--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:16:31 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0024/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -346.32          -349.49
2       -346.36          -349.80
--------------------------------------
TOTAL     -346.34          -349.66
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.897479    0.088455    0.322916    1.476304    0.865055   1501.00   1501.00    1.000
r(A<->C){all}   0.155206    0.018281    0.000001    0.428306    0.117143    171.98    214.24    1.000
r(A<->G){all}   0.162364    0.018576    0.000137    0.440965    0.127915    192.56    241.79    1.001
r(A<->T){all}   0.188523    0.022540    0.000056    0.480304    0.154707    190.36    204.89    1.000
r(C<->G){all}   0.162757    0.020194    0.000148    0.458450    0.123171    145.88    204.27    1.000
r(C<->T){all}   0.161280    0.019924    0.000004    0.441566    0.121679    214.27    226.58    1.000
r(G<->T){all}   0.169870    0.020750    0.000010    0.460272    0.131502    101.21    148.05    1.000
pi(A){all}      0.230901    0.000699    0.180236    0.284478    0.230378   1108.88   1236.37    1.000
pi(C){all}      0.244033    0.000710    0.191083    0.293866    0.243810   1250.20   1337.54    1.000
pi(G){all}      0.276403    0.000802    0.224465    0.333880    0.276252   1254.58   1349.90    1.000
pi(T){all}      0.248663    0.000734    0.195568    0.301169    0.247734   1176.48   1300.71    1.001
alpha{1,2}      0.398603    0.207545    0.000128    1.286648    0.239216   1076.08   1200.62    1.000
alpha{3}        0.444125    0.241762    0.000113    1.387533    0.281861   1135.03   1218.99    1.000
pinvar{all}     0.993415    0.000057    0.977955    1.000000    0.995973   1077.48   1289.24    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-329.687019
Model 2: PositiveSelection	-329.687019
Model 0: one-ratio	-329.68702
Model 7: beta	-329.687019
Model 8: beta&w>1	-329.687019


Model 0 vs 1	1.9999999949504854E-6

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C2
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C3
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C4
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C5
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C6
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=83 

C1              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C2              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C3              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C4              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C5              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C6              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
                **************************************************

C1              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C2              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C3              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C4              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C5              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C6              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
                *********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   83 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   83 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2490]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2490]--->[2490]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.439 Mb, Max= 30.594 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C2              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C3              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C4              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C5              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
C6              VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
                **************************************************

C1              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C2              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C3              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C4              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C5              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
C6              GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
                *********************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
C2              GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
C3              GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
C4              GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
C5              GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
C6              GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
                **************************************************

C1              GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
C2              GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
C3              GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
C4              GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
C5              GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
C6              GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
                **************************************************

C1              CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
C2              CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
C3              CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
C4              CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
C5              CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
C6              CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
                **************************************************

C1              GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
C2              GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
C3              GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
C4              GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
C5              GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
C6              GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
                **************************************************

C1              CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
C2              CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
C3              CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
C4              CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
C5              CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
C6              CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
                *************************************************



>C1
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C2
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C3
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C4
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C5
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C6
GTGCCTTTCGATTACCACGTCGCCGCTGAACCACAATACTTTGCTGGACA
GCATGTTGTCTTGACTGCGGTGCACGATCACGATGGTGTCGATTCCCTGG
CAGATGCTTTCGACGACAAACCGGAGCTTGGGAATACACTGCAACACATA
GGGTCCAGTCGTGCCGCAATTCGGGGTGCAGGAGATGATTGTGGCCGTTT
CCGGAAAAAGTTTTTGGAGGCTACAGGTTACGTGAACACCAAGTCTTCA
>C1
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C2
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C3
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C4
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C5
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS
>C6
VPFDYHVAAEPQYFAGQHVVLTAVHDHDGVDSLADAFDDKPELGNTLQHI
GSSRAAIRGAGDDCGRFRKKFLEATGYVNTKSS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 249 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579788920
      Setting output file names to "/data/3res/ML0024/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 289162985
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0285644836
      Seed = 399988855
      Swapseed = 1579788920
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -557.273937 -- -24.965149
         Chain 2 -- -557.273852 -- -24.965149
         Chain 3 -- -557.273937 -- -24.965149
         Chain 4 -- -557.273937 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -557.273852 -- -24.965149
         Chain 2 -- -557.273937 -- -24.965149
         Chain 3 -- -557.273937 -- -24.965149
         Chain 4 -- -557.273852 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-557.274] (-557.274) (-557.274) (-557.274) * [-557.274] (-557.274) (-557.274) (-557.274) 
        500 -- (-363.268) [-352.392] (-357.709) (-356.882) * [-351.973] (-356.656) (-357.609) (-353.297) -- 0:33:19
       1000 -- (-354.683) (-358.038) (-356.239) [-353.360] * (-353.027) (-362.421) (-352.399) [-354.205] -- 0:16:39
       1500 -- (-354.837) (-352.191) [-358.508] (-359.237) * (-351.893) (-357.109) (-357.685) [-351.767] -- 0:11:05
       2000 -- [-356.859] (-359.242) (-353.022) (-356.467) * (-356.910) [-355.257] (-361.150) (-360.464) -- 0:08:19
       2500 -- (-354.216) (-357.886) (-357.567) [-356.538] * [-362.939] (-351.217) (-352.345) (-354.048) -- 0:06:39
       3000 -- [-360.945] (-363.214) (-359.904) (-360.059) * (-359.399) (-352.022) (-355.076) [-356.570] -- 0:05:32
       3500 -- (-355.499) [-356.052] (-355.220) (-355.354) * (-356.121) [-351.933] (-365.311) (-354.468) -- 0:04:44
       4000 -- (-363.285) [-351.969] (-354.731) (-354.569) * [-354.741] (-352.584) (-363.748) (-353.401) -- 0:04:09
       4500 -- (-350.185) (-351.380) [-354.255] (-359.139) * [-353.898] (-358.122) (-359.745) (-355.459) -- 0:03:41
       5000 -- (-358.721) (-357.753) (-357.708) [-356.975] * (-353.959) [-355.986] (-356.622) (-355.280) -- 0:03:19

      Average standard deviation of split frequencies: 0.075151

       5500 -- (-358.820) (-349.756) [-354.539] (-361.856) * (-364.489) [-356.743] (-359.923) (-355.984) -- 0:03:00
       6000 -- [-353.355] (-359.299) (-352.975) (-361.109) * (-359.012) (-356.567) [-357.772] (-363.308) -- 0:02:45
       6500 -- [-354.003] (-358.001) (-362.076) (-368.852) * (-356.140) (-356.059) (-360.909) [-353.323] -- 0:02:32
       7000 -- [-358.153] (-356.123) (-355.199) (-366.218) * (-357.972) (-355.497) (-349.197) [-360.023] -- 0:02:21
       7500 -- (-358.092) [-368.093] (-355.258) (-353.608) * [-358.261] (-352.670) (-354.940) (-363.663) -- 0:02:12
       8000 -- [-351.678] (-345.217) (-360.326) (-345.240) * [-355.819] (-355.985) (-360.613) (-361.418) -- 0:02:04
       8500 -- (-360.224) (-345.570) [-357.183] (-346.873) * (-360.408) (-354.949) [-353.069] (-371.528) -- 0:01:56
       9000 -- (-361.729) (-345.456) (-365.078) [-347.694] * (-365.923) (-357.219) [-356.705] (-358.752) -- 0:01:50
       9500 -- (-355.222) (-345.104) [-357.485] (-348.829) * (-354.280) [-353.798] (-356.732) (-346.233) -- 0:01:44
      10000 -- (-361.719) (-345.584) (-368.991) [-345.082] * (-366.055) [-356.547] (-353.699) (-350.176) -- 0:01:39

