 0.0000 0.0001 481.9382 ++ 338.268959 m 0.0001 45 | 3/11
4 h-m-p 0.0001 0.0005 311.7613 ++ 331.053343 m 0.0005 59 | 4/11
5 h-m-p 0.0000 0.0002 359.7546 ++ 329.914667 m 0.0002 73 | 5/11
6 h-m-p 0.0001 0.0004 213.8152 ++ 329.687019 m 0.0004 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0000 ++ 329.687019 m 8.0000 101 | 6/11
8 h-m-p 0.4189 8.0000 0.0005 ------C 329.687019 0 0.0000 126
Out..
lnL = -329.687019
127 lfun, 508 eigenQcodon, 2286 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -329.693342 S = -329.685880 -0.002853
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:02
did 20 / 44 patterns 0:02
did 30 / 44 patterns 0:02
did 40 / 44 patterns 0:02
did 44 / 44 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.102933 0.014842 0.052780 0.088797 0.063666 0.069072 0.020318 0.503598 1.201110
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 20.595608
np = 9
lnL0 = -359.555798
Iterating by ming2
Initial: fx= 359.555798
x= 0.10293 0.01484 0.05278 0.08880 0.06367 0.06907 0.02032 0.50360 1.20111
1 h-m-p 0.0000 0.0002 174.1950 +++ 353.240894 m 0.0002 15 | 1/9
2 h-m-p 0.0002 0.0009 33.5989 ++ 352.409076 m 0.0009 27 | 2/9
3 h-m-p 0.0002 0.0012 83.3510 ++ 348.909072 m 0.0012 39 | 3/9
4 h-m-p 0.0011 0.0056 47.9129 ++ 336.996408 m 0.0056 51 | 4/9
5 h-m-p 0.0003 0.0016 89.3206 ++ 335.248445 m 0.0016 63 | 5/9
6 h-m-p 0.0001 0.0003 1398.9154 ++ 332.953511 m 0.0003 75 | 6/9
7 h-m-p 0.0004 0.0019 247.8981 ++ 329.687019 m 0.0019 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 -Y 329.687019 0 0.1000 100 | 7/9
9 h-m-p 0.7282 8.0000 0.0000 Y 329.687019 0 0.7282 114 | 7/9
10 h-m-p 0.0182 8.0000 0.0000 Y 329.687019 0 0.0046 128 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 ----------Y 329.687019 0 0.0000 152
Out..
lnL = -329.687019
153 lfun, 1683 eigenQcodon, 9180 P(t)
Time used: 0:04
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053816 0.035592 0.042722 0.091655 0.010228 0.080961 0.000100 0.900000 1.152036 1.173381 1.300016
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.479711
np = 11
lnL0 = -354.409347
Iterating by ming2
Initial: fx= 354.409347
x= 0.05382 0.03559 0.04272 0.09165 0.01023 0.08096 0.00011 0.90000 1.15204 1.17338 1.30002
1 h-m-p 0.0000 0.0000 184.6207 ++ 354.166794 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0037 43.6917 ++++ 348.480473 m 0.0037 32 | 2/11
3 h-m-p 0.0003 0.0014 65.2342 ++ 338.632770 m 0.0014 46 | 3/11
4 h-m-p 0.0009 0.0046 37.9559 ++ 336.376454 m 0.0046 60 | 4/11
5 h-m-p 0.0000 0.0001 749.6683 ++ 334.144483 m 0.0001 74 | 5/11
6 h-m-p 0.0001 0.0007 724.3797 ++ 330.370517 m 0.0007 88 | 6/11
7 h-m-p 0.0000 0.0000 10947.9555 ++ 329.687019 m 0.0000 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 329.687019 m 8.0000 116 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 +Y 329.687019 0 6.4000 135 | 7/11
10 h-m-p 0.0041 2.0734 0.3019 +++++ 329.687019 m 2.0734 156 | 8/11
11 h-m-p 0.2433 1.2167 1.4739 ++ 329.687019 m 1.2167 174 | 9/11
12 h-m-p 1.4574 8.0000 0.6476 --------C 329.687019 0 0.0000 196 | 9/11
13 h-m-p 1.6000 8.0000 0.0000 ++ 329.687019 m 8.0000 212 | 9/11
14 h-m-p 0.0160 8.0000 0.0171 +++++ 329.687019 m 8.0000 231 | 9/11
15 h-m-p 0.2677 2.6346 0.5106 ---------------.. | 9/11
16 h-m-p 0.0160 8.0000 0.0000 --N 329.687019 0 0.0003 278 | 9/11
17 h-m-p 0.0160 8.0000 0.0000 -----N 329.687019 0 0.0000 299
Out..