      Average standard deviation of split frequencies: 0.055824

      10500 -- (-357.091) (-348.807) (-358.630) [-347.693] * (-352.705) (-358.526) (-352.175) [-345.956] -- 0:01:34
      11000 -- (-363.339) [-345.918] (-349.292) (-345.713) * (-361.765) (-351.488) [-353.741] (-347.926) -- 0:01:29
      11500 -- (-370.583) (-347.322) [-345.876] (-345.303) * (-367.474) [-352.174] (-355.243) (-350.448) -- 0:01:25
      12000 -- (-352.756) (-348.117) [-346.050] (-348.029) * (-346.804) [-351.978] (-352.631) (-345.645) -- 0:01:22
      12500 -- (-347.396) (-345.541) (-347.661) [-345.837] * (-345.681) [-358.105] (-353.328) (-347.116) -- 0:01:19
      13000 -- (-349.494) (-347.691) [-346.133] (-346.545) * (-347.145) [-351.923] (-349.622) (-346.741) -- 0:01:15
      13500 -- (-349.202) (-347.981) (-345.973) [-347.216] * (-346.645) (-360.505) (-362.577) [-346.207] -- 0:01:13
      14000 -- (-346.253) (-345.745) (-345.567) [-345.218] * (-346.530) (-357.048) (-356.528) [-348.374] -- 0:02:20
      14500 -- (-346.327) (-346.259) (-347.429) [-348.131] * (-344.945) [-351.554] (-355.121) (-347.920) -- 0:02:15
      15000 -- (-345.656) (-346.165) (-348.251) [-346.544] * (-345.198) (-364.379) (-363.244) [-346.701] -- 0:02:11

      Average standard deviation of split frequencies: 0.046520

      15500 -- [-345.117] (-348.202) (-345.636) (-346.338) * (-349.500) (-354.899) [-355.437] (-345.806) -- 0:02:07
      16000 -- (-352.602) (-345.345) [-345.515] (-345.251) * (-346.638) (-357.743) [-352.051] (-349.412) -- 0:02:03
      16500 -- (-347.162) (-351.308) [-345.452] (-344.876) * [-345.677] (-359.650) (-355.960) (-347.110) -- 0:01:59
      17000 -- [-349.590] (-348.646) (-347.912) (-350.515) * (-348.506) [-358.762] (-355.969) (-345.525) -- 0:01:55
      17500 -- (-348.745) (-347.469) [-347.577] (-348.625) * (-348.435) (-355.225) (-356.205) [-349.112] -- 0:01:52
      18000 -- (-346.822) (-345.113) (-351.570) [-347.537] * (-345.855) (-362.114) [-348.892] (-349.400) -- 0:01:49
      18500 -- (-345.918) (-344.968) [-345.470] (-346.355) * (-345.385) [-354.550] (-357.704) (-347.285) -- 0:01:46
      19000 -- (-350.305) (-344.874) (-348.064) [-346.384] * (-345.182) [-358.957] (-355.455) (-346.305) -- 0:01:43
      19500 -- (-348.784) (-345.429) [-349.139] (-347.638) * (-348.889) [-352.125] (-360.188) (-347.183) -- 0:01:40
      20000 -- (-349.727) (-350.617) [-349.545] (-345.911) * (-346.386) (-361.302) [-352.659] (-347.767) -- 0:01:38

      Average standard deviation of split frequencies: 0.062727

      20500 -- (-348.430) (-350.084) (-348.335) [-347.657] * (-348.106) (-378.533) [-351.575] (-346.887) -- 0:01:35
      21000 -- (-349.905) [-345.848] (-346.676) (-350.924) * (-345.326) (-370.939) (-360.850) [-347.496] -- 0:01:33
      21500 -- (-346.623) [-346.510] (-350.473) (-346.174) * [-346.889] (-360.838) (-370.581) (-345.902) -- 0:01:31
      22000 -- [-349.861] (-348.055) (-345.872) (-345.622) * (-351.260) (-356.538) (-358.757) [-349.055] -- 0:01:28
      22500 -- (-346.663) [-347.777] (-350.829) (-346.272) * (-349.056) (-353.873) [-352.567] (-346.687) -- 0:01:26
      23000 -- (-347.078) [-344.741] (-347.302) (-349.847) * [-347.357] (-348.068) (-369.894) (-348.261) -- 0:01:24
      23500 -- [-345.214] (-347.562) (-346.360) (-347.124) * [-346.881] (-345.928) (-365.171) (-346.468) -- 0:01:23
      24000 -- (-346.489) (-347.603) [-347.882] (-349.956) * (-345.854) [-347.743] (-354.167) (-348.499) -- 0:01:21
      24500 -- [-347.483] (-346.235) (-348.804) (-350.057) * (-345.848) [-347.522] (-347.600) (-347.218) -- 0:01:19
      25000 -- (-345.742) (-352.723) [-346.775] (-349.514) * (-347.088) (-346.137) [-347.629] (-348.133) -- 0:01:18

      Average standard deviation of split frequencies: 0.050576

      25500 -- (-345.420) (-346.943) (-351.774) [-346.129] * (-347.277) [-346.281] (-344.963) (-346.524) -- 0:01:16
      26000 -- (-345.247) (-346.344) [-345.924] (-346.714) * (-349.621) (-348.134) [-347.733] (-345.712) -- 0:01:14
      26500 -- [-349.021] (-347.098) (-345.273) (-345.615) * (-347.677) (-348.653) (-346.754) [-345.895] -- 0:01:13
      27000 -- (-347.610) [-345.735] (-344.926) (-346.706) * (-348.900) (-351.670) [-345.368] (-345.765) -- 0:01:12
      27500 -- (-345.920) (-347.606) (-347.849) [-349.028] * (-346.760) (-353.530) (-351.042) [-346.748] -- 0:01:10
      28000 -- (-348.285) [-346.495] (-345.343) (-344.825) * (-346.376) [-348.101] (-349.507) (-345.875) -- 0:01:09
      28500 -- (-345.941) [-347.622] (-345.138) (-345.741) * [-347.123] (-347.720) (-346.588) (-346.894) -- 0:01:08
      29000 -- [-346.490] (-347.903) (-347.030) (-347.812) * (-348.558) (-348.400) (-347.940) [-347.015] -- 0:01:40
      29500 -- (-350.019) (-346.899) [-346.227] (-348.918) * (-349.515) (-347.949) [-345.311] (-345.090) -- 0:01:38
      30000 -- (-350.884) (-346.263) [-348.256] (-350.652) * (-347.032) [-345.784] (-348.507) (-347.017) -- 0:01:37

      Average standard deviation of split frequencies: 0.040735

      30500 -- (-348.181) (-345.367) (-348.649) [-353.233] * (-351.074) (-348.397) (-347.839) [-349.364] -- 0:01:35
      31000 -- (-345.265) (-346.685) [-346.935] (-348.236) * (-348.951) [-345.289] (-345.961) (-349.685) -- 0:01:33
      31500 -- [-345.773] (-346.937) (-349.931) (-348.343) * (-345.391) (-345.227) [-347.326] (-349.571) -- 0:01:32
      32000 -- (-346.237) [-347.420] (-348.996) (-349.974) * (-345.264) [-345.237] (-348.972) (-345.067) -- 0:01:30
      32500 -- (-345.175) (-350.597) [-346.062] (-348.277) * (-348.310) (-345.380) [-345.891] (-345.946) -- 0:01:29
      33000 -- [-345.468] (-347.947) (-346.066) (-347.063) * (-348.277) (-345.355) [-348.227] (-349.057) -- 0:01:27
      33500 -- (-346.278) (-345.683) (-346.920) [-346.604] * [-345.827] (-345.824) (-349.576) (-346.486) -- 0:01:26
      34000 -- [-348.241] (-347.938) (-350.098) (-344.709) * (-348.993) (-351.225) [-348.933] (-345.709) -- 0:01:25
      34500 -- (-345.972) (-348.206) (-346.809) [-346.943] * (-345.721) (-349.957) (-348.599) [-349.808] -- 0:01:23
      35000 -- (-347.523) (-348.520) (-347.174) [-344.903] * [-344.787] (-349.821) (-347.133) (-347.511) -- 0:01:22

      Average standard deviation of split frequencies: 0.028808

      35500 -- (-347.983) [-350.114] (-345.186) (-345.107) * (-345.409) (-348.872) (-348.762) [-345.349] -- 0:01:21
      36000 -- (-346.172) (-353.142) [-345.766] (-345.924) * (-344.782) (-349.675) [-346.986] (-345.583) -- 0:01:20
      36500 -- (-349.661) [-347.435] (-350.913) (-347.204) * (-344.995) (-345.695) (-346.938) [-350.203] -- 0:01:19
      37000 -- [-347.413] (-348.871) (-346.875) (-352.417) * (-346.892) (-346.637) [-346.616] (-346.748) -- 0:01:18
      37500 -- (-345.349) [-349.093] (-351.050) (-357.392) * (-347.177) (-348.828) [-347.267] (-349.762) -- 0:01:17
      38000 -- (-351.100) [-349.653] (-350.769) (-346.844) * (-348.092) (-347.439) (-348.369) [-353.010] -- 0:01:15
      38500 -- [-351.494] (-350.164) (-345.412) (-346.674) * (-345.536) (-347.198) [-348.057] (-348.104) -- 0:01:14
      39000 -- (-349.356) [-346.701] (-345.913) (-347.895) * [-347.517] (-347.640) (-345.478) (-347.381) -- 0:01:13
      39500 -- (-347.953) (-347.593) (-347.414) [-345.971] * (-347.710) (-345.603) [-346.797] (-344.942) -- 0:01:12
      40000 -- [-345.627] (-345.470) (-346.199) (-349.512) * (-346.225) [-345.210] (-348.052) (-346.442) -- 0:01:12

      Average standard deviation of split frequencies: 0.027455

      40500 -- (-348.034) [-347.315] (-347.662) (-345.803) * (-347.102) [-346.172] (-349.159) (-347.152) -- 0:01:11
      41000 -- (-346.544) [-346.460] (-347.095) (-345.770) * (-346.852) (-344.915) [-348.786] (-345.344) -- 0:01:10
      41500 -- (-347.860) [-345.701] (-345.551) (-349.416) * (-344.701) [-348.974] (-346.922) (-345.380) -- 0:01:09
      42000 -- (-346.056) (-346.704) [-345.993] (-345.783) * [-347.780] (-348.839) (-349.732) (-345.973) -- 0:01:08
      42500 -- (-347.059) (-347.852) [-348.311] (-345.743) * [-345.772] (-349.642) (-347.589) (-346.284) -- 0:01:07
      43000 -- (-346.332) (-346.652) [-346.858] (-347.690) * [-347.910] (-348.481) (-345.758) (-346.860) -- 0:01:06
      43500 -- [-346.216] (-346.825) (-347.526) (-346.288) * (-347.494) [-346.318] (-346.035) (-346.339) -- 0:01:05
      44000 -- (-346.441) (-346.996) (-349.547) [-349.979] * (-346.872) (-346.862) (-349.736) [-346.388] -- 0:01:05
      44500 -- (-346.558) [-345.604] (-346.147) (-346.237) * [-346.067] (-346.111) (-349.619) (-346.227) -- 0:01:25
      45000 -- (-348.100) (-346.920) [-345.713] (-346.949) * [-346.153] (-346.455) (-349.118) (-347.268) -- 0:01:24

      Average standard deviation of split frequencies: 0.028070

      45500 -- (-345.009) (-349.988) (-346.992) [-347.703] * (-346.891) (-345.766) (-346.965) [-345.378] -- 0:01:23
      46000 -- (-345.754) (-349.117) [-346.115] (-349.723) * (-348.381) (-345.893) (-347.791) [-347.435] -- 0:01:22
      46500 -- [-345.103] (-347.620) (-349.125) (-349.810) * (-346.653) (-347.877) (-351.093) [-347.745] -- 0:01:22
      47000 -- (-345.993) [-345.831] (-345.996) (-348.776) * (-349.440) [-347.333] (-348.377) (-346.217) -- 0:01:21
      47500 -- (-347.476) [-344.965] (-347.893) (-346.997) * [-346.559] (-349.789) (-346.475) (-353.541) -- 0:01:20
      48000 -- [-349.579] (-346.378) (-347.427) (-347.773) * (-346.935) (-345.135) (-346.385) [-346.578] -- 0:01:19
      48500 -- [-347.005] (-349.723) (-347.682) (-348.287) * [-345.021] (-347.267) (-348.270) (-345.275) -- 0:01:18
      49000 -- (-349.583) [-348.006] (-345.399) (-346.154) * (-346.079) [-349.547] (-350.313) (-346.406) -- 0:01:17
      49500 -- (-346.189) (-348.879) (-345.007) [-347.507] * [-345.795] (-348.855) (-346.295) (-347.378) -- 0:01:16
      50000 -- [-347.353] (-347.653) (-350.110) (-347.390) * (-347.676) (-348.295) (-345.554) [-345.416] -- 0:01:16

      Average standard deviation of split frequencies: 0.026140

      50500 -- (-351.760) [-351.208] (-349.901) (-346.700) * (-355.105) [-345.723] (-345.602) (-346.509) -- 0:01:15
      51000 -- (-347.032) (-348.733) [-347.321] (-346.266) * (-348.905) (-345.459) [-347.299] (-347.442) -- 0:01:14
      51500 -- [-345.466] (-347.719) (-346.334) (-347.573) * (-347.852) (-344.953) [-349.349] (-346.211) -- 0:01:13
      52000 -- (-347.898) (-347.051) [-347.087] (-349.844) * (-348.364) (-349.382) (-350.665) [-348.674] -- 0:01:12
      52500 -- (-349.001) (-349.781) (-349.923) [-347.350] * (-346.030) (-348.548) (-350.613) [-350.812] -- 0:01:12
      53000 -- [-346.141] (-345.512) (-349.562) (-347.196) * (-347.408) (-345.682) (-349.315) [-346.634] -- 0:01:11
      53500 -- (-349.366) (-351.887) (-348.042) [-347.331] * (-350.166) (-346.915) [-346.353] (-345.572) -- 0:01:10
      54000 -- (-348.702) (-349.287) [-345.654] (-352.767) * (-353.150) (-351.341) [-346.204] (-348.019) -- 0:01:10
      54500 -- (-349.517) (-350.138) (-349.154) [-351.048] * (-351.912) (-346.984) (-346.113) [-347.956] -- 0:01:09
      55000 -- (-349.761) (-347.086) (-350.472) [-347.810] * (-346.836) [-347.296] (-348.423) (-349.530) -- 0:01:08

      Average standard deviation of split frequencies: 0.027469

      55500 -- [-346.981] (-349.218) (-350.843) (-346.330) * (-346.664) (-346.242) (-347.147) [-347.845] -- 0:01:08
      56000 -- (-345.481) (-350.813) [-345.235] (-347.194) * (-354.136) (-344.841) (-346.810) [-348.931] -- 0:01:07
      56500 -- (-347.775) (-345.366) [-346.915] (-349.502) * (-350.662) (-347.650) [-349.463] (-349.772) -- 0:01:06
      57000 -- (-347.436) (-347.922) (-346.453) [-350.043] * (-349.377) (-348.001) [-346.343] (-346.307) -- 0:01:06
      57500 -- (-347.723) [-346.651] (-347.055) (-345.818) * (-347.734) (-350.925) [-346.879] (-344.969) -- 0:01:05
      58000 -- (-346.085) (-345.949) (-346.913) [-348.914] * [-346.325] (-346.263) (-347.083) (-346.122) -- 0:01:04
      58500 -- (-346.141) [-346.627] (-350.640) (-345.450) * (-352.287) (-345.180) (-345.188) [-345.549] -- 0:01:04
      59000 -- (-347.489) (-345.787) (-351.377) [-347.013] * (-345.315) (-345.670) [-346.033] (-345.685) -- 0:01:03
      59500 -- (-346.303) (-348.356) [-346.698] (-346.126) * (-345.365) (-345.698) [-346.103] (-349.547) -- 0:01:03
      60000 -- (-345.279) (-346.555) (-348.596) [-347.099] * [-348.570] (-351.683) (-346.793) (-346.631) -- 0:01:18