lnL = -329.687019
300 lfun, 3600 eigenQcodon, 19800 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -329.701130 S = -329.686302 -0.006513
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:10
did 20 / 44 patterns 0:10
did 30 / 44 patterns 0:10
did 40 / 44 patterns 0:10
did 44 / 44 patterns 0:10
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=83
NC_011896_1_WP_010907475_1_23_MLBR_RS00125 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
NC_002677_1_NP_301150_1_22_ML0024 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
**************************************************
NC_011896_1_WP_010907475_1_23_MLBR_RS00125 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
NC_002677_1_NP_301150_1_22_ML0024 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130 GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
*********************************
>NC_011896_1_WP_010907475_1_23_MLBR_RS00125 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA >NC_002677_1_NP_301150_1_22_ML0024 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA >NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA >NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA >NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA >NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130 GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>NC_011896_1_WP_010907475_1_23_MLBR_RS00125 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS >NC_002677_1_NP_301150_1_22_ML0024 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS >NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS >NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS >NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS >NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130 VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
#NEXUS
[ID: 0285644836]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907475_1_23_MLBR_RS00125
NC_002677_1_NP_301150_1_22_ML0024
NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085
NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815
NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130
NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907475_1_23_MLBR_RS00125,
2 NC_002677_1_NP_301150_1_22_ML0024,
3 NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085,
4 NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815,
5 NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130,
6 NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06681703,2:0.07114845,3:0.07056267,4:0.07096217,5:0.0726421,6:0.06381483);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06681703,2:0.07114845,3:0.07056267,4:0.07096217,5:0.0726421,6:0.06381483);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -346.32 -349.49
2 -346.36 -349.80
--------------------------------------
TOTAL -346.34 -349.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.897479 0.088455 0.322916 1.476304 0.865055 1501.00 1501.00 1.000
r(A<->C){all} 0.155206 0.018281 0.000001 0.428306 0.117143 171.98 214.24 1.000
r(A<->G){all} 0.162364 0.018576 0.000137 0.440965 0.127915 192.56 241.79 1.001
r(A<->T){all} 0.188523 0.022540 0.000056 0.480304 0.154707 190.36 204.89 1.000
r(C<->G){all} 0.162757 0.020194 0.000148 0.458450 0.123171 145.88 204.27 1.000
r(C<->T){all} 0.161280 0.019924 0.000004 0.441566 0.121679 214.27 226.58 1.000
r(G<->T){all} 0.169870 0.020750 0.000010 0.460272 0.131502 101.21 148.05 1.000
pi(A){all} 0.230901 0.000699 0.180236 0.284478 0.230378 1108.88 1236.37 1.000
pi(C){all} 0.244033 0.000710 0.191083 0.293866 0.243810 1250.20 1337.54 1.000
pi(G){all} 0.276403 0.000802 0.224465 0.333880 0.276252 1254.58 1349.90 1.000
pi(T){all} 0.248663 0.000734 0.195568 0.301169 0.247734 1176.48 1300.71 1.001
alpha{1,2} 0.398603 0.207545 0.000128 1.286648 0.239216 1076.08 1200.62 1.000
alpha{3} 0.444125 0.241762 0.000113 1.387533 0.281861 1135.03 1218.99 1.000
pinvar{all} 0.993415 0.000057 0.977955 1.000000 0.995973 1077.48 1289.24 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0024/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 83
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 1 1 1 1 1 1
TTC 3 3 3 3 3 3 | TCC 2 2 2 2 2 2 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 4 4 4 4 4 4 | CGC 0 0 0 0 0 0