      Average standard deviation of split frequencies: 0.024947

      60500 -- (-346.398) [-346.008] (-346.559) (-348.948) * (-349.589) (-344.735) [-346.898] (-345.508) -- 0:01:17
      61000 -- (-348.902) (-346.186) (-346.183) [-347.367] * (-346.786) (-345.554) [-348.407] (-348.109) -- 0:01:16
      61500 -- (-347.654) (-347.953) (-346.768) [-346.842] * (-346.672) (-346.776) (-347.774) [-346.206] -- 0:01:16
      62000 -- (-348.970) (-345.641) (-348.758) [-347.123] * [-346.067] (-347.829) (-348.273) (-346.866) -- 0:01:15
      62500 -- [-348.500] (-345.765) (-350.689) (-347.399) * (-347.220) (-347.540) (-348.050) [-348.465] -- 0:01:15
      63000 -- (-346.628) (-345.424) (-351.590) [-347.649] * [-345.291] (-345.558) (-345.845) (-347.348) -- 0:01:14
      63500 -- (-346.702) (-348.715) (-349.936) [-347.324] * (-345.895) (-347.281) [-346.796] (-347.938) -- 0:01:13
      64000 -- [-344.808] (-349.229) (-347.138) (-345.727) * [-346.319] (-347.129) (-347.182) (-351.322) -- 0:01:13
      64500 -- (-345.286) (-348.850) [-346.955] (-345.181) * (-348.411) (-347.987) (-346.509) [-345.310] -- 0:01:12
      65000 -- [-347.656] (-350.096) (-349.164) (-350.783) * [-345.565] (-345.785) (-347.123) (-349.244) -- 0:01:11

      Average standard deviation of split frequencies: 0.020713

      65500 -- [-347.575] (-350.785) (-347.920) (-349.633) * (-345.609) (-345.983) [-347.252] (-351.614) -- 0:01:11
      66000 -- (-345.823) (-346.848) (-350.326) [-348.318] * (-348.440) (-345.899) [-346.331] (-347.379) -- 0:01:10
      66500 -- [-345.271] (-346.132) (-345.523) (-348.858) * (-350.925) (-344.901) [-347.047] (-349.969) -- 0:01:10
      67000 -- [-345.272] (-347.297) (-350.612) (-345.601) * (-349.020) (-346.667) (-348.434) [-346.046] -- 0:01:09
      67500 -- (-345.313) (-345.466) [-346.434] (-346.442) * (-354.525) (-345.336) [-345.212] (-347.940) -- 0:01:09
      68000 -- (-349.573) (-346.279) [-346.985] (-345.552) * (-349.628) (-346.438) [-346.827] (-347.989) -- 0:01:08
      68500 -- [-345.881] (-345.984) (-347.854) (-344.953) * (-346.827) (-345.887) (-347.833) [-345.358] -- 0:01:07
      69000 -- (-346.289) (-348.001) [-346.420] (-349.281) * (-347.201) (-345.538) [-349.271] (-351.036) -- 0:01:07
      69500 -- (-346.164) (-347.883) [-344.792] (-347.683) * (-351.139) [-346.211] (-348.164) (-352.850) -- 0:01:06
      70000 -- [-346.939] (-346.241) (-346.764) (-348.509) * (-347.746) (-345.872) [-346.276] (-345.339) -- 0:01:06

      Average standard deviation of split frequencies: 0.023681

      70500 -- (-345.783) [-346.242] (-346.046) (-348.108) * (-348.176) (-346.676) [-347.849] (-347.953) -- 0:01:05
      71000 -- (-346.581) (-346.904) (-346.739) [-347.059] * (-347.229) (-345.867) (-347.856) [-346.009] -- 0:01:05
      71500 -- (-345.181) [-345.768] (-346.983) (-346.831) * (-345.915) (-349.313) (-352.808) [-346.464] -- 0:01:04
      72000 -- (-345.039) (-347.743) (-346.744) [-344.809] * (-346.011) (-347.416) (-351.973) [-345.673] -- 0:01:04
      72500 -- [-347.359] (-351.476) (-346.508) (-346.041) * [-345.848] (-346.160) (-346.206) (-345.701) -- 0:01:03
      73000 -- (-345.169) (-349.492) (-348.255) [-348.425] * (-345.880) [-349.940] (-351.072) (-348.117) -- 0:01:03
      73500 -- (-354.463) (-349.596) [-349.589] (-347.839) * (-347.245) (-350.180) (-351.797) [-348.077] -- 0:01:03
      74000 -- (-345.546) (-352.760) (-348.790) [-346.040] * [-346.373] (-347.789) (-345.509) (-348.776) -- 0:01:02
      74500 -- [-345.739] (-349.075) (-349.057) (-346.128) * [-349.264] (-346.546) (-346.981) (-349.663) -- 0:01:02
      75000 -- (-349.299) [-345.743] (-346.557) (-347.834) * (-348.705) [-346.921] (-344.777) (-348.432) -- 0:01:01

      Average standard deviation of split frequencies: 0.025992

      75500 -- (-346.797) [-345.496] (-351.797) (-346.482) * [-347.247] (-347.133) (-345.734) (-346.665) -- 0:01:01
      76000 -- (-346.984) (-344.702) [-346.236] (-345.313) * [-346.671] (-345.966) (-346.844) (-347.608) -- 0:01:00
      76500 -- (-352.211) (-345.518) [-346.114] (-345.772) * (-347.600) [-350.189] (-346.823) (-348.401) -- 0:01:12
      77000 -- (-348.015) [-345.756] (-347.044) (-347.399) * (-347.696) (-346.339) (-348.021) [-348.034] -- 0:01:11
      77500 -- (-346.469) (-347.478) [-345.847] (-347.741) * (-350.057) (-345.847) (-347.129) [-345.974] -- 0:01:11
      78000 -- (-345.149) (-348.031) [-346.049] (-346.457) * (-348.235) (-347.494) [-346.190] (-345.736) -- 0:01:10
      78500 -- [-346.206] (-347.359) (-348.415) (-346.537) * (-348.004) [-346.465] (-347.131) (-346.884) -- 0:01:10
      79000 -- (-344.777) [-346.569] (-349.413) (-346.493) * (-348.727) (-347.262) [-346.878] (-347.122) -- 0:01:09
      79500 -- (-345.892) (-347.119) [-347.184] (-345.558) * (-348.386) (-346.960) (-345.162) [-348.164] -- 0:01:09
      80000 -- (-348.331) (-346.466) (-347.259) [-346.279] * (-351.659) (-346.823) (-348.759) [-346.590] -- 0:01:09

      Average standard deviation of split frequencies: 0.030388

      80500 -- (-346.284) (-350.262) (-350.022) [-350.803] * (-347.336) (-349.923) (-346.338) [-346.360] -- 0:01:08
      81000 -- (-347.440) (-347.767) [-345.866] (-347.226) * (-346.439) [-347.620] (-350.534) (-347.331) -- 0:01:08
      81500 -- (-349.077) (-346.830) (-346.410) [-349.192] * (-349.774) [-346.425] (-347.365) (-347.823) -- 0:01:07
      82000 -- (-346.175) (-347.041) [-345.575] (-345.934) * (-353.249) (-347.686) (-348.251) [-347.597] -- 0:01:07
      82500 -- [-345.483] (-345.609) (-346.349) (-345.561) * (-348.060) (-349.720) [-345.387] (-347.939) -- 0:01:06
      83000 -- (-348.148) (-346.612) (-347.767) [-347.073] * (-347.636) [-346.240] (-346.917) (-347.915) -- 0:01:06
      83500 -- (-347.887) (-349.266) (-351.130) [-345.561] * (-347.854) [-346.373] (-349.340) (-345.435) -- 0:01:05
      84000 -- [-346.517] (-346.082) (-346.258) (-345.907) * [-346.295] (-345.928) (-346.463) (-346.728) -- 0:01:05
      84500 -- [-345.909] (-346.348) (-347.409) (-345.674) * [-346.351] (-346.301) (-346.793) (-345.207) -- 0:01:05
      85000 -- (-345.043) (-350.892) (-346.264) [-345.847] * (-346.157) [-351.825] (-346.255) (-345.474) -- 0:01:04

      Average standard deviation of split frequencies: 0.024667

      85500 -- [-346.093] (-349.170) (-348.831) (-348.518) * [-347.694] (-345.456) (-346.514) (-347.872) -- 0:01:04
      86000 -- (-347.563) [-346.244] (-346.633) (-346.288) * (-345.699) (-346.232) [-348.972] (-346.291) -- 0:01:03
      86500 -- (-347.232) (-347.776) (-345.216) [-347.533] * (-346.561) [-347.135] (-347.451) (-346.445) -- 0:01:03
      87000 -- (-347.834) (-348.564) (-345.201) [-347.588] * (-349.948) [-345.710] (-345.251) (-352.496) -- 0:01:02
      87500 -- (-347.377) (-348.816) [-350.955] (-346.271) * [-350.097] (-346.790) (-347.049) (-347.831) -- 0:01:02
      88000 -- (-345.980) (-347.957) [-346.882] (-348.213) * (-346.866) (-348.784) [-347.304] (-346.511) -- 0:01:02
      88500 -- (-346.391) [-348.108] (-346.591) (-350.466) * (-345.964) (-352.802) [-357.629] (-349.909) -- 0:01:01
      89000 -- (-346.051) [-348.202] (-345.509) (-346.691) * (-351.988) (-345.230) (-348.580) [-346.860] -- 0:01:01
      89500 -- (-346.428) (-346.014) [-345.711] (-346.462) * (-348.132) (-346.268) [-348.376] (-350.897) -- 0:01:01
      90000 -- [-345.086] (-347.388) (-346.086) (-345.781) * (-349.096) (-348.627) [-350.183] (-347.321) -- 0:01:00

      Average standard deviation of split frequencies: 0.028186

      90500 -- [-345.555] (-349.270) (-345.850) (-345.315) * (-346.647) (-346.953) (-349.055) [-345.866] -- 0:01:00
      91000 -- (-348.246) (-349.251) (-348.138) [-345.360] * [-347.195] (-348.060) (-345.664) (-345.357) -- 0:00:59
      91500 -- (-347.764) (-348.555) [-346.191] (-347.314) * (-346.605) [-346.032] (-347.178) (-345.214) -- 0:00:59
      92000 -- (-346.642) (-346.349) [-347.410] (-346.298) * [-345.415] (-350.527) (-348.683) (-348.947) -- 0:00:59
      92500 -- [-346.430] (-348.627) (-346.443) (-345.640) * [-345.807] (-354.942) (-345.559) (-355.505) -- 0:00:58
      93000 -- [-345.607] (-346.655) (-347.840) (-345.149) * (-346.548) [-352.911] (-345.979) (-354.920) -- 0:00:58
      93500 -- (-346.679) (-346.410) (-346.639) [-347.511] * [-346.233] (-346.057) (-346.227) (-349.352) -- 0:01:07
      94000 -- [-347.321] (-346.089) (-346.432) (-347.219) * (-345.560) (-346.734) [-345.925] (-346.876) -- 0:01:07
      94500 -- [-346.192] (-350.298) (-345.061) (-349.077) * (-346.590) [-345.812] (-345.784) (-345.726) -- 0:01:07
      95000 -- (-345.052) [-349.580] (-348.062) (-349.413) * (-345.585) (-348.048) (-345.549) [-345.722] -- 0:01:06

      Average standard deviation of split frequencies: 0.026025

      95500 -- [-348.220] (-345.866) (-346.575) (-345.367) * (-353.691) (-350.117) [-347.183] (-345.829) -- 0:01:06
      96000 -- [-347.623] (-345.833) (-346.549) (-347.412) * (-351.918) [-347.787] (-347.306) (-347.485) -- 0:01:05
      96500 -- (-345.135) [-345.541] (-347.220) (-347.656) * (-351.471) (-345.728) (-346.065) [-346.555] -- 0:01:05
      97000 -- (-346.291) (-349.703) [-345.805] (-351.253) * (-353.460) [-346.562] (-347.600) (-345.476) -- 0:01:05
      97500 -- (-345.511) (-345.081) [-349.620] (-346.587) * (-347.514) (-350.057) (-348.072) [-346.089] -- 0:01:04
      98000 -- (-346.329) (-345.665) [-349.071] (-347.901) * (-346.855) [-346.059] (-346.048) (-347.817) -- 0:01:04
      98500 -- [-345.375] (-345.718) (-346.286) (-347.039) * (-345.284) (-347.966) [-345.501] (-347.977) -- 0:01:04
      99000 -- (-346.462) [-345.938] (-349.278) (-350.724) * (-345.788) (-354.315) [-345.328] (-348.181) -- 0:01:03
      99500 -- (-346.129) (-349.081) (-347.990) [-345.326] * (-350.559) (-347.224) (-348.649) [-346.339] -- 0:01:03
      100000 -- [-347.675] (-347.038) (-345.101) (-349.996) * (-347.237) (-350.313) (-347.031) [-346.599] -- 0:01:02

      Average standard deviation of split frequencies: 0.025198

      100500 -- (-346.592) (-346.986) (-348.121) [-348.779] * (-347.720) (-353.291) (-346.934) [-346.717] -- 0:01:02
      101000 -- [-345.842] (-344.878) (-347.899) (-350.394) * (-347.657) (-351.243) [-346.759] (-345.508) -- 0:01:02
      101500 -- [-349.983] (-344.800) (-347.260) (-351.323) * (-348.498) (-347.053) (-349.719) [-346.374] -- 0:01:01
      102000 -- (-345.881) (-345.726) (-347.283) [-345.739] * (-349.858) (-346.658) (-354.057) [-351.243] -- 0:01:01
      102500 -- (-347.046) (-347.901) (-348.476) [-349.568] * (-349.086) (-347.357) (-347.480) [-348.185] -- 0:01:01
      103000 -- (-345.407) (-348.540) [-347.767] (-349.590) * (-347.219) (-345.288) (-348.222) [-348.439] -- 0:01:00
      103500 -- [-346.002] (-346.678) (-346.496) (-346.266) * (-348.821) (-346.267) (-350.196) [-347.114] -- 0:01:00
      104000 -- [-346.198] (-347.094) (-352.371) (-346.514) * (-345.563) (-353.275) [-349.227] (-352.874) -- 0:01:00
      104500 -- (-350.393) (-345.756) [-351.127] (-346.108) * (-352.648) (-345.687) (-353.827) [-345.962] -- 0:00:59
      105000 -- (-346.282) [-348.968] (-347.897) (-347.199) * (-349.825) (-349.573) [-347.575] (-351.385) -- 0:00:59

      Average standard deviation of split frequencies: 0.023930

      105500 -- (-348.584) (-349.580) (-347.597) [-346.725] * [-347.908] (-346.736) (-346.923) (-346.186) -- 0:00:59
      106000 -- (-347.951) (-346.790) [-348.351] (-350.511) * (-351.482) (-348.534) [-347.633] (-346.085) -- 0:00:59
      106500 -- (-351.439) (-349.521) [-344.985] (-349.214) * (-345.971) (-349.191) [-346.482] (-346.238) -- 0:00:58
      107000 -- (-346.084) [-345.758] (-350.809) (-351.783) * (-345.806) [-346.545] (-346.353) (-346.729) -- 0:00:58
      107500 -- (-345.981) [-345.657] (-348.227) (-348.468) * (-345.168) (-348.506) [-345.148] (-350.798) -- 0:00:58
      108000 -- (-346.378) (-348.479) [-347.767] (-347.401) * [-345.401] (-347.653) (-345.809) (-346.130) -- 0:00:57
      108500 -- (-345.607) (-349.452) (-351.381) [-345.770] * (-348.495) (-347.058) [-349.687] (-347.406) -- 0:00:57
      109000 -- (-345.823) [-346.085] (-346.133) (-346.035) * (-345.636) [-349.657] (-347.854) (-345.915) -- 0:00:57
      109500 -- (-346.020) (-351.113) [-348.218] (-345.486) * [-345.510] (-346.367) (-346.290) (-346.248) -- 0:00:56
      110000 -- (-346.105) (-348.723) (-346.315) [-345.037] * (-345.850) [-348.120] (-345.764) (-347.642) -- 0:00:56