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 1 1 1 1 1 1 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 0 0 0 0 0 0 | ACC 1 1 1 1 1 1 | AAC 1 1 1 1 1 1 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 0 0 0 0 0 0 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 4 4 4 4 4 4 | Asp GAT 7 7 7 7 7 7 | Gly GGT 3 3 3 3 3 3
GTC 3 3 3 3 3 3 | GCC 2 2 2 2 2 2 | GAC 2 2 2 2 2 2 | GGC 1 1 1 1 1 1
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 1 1 1 1 1 1 | GGA 2 2 2 2 2 2
GTG 3 3 3 3 3 3 | GCG 1 1 1 1 1 1 | GAG 2 2 2 2 2 2 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907475_1_23_MLBR_RS00125
position 1: T:0.18072 C:0.21687 A:0.15663 G:0.44578
position 2: T:0.22892 C:0.25301 A:0.34940 G:0.16867
position 3: T:0.33735 C:0.26506 A:0.18072 G:0.21687
Average T:0.24900 C:0.24498 A:0.22892 G:0.27711
#2: NC_002677_1_NP_301150_1_22_ML0024
position 1: T:0.18072 C:0.21687 A:0.15663 G:0.44578
position 2: T:0.22892 C:0.25301 A:0.34940 G:0.16867
position 3: T:0.33735 C:0.26506 A:0.18072 G:0.21687
Average T:0.24900 C:0.24498 A:0.22892 G:0.27711
#3: NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085
position 1: T:0.18072 C:0.21687 A:0.15663 G:0.44578
position 2: T:0.22892 C:0.25301 A:0.34940 G:0.16867
position 3: T:0.33735 C:0.26506 A:0.18072 G:0.21687
Average T:0.24900 C:0.24498 A:0.22892 G:0.27711
#4: NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815
position 1: T:0.18072 C:0.21687 A:0.15663 G:0.44578
position 2: T:0.22892 C:0.25301 A:0.34940 G:0.16867
position 3: T:0.33735 C:0.26506 A:0.18072 G:0.21687
Average T:0.24900 C:0.24498 A:0.22892 G:0.27711
#5: NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130
position 1: T:0.18072 C:0.21687 A:0.15663 G:0.44578
position 2: T:0.22892 C:0.25301 A:0.34940 G:0.16867
position 3: T:0.33735 C:0.26506 A:0.18072 G:0.21687
Average T:0.24900 C:0.24498 A:0.22892 G:0.27711
#6: NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130
position 1: T:0.18072 C:0.21687 A:0.15663 G:0.44578
position 2: T:0.22892 C:0.25301 A:0.34940 G:0.16867
position 3: T:0.33735 C:0.26506 A:0.18072 G:0.21687
Average T:0.24900 C:0.24498 A:0.22892 G:0.27711
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 6
TTC 18 | TCC 12 | TAC 18 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 12
CTC 0 | CCC 0 | CAC 24 | CGC 0
CTA 0 | CCA 6 | Gln Q CAA 12 | CGA 0
CTG 12 | CCG 6 | CAG 6 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 6
ATC 0 | ACC 6 | AAC 6 | AGC 0
ATA 6 | ACA 12 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 0 | ACG 0 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 24 | Asp D GAT 42 | Gly G GGT 18
GTC 18 | GCC 12 | GAC 12 | GGC 6
GTA 0 | GCA 18 | Glu E GAA 6 | GGA 12
GTG 18 | GCG 6 | GAG 12 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18072 C:0.21687 A:0.15663 G:0.44578
position 2: T:0.22892 C:0.25301 A:0.34940 G:0.16867
position 3: T:0.33735 C:0.26506 A:0.18072 G:0.21687
Average T:0.24900 C:0.24498 A:0.22892 G:0.27711
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -329.687020 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299877 1.300016
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907475_1_23_MLBR_RS00125: 0.000004, NC_002677_1_NP_301150_1_22_ML0024: 0.000004, NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085: 0.000004, NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815: 0.000004, NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130: 0.000004, NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29988
omega (dN/dS) = 1.30002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 197.5 51.5 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 197.5 51.5 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 197.5 51.5 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 197.5 51.5 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 197.5 51.5 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 197.5 51.5 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -329.687019 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.077083 0.708841 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907475_1_23_MLBR_RS00125: 0.000004, NC_002677_1_NP_301150_1_22_ML0024: 0.000004, NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085: 0.000004, NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815: 0.000004, NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130: 0.000004, NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.07708
MLEs of dN/dS (w) for site classes (K=2)
p: 0.70884 0.29116
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 202.3 46.7 0.2912 0.0000 0.0000 0.0 0.0
7..2 0.000 202.3 46.7 0.2912 0.0000 0.0000 0.0 0.0
7..3 0.000 202.3 46.7 0.2912 0.0000 0.0000 0.0 0.0
7..4 0.000 202.3 46.7 0.2912 0.0000 0.0000 0.0 0.0
7..5 0.000 202.3 46.7 0.2912 0.0000 0.0000 0.0 0.0
7..6 0.000 202.3 46.7 0.2912 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -329.687019 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.020318 0.708379 0.159541 0.097335 1.475509
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907475_1_23_MLBR_RS00125: 0.000004, NC_002677_1_NP_301150_1_22_ML0024: 0.000004, NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085: 0.000004, NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815: 0.000004, NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130: 0.000004, NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.02032
MLEs of dN/dS (w) for site classes (K=3)
p: 0.70838 0.15954 0.13208
w: 0.09733 1.00000 1.47551
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 203.7 45.3 0.4234 0.0000 0.0000 0.0 0.0
7..2 0.000 203.7 45.3 0.4234 0.0000 0.0000 0.0 0.0
7..3 0.000 203.7 45.3 0.4234 0.0000 0.0000 0.0 0.0
7..4 0.000 203.7 45.3 0.4234 0.0000 0.0000 0.0 0.0
7..5 0.000 203.7 45.3 0.4234 0.0000 0.0000 0.0 0.0
7..6 0.000 203.7 45.3 0.4234 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907475_1_23_MLBR_RS00125)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907475_1_23_MLBR_RS00125)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -329.687019 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.562017 1.103763
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907475_1_23_MLBR_RS00125: 0.000004, NC_002677_1_NP_301150_1_22_ML0024: 0.000004, NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085: 0.000004, NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815: 0.000004, NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130: 0.000004, NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.56202 q = 1.10376
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00431 0.03049 0.07589 0.13872 0.21823 0.31425 0.42715 0.55800 0.70923 0.88770
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 204.2 44.8 0.3364 0.0000 0.0000 0.0 0.0
7..2 0.000 204.2 44.8 0.3364 0.0000 0.0000 0.0 0.0
7..3 0.000 204.2 44.8 0.3364 0.0000 0.0000 0.0 0.0
7..4 0.000 204.2 44.8 0.3364 0.0000 0.0000 0.0 0.0
7..5 0.000 204.2 44.8 0.3364 0.0000 0.0000 0.0 0.0
7..6 0.000 204.2 44.8 0.3364 0.0000 0.0000 0.0 0.0
Time used: 0:04
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -329.687019 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.795830 0.005000 0.833083 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907475_1_23_MLBR_RS00125: 0.000004, NC_002677_1_NP_301150_1_22_ML0024: 0.000004, NZ_LVXE01000010_1_WP_010907475_1_288_A3216_RS05085: 0.000004, NZ_LYPH01000099_1_WP_010907475_1_2863_A8144_RS13815: 0.000004, NZ_CP029543_1_WP_010907475_1_23_DIJ64_RS00130: 0.000004, NZ_AP014567_1_WP_010907475_1_23_JK2ML_RS00130: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.79583 p = 0.00500 q = 0.83308
(p1 = 0.20417) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07958 0.07958 0.07958 0.07958 0.07958 0.07958 0.07958 0.07958 0.07958 0.07958 0.20417
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00005 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 204.2 44.8 0.2042 0.0000 0.0000 0.0 0.0
7..2 0.000 204.2 44.8 0.2042 0.0000 0.0000 0.0 0.0
7..3 0.000 204.2 44.8 0.2042 0.0000 0.0000 0.0 0.0
7..4 0.000 204.2 44.8 0.2042 0.0000 0.0000 0.0 0.0
7..5 0.000 204.2 44.8 0.2042 0.0000 0.0000 0.0 0.0
7..6 0.000 204.2 44.8 0.2042 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907475_1_23_MLBR_RS00125)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:10
Model 1: NearlyNeutral -329.687019 Model 2: PositiveSelection -329.687019 Model 0: one-ratio -329.68702 Model 7: beta -329.687019 Model 8: beta&w>1 -329.687019 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 0.0 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