      Average standard deviation of split frequencies: 0.023530

      110500 -- (-345.514) (-352.631) [-349.633] (-346.186) * (-350.174) [-350.121] (-345.819) (-347.889) -- 0:01:04
      111000 -- (-346.632) (-348.176) [-347.009] (-347.115) * (-349.331) (-350.053) [-345.618] (-346.404) -- 0:01:04
      111500 -- (-346.408) (-352.707) (-345.759) [-346.326] * (-348.748) (-348.190) (-345.174) [-347.931] -- 0:01:03
      112000 -- [-345.206] (-345.170) (-345.606) (-346.886) * (-344.945) [-348.082] (-347.292) (-347.214) -- 0:01:03
      112500 -- (-346.290) (-349.200) [-345.718] (-346.958) * (-348.751) [-350.839] (-350.408) (-347.038) -- 0:01:03
      113000 -- (-353.611) (-347.549) [-347.869] (-345.712) * (-345.602) (-348.879) [-346.086] (-352.280) -- 0:01:02
      113500 -- (-346.535) (-347.569) (-346.228) [-346.230] * [-345.336] (-345.321) (-347.315) (-347.577) -- 0:01:02
      114000 -- (-346.976) [-345.937] (-348.932) (-350.083) * (-349.039) (-345.750) (-347.494) [-347.841] -- 0:01:02
      114500 -- [-346.691] (-347.500) (-346.244) (-350.224) * (-350.331) (-347.804) [-345.993] (-347.909) -- 0:01:01
      115000 -- (-345.771) [-346.157] (-347.349) (-346.029) * [-347.782] (-345.024) (-347.081) (-345.840) -- 0:01:01

      Average standard deviation of split frequencies: 0.023275

      115500 -- [-345.928] (-346.055) (-346.345) (-348.598) * (-345.729) (-346.415) [-349.308] (-346.559) -- 0:01:01
      116000 -- (-345.198) (-347.928) (-345.359) [-347.974] * (-345.643) (-347.556) (-347.445) [-351.574] -- 0:01:00
      116500 -- (-345.697) (-348.447) (-346.386) [-346.314] * (-348.799) (-345.273) [-345.692] (-347.310) -- 0:01:00
      117000 -- (-346.193) [-346.925] (-347.252) (-346.145) * [-345.499] (-347.129) (-349.975) (-345.803) -- 0:01:00
      117500 -- [-346.718] (-348.405) (-346.138) (-345.514) * (-349.125) (-349.160) [-350.261] (-349.930) -- 0:01:00
      118000 -- (-347.774) (-345.166) [-346.268] (-348.698) * (-345.965) (-350.201) [-347.337] (-349.465) -- 0:00:59
      118500 -- (-349.117) [-346.533] (-348.664) (-347.152) * (-346.015) (-351.197) [-348.876] (-350.205) -- 0:00:59
      119000 -- (-347.710) (-346.010) [-345.826] (-348.278) * [-347.497] (-348.498) (-346.775) (-350.875) -- 0:00:59
      119500 -- (-347.795) (-345.804) [-347.851] (-346.086) * (-349.064) [-346.058] (-346.873) (-345.625) -- 0:00:58
      120000 -- (-347.561) [-346.049] (-348.663) (-346.857) * (-346.442) [-346.212] (-346.794) (-346.617) -- 0:00:58

      Average standard deviation of split frequencies: 0.021877

      120500 -- (-346.619) (-349.344) (-346.845) [-345.628] * (-352.799) (-346.024) [-346.998] (-348.275) -- 0:00:58
      121000 -- (-346.973) (-346.666) (-346.297) [-345.269] * [-346.364] (-346.337) (-352.873) (-347.358) -- 0:00:58
      121500 -- (-345.813) (-347.067) (-347.470) [-345.194] * (-346.076) (-347.104) (-349.620) [-348.312] -- 0:00:57
      122000 -- (-347.616) (-351.198) (-346.772) [-350.500] * (-344.940) (-348.528) [-346.809] (-346.025) -- 0:00:57
      122500 -- (-346.317) (-347.718) [-345.690] (-346.166) * (-345.590) [-346.354] (-348.528) (-350.667) -- 0:00:57
      123000 -- (-347.607) [-347.071] (-347.221) (-350.704) * [-346.367] (-348.424) (-344.831) (-347.675) -- 0:00:57
      123500 -- (-348.769) (-344.919) (-346.850) [-345.317] * (-349.948) (-347.060) (-345.850) [-347.511] -- 0:00:56
      124000 -- [-346.150] (-347.087) (-345.787) (-346.832) * (-349.714) (-348.140) (-346.490) [-348.634] -- 0:00:56
      124500 -- (-348.899) [-345.554] (-345.408) (-346.572) * (-347.028) (-346.091) [-346.165] (-352.066) -- 0:00:56
      125000 -- [-345.360] (-346.242) (-347.005) (-347.246) * (-346.721) (-345.788) (-346.463) [-349.327] -- 0:00:56

      Average standard deviation of split frequencies: 0.022270

      125500 -- (-345.359) (-346.771) [-347.781] (-345.690) * (-345.932) [-345.502] (-348.055) (-346.770) -- 0:00:55
      126000 -- (-345.340) (-345.519) (-345.859) [-345.408] * (-344.897) (-346.445) (-346.317) [-350.580] -- 0:00:55
      126500 -- [-345.782] (-347.598) (-345.414) (-355.477) * (-345.889) (-345.784) (-348.134) [-347.289] -- 0:00:55
      127000 -- [-348.789] (-345.722) (-345.545) (-347.427) * (-347.022) (-347.321) [-346.578] (-349.471) -- 0:01:01
      127500 -- (-345.551) (-346.094) [-344.865] (-347.794) * (-350.228) (-348.335) [-352.556] (-352.148) -- 0:01:01
      128000 -- (-345.729) (-347.826) (-345.362) [-348.765] * (-350.462) [-345.889] (-351.223) (-348.868) -- 0:01:01
      128500 -- (-346.370) [-351.556] (-345.509) (-347.012) * [-346.937] (-347.052) (-356.094) (-346.515) -- 0:01:01
      129000 -- [-346.736] (-348.398) (-349.180) (-345.489) * (-349.477) (-345.997) (-354.867) [-346.006] -- 0:01:00
      129500 -- [-345.517] (-349.052) (-347.592) (-350.108) * (-347.888) (-347.419) (-350.245) [-345.835] -- 0:01:00
      130000 -- (-346.089) (-350.059) (-348.054) [-348.930] * (-347.152) (-345.554) [-351.372] (-346.262) -- 0:01:00

      Average standard deviation of split frequencies: 0.022333

      130500 -- [-347.147] (-347.066) (-347.260) (-348.228) * (-346.007) (-346.443) (-347.658) [-345.161] -- 0:00:59
      131000 -- (-345.722) [-346.131] (-348.482) (-355.404) * (-346.302) (-352.382) [-345.635] (-346.421) -- 0:00:59
      131500 -- (-345.708) (-347.974) [-346.483] (-349.784) * (-345.914) (-349.588) [-350.494] (-347.976) -- 0:00:59
      132000 -- (-347.400) [-347.087] (-346.041) (-347.146) * (-347.463) (-345.483) (-351.008) [-346.087] -- 0:00:59
      132500 -- (-350.537) (-347.015) (-346.656) [-345.621] * [-346.853] (-349.551) (-346.985) (-348.688) -- 0:00:58
      133000 -- (-348.364) (-349.169) [-346.463] (-346.322) * [-351.031] (-354.155) (-346.678) (-350.189) -- 0:00:58
      133500 -- (-346.483) (-350.427) (-346.576) [-346.604] * (-348.188) (-350.257) (-346.761) [-350.339] -- 0:00:58
      134000 -- [-346.119] (-351.234) (-350.644) (-349.797) * (-350.138) [-346.557] (-347.041) (-347.968) -- 0:00:58
      134500 -- (-349.917) [-353.292] (-348.441) (-346.807) * (-346.967) (-345.928) (-346.793) [-347.245] -- 0:00:57
      135000 -- [-346.277] (-347.604) (-347.024) (-348.699) * (-345.649) (-347.350) [-345.608] (-345.613) -- 0:00:57

      Average standard deviation of split frequencies: 0.020194

      135500 -- (-352.006) [-349.816] (-347.911) (-350.912) * [-345.770] (-349.384) (-348.870) (-354.417) -- 0:00:57
      136000 -- (-346.904) (-352.315) [-349.070] (-351.011) * (-345.141) (-351.036) [-345.429] (-350.101) -- 0:00:57
      136500 -- (-346.944) (-346.914) (-349.364) [-348.036] * (-347.837) (-345.240) [-345.584] (-349.450) -- 0:00:56
      137000 -- (-346.360) (-345.604) (-346.096) [-345.248] * [-346.063] (-346.524) (-345.995) (-349.177) -- 0:00:56
      137500 -- (-346.496) [-344.986] (-345.879) (-346.640) * (-348.020) (-347.613) [-347.611] (-351.191) -- 0:00:56
      138000 -- [-346.822] (-347.475) (-345.634) (-348.314) * (-346.712) [-347.920] (-346.229) (-347.699) -- 0:00:56
      138500 -- [-346.117] (-345.871) (-345.833) (-347.438) * (-347.981) (-348.060) (-346.779) [-346.811] -- 0:00:55
      139000 -- (-345.546) (-346.117) (-348.278) [-348.616] * (-346.027) [-346.459] (-351.564) (-349.121) -- 0:00:55
      139500 -- (-346.765) (-346.595) [-346.920] (-346.069) * (-351.314) [-345.730] (-345.923) (-349.794) -- 0:00:55
      140000 -- (-348.660) (-351.544) (-345.023) [-345.405] * (-350.416) (-346.413) [-345.525] (-347.794) -- 0:00:55

      Average standard deviation of split frequencies: 0.019670

      140500 -- (-345.590) (-348.492) (-345.437) [-348.118] * (-348.850) (-345.375) [-345.301] (-348.063) -- 0:00:55
      141000 -- (-349.013) (-346.000) (-346.584) [-346.799] * (-349.960) (-348.732) (-346.459) [-347.644] -- 0:00:54
      141500 -- (-346.678) (-345.679) (-349.391) [-349.018] * (-346.247) (-349.367) [-347.618] (-345.023) -- 0:00:54
      142000 -- (-346.256) [-346.623] (-349.307) (-349.201) * (-346.415) (-345.766) (-348.894) [-348.454] -- 0:00:54
      142500 -- (-347.320) (-347.315) (-349.566) [-345.184] * (-347.189) (-346.885) (-347.895) [-347.563] -- 0:00:54
      143000 -- (-348.979) (-348.826) (-346.896) [-347.968] * (-349.458) (-346.032) (-345.891) [-347.080] -- 0:00:53
      143500 -- [-346.019] (-347.269) (-345.399) (-350.331) * (-347.700) [-347.191] (-349.911) (-345.851) -- 0:00:53
      144000 -- (-345.214) [-348.469] (-350.360) (-347.476) * (-348.256) [-345.561] (-344.945) (-346.176) -- 0:00:59
      144500 -- [-347.377] (-351.297) (-347.460) (-347.641) * [-345.487] (-346.591) (-346.194) (-345.273) -- 0:00:59
      145000 -- (-355.416) (-346.609) (-346.309) [-345.329] * (-346.558) (-348.660) [-347.044] (-348.501) -- 0:00:58

      Average standard deviation of split frequencies: 0.020355

      145500 -- [-345.178] (-345.500) (-346.484) (-345.918) * (-348.880) (-346.376) [-345.604] (-345.779) -- 0:00:58
      146000 -- (-348.160) (-348.419) [-351.150] (-345.833) * [-346.221] (-349.985) (-349.318) (-346.144) -- 0:00:58
      146500 -- (-349.738) (-345.789) (-345.691) [-345.539] * (-347.485) [-348.165] (-346.281) (-348.513) -- 0:00:58
      147000 -- (-348.152) (-345.598) [-345.475] (-347.691) * (-345.029) (-349.696) [-346.079] (-346.691) -- 0:00:58
      147500 -- [-346.251] (-348.477) (-347.798) (-346.223) * [-345.411] (-347.781) (-346.124) (-346.335) -- 0:00:57
      148000 -- [-345.431] (-351.076) (-347.384) (-347.251) * [-346.968] (-346.008) (-346.439) (-348.963) -- 0:00:57
      148500 -- (-347.360) [-348.589] (-348.204) (-348.853) * (-347.212) [-348.210] (-349.079) (-351.075) -- 0:00:57
      149000 -- (-345.308) (-347.205) [-347.198] (-347.402) * (-345.765) (-346.869) (-348.031) [-347.043] -- 0:00:57
      149500 -- (-350.431) (-348.176) (-347.634) [-346.216] * [-346.675] (-347.481) (-346.183) (-348.666) -- 0:00:56
      150000 -- [-346.256] (-347.310) (-347.748) (-347.339) * [-346.365] (-345.593) (-346.019) (-349.171) -- 0:00:56

      Average standard deviation of split frequencies: 0.019342

      150500 -- (-348.134) (-347.899) [-349.049] (-353.223) * (-346.168) [-345.586] (-348.018) (-347.137) -- 0:00:56
      151000 -- [-345.073] (-348.132) (-346.502) (-351.017) * [-345.523] (-351.121) (-346.388) (-345.103) -- 0:00:56
      151500 -- [-345.376] (-347.719) (-348.233) (-351.787) * (-345.428) (-346.933) [-346.831] (-347.375) -- 0:00:56
      152000 -- (-348.187) (-347.903) [-345.209] (-349.102) * (-347.146) (-346.861) [-345.691] (-346.449) -- 0:00:55
      152500 -- [-349.237] (-346.438) (-345.790) (-345.027) * (-348.028) (-349.338) (-347.905) [-347.011] -- 0:00:55
      153000 -- (-347.129) (-347.810) (-346.389) [-346.918] * [-345.217] (-348.966) (-347.576) (-349.582) -- 0:00:55
      153500 -- (-346.058) (-347.635) [-346.233] (-348.272) * [-345.404] (-346.553) (-351.463) (-347.425) -- 0:00:55
      154000 -- (-345.389) (-348.187) [-345.277] (-346.044) * (-350.049) (-346.942) [-349.578] (-347.422) -- 0:00:54
      154500 -- (-345.799) (-345.565) (-349.646) [-347.601] * (-347.093) (-347.149) (-348.006) [-348.179] -- 0:00:54
      155000 -- (-350.805) (-348.327) [-346.786] (-346.964) * (-348.366) [-350.382] (-346.985) (-347.738) -- 0:00:54

      Average standard deviation of split frequencies: 0.019714

      155500 -- (-346.180) (-347.410) (-346.163) [-347.383] * (-352.264) (-349.197) (-350.277) [-349.608] -- 0:00:54
      156000 -- (-346.947) [-344.996] (-345.196) (-345.525) * (-345.138) (-345.516) [-347.253] (-350.308) -- 0:00:54
      156500 -- (-350.346) (-347.148) [-347.208] (-349.363) * (-352.220) [-347.591] (-347.724) (-347.051) -- 0:00:53
      157000 -- (-348.794) (-349.321) (-350.234) [-350.144] * (-345.236) (-346.490) [-347.367] (-349.575) -- 0:00:53
      157500 -- (-346.013) (-345.223) (-345.723) [-351.001] * (-346.198) (-346.022) (-346.549) [-346.800] -- 0:00:53
      158000 -- (-347.047) (-346.426) (-345.525) [-347.988] * (-345.558) [-347.491] (-347.112) (-350.296) -- 0:00:53
      158500 -- (-345.857) (-348.840) [-347.331] (-346.468) * [-346.042] (-345.763) (-346.601) (-352.725) -- 0:00:53
      159000 -- (-345.952) (-345.844) (-346.394) [-347.162] * (-349.955) [-350.232] (-347.569) (-348.546) -- 0:00:52
      159500 -- (-345.430) (-351.125) (-346.895) [-346.266] * (-349.835) [-346.161] (-350.596) (-346.593) -- 0:00:52
      160000 -- (-346.587) [-348.198] (-345.658) (-346.144) * (-345.986) [-345.976] (-347.311) (-347.297) -- 0:00:52

      Average standard deviation of split frequencies: 0.021125

      160500 -- [-347.275] (-346.139) (-345.792) (-346.426) * (-346.399) (-345.473) (-345.903) [-348.007] -- 0:00:52
      161000 -- (-348.194) (-345.727) (-348.950) [-347.320] * [-346.290] (-349.708) (-346.221) (-347.106) -- 0:00:52
      161500 -- (-348.740) (-348.225) (-345.463) [-346.077] * [-349.338] (-347.057) (-347.817) (-347.009) -- 0:00:57
      162000 -- (-349.498) (-349.116) [-347.439] (-345.887) * [-352.616] (-351.871) (-346.690) (-346.624) -- 0:00:56
      162500 -- (-348.072) (-350.941) [-347.896] (-347.766) * (-351.073) (-347.106) [-346.397] (-348.571) -- 0:00:56
      163000 -- (-347.574) (-347.411) [-349.906] (-345.333) * (-345.876) (-348.548) (-349.947) [-350.515] -- 0:00:56
      163500 -- (-347.470) (-347.061) [-345.983] (-349.163) * (-345.301) [-346.776] (-345.934) (-347.088) -- 0:00:56
      164000 -- [-347.566] (-345.760) (-349.444) (-345.732) * (-345.982) [-346.842] (-345.679) (-346.308) -- 0:00:56
      164500 -- (-348.296) (-350.220) (-345.919) [-346.259] * (-345.625) (-349.924) (-351.929) [-345.422] -- 0:00:55
      165000 -- (-345.955) (-350.749) [-345.020] (-347.278) * (-346.321) (-350.344) (-347.310) [-347.128] -- 0:00:55

      Average standard deviation of split frequencies: 0.020304

      165500 -- [-344.823] (-347.752) (-347.331) (-349.297) * (-347.056) (-345.887) (-348.899) [-348.334] -- 0:00:55
      166000 -- (-345.764) (-350.471) (-347.891) [-346.328] * (-345.942) (-348.560) [-347.467] (-345.677) -- 0:00:55
      166500 -- (-345.139) [-348.908] (-346.369) (-347.338) * (-346.964) [-344.997] (-346.377) (-347.969) -- 0:00:55
      167000 -- (-345.960) (-347.557) [-346.621] (-345.295) * (-348.443) (-346.526) [-345.109] (-345.513) -- 0:00:54
      167500 -- (-348.248) [-345.329] (-346.465) (-348.498) * (-346.508) [-346.490] (-348.185) (-345.757) -- 0:00:54
      168000 -- [-348.895] (-350.054) (-348.032) (-345.613) * [-346.063] (-346.756) (-345.022) (-345.827) -- 0:00:54
      168500 -- (-348.319) (-347.175) (-348.439) [-347.059] * [-345.339] (-350.152) (-345.061) (-350.793) -- 0:00:54
      169000 -- (-347.246) [-345.328] (-346.045) (-347.271) * (-345.734) [-346.943] (-346.259) (-349.996) -- 0:00:54
      169500 -- [-346.633] (-348.775) (-348.882) (-347.519) * (-346.980) [-347.787] (-348.545) (-348.369) -- 0:00:53
      170000 -- (-345.570) (-345.091) (-347.802) [-347.261] * [-351.299] (-346.931) (-345.889) (-347.270) -- 0:00:53

      Average standard deviation of split frequencies: 0.020440

      170500 -- (-348.229) (-347.291) [-346.853] (-347.824) * (-346.727) [-346.729] (-345.867) (-346.098) -- 0:00:53
      171000 -- (-346.863) (-346.078) (-347.279) [-346.812] * (-345.746) (-348.041) [-346.389] (-346.767) -- 0:00:53
      171500 -- [-347.617] (-347.955) (-345.437) (-349.733) * (-346.060) (-347.285) (-348.711) [-346.951] -- 0:00:53
      172000 -- (-346.411) (-348.201) [-350.704] (-350.281) * (-345.664) (-352.231) (-348.390) [-347.676] -- 0:00:52
      172500 -- (-351.256) (-347.630) (-348.761) [-346.246] * [-348.076] (-348.949) (-346.464) (-350.110) -- 0:00:52
      173000 -- [-346.163] (-349.968) (-352.101) (-346.913) * [-345.672] (-348.282) (-347.233) (-350.829) -- 0:00:52
      173500 -- (-349.385) (-349.935) [-345.618] (-348.630) * (-345.843) (-354.943) (-348.700) [-348.545] -- 0:00:52
      174000 -- [-346.649] (-348.188) (-346.703) (-346.975) * (-345.414) (-347.516) (-346.599) [-345.957] -- 0:00:52
      174500 -- (-348.371) (-346.177) [-346.645] (-349.038) * (-347.021) [-348.037] (-345.980) (-347.180) -- 0:00:52
      175000 -- (-349.451) (-354.629) [-350.173] (-346.179) * [-347.425] (-348.217) (-347.305) (-346.731) -- 0:00:51

      Average standard deviation of split frequencies: 0.020300

      175500 -- (-346.649) (-353.568) (-347.955) [-351.246] * [-345.941] (-345.962) (-346.106) (-346.945) -- 0:00:51
      176000 -- [-346.023] (-346.702) (-350.889) (-346.940) * (-349.182) (-348.524) [-346.468] (-350.348) -- 0:00:51
      176500 -- (-345.056) [-347.073] (-347.966) (-346.170) * (-345.881) [-347.154] (-345.058) (-348.686) -- 0:00:51
      177000 -- (-347.822) (-345.685) (-347.741) [-348.286] * (-353.735) (-350.902) [-346.690] (-345.753) -- 0:00:51
      177500 -- (-359.652) (-346.592) [-347.577] (-345.675) * (-348.004) (-350.333) [-347.324] (-347.488) -- 0:00:50
      178000 -- (-345.945) [-345.067] (-350.167) (-347.924) * [-347.779] (-346.833) (-347.386) (-347.559) -- 0:00:50
      178500 -- [-346.523] (-345.881) (-345.414) (-347.266) * (-347.075) (-346.545) [-345.092] (-347.321) -- 0:00:50
      179000 -- (-346.546) (-347.024) (-345.633) [-348.276] * (-352.115) (-345.940) [-345.725] (-346.601) -- 0:00:55
      179500 -- [-346.705] (-345.232) (-345.014) (-347.446) * (-350.080) (-345.688) [-346.918] (-345.046) -- 0:00:54
      180000 -- (-346.704) (-350.378) [-348.021] (-347.159) * [-347.485] (-348.491) (-345.775) (-347.909) -- 0:00:54

      Average standard deviation of split frequencies: 0.018951

      180500 -- (-349.087) (-350.724) [-346.508] (-345.088) * [-349.482] (-348.078) (-345.359) (-345.679) -- 0:00:54
      181000 -- (-350.442) [-348.564] (-351.699) (-349.836) * [-348.801] (-351.487) (-345.740) (-345.558) -- 0:00:54
      181500 -- (-355.528) [-345.647] (-346.030) (-348.917) * (-347.334) (-346.326) [-347.516] (-344.826) -- 0:00:54
      182000 -- [-347.826] (-345.087) (-346.389) (-351.150) * [-346.665] (-345.475) (-345.851) (-345.714) -- 0:00:53
      182500 -- (-345.438) [-346.799] (-346.056) (-350.573) * (-350.414) (-345.691) (-346.463) [-345.263] -- 0:00:53
      183000 -- [-346.390] (-346.934) (-345.069) (-346.259) * (-347.648) [-345.824] (-345.893) (-346.861) -- 0:00:53
      183500 -- (-345.843) [-348.393] (-346.189) (-346.311) * (-350.073) [-346.769] (-345.606) (-348.965) -- 0:00:53
      184000 -- [-349.235] (-348.051) (-350.726) (-345.747) * [-347.692] (-347.635) (-349.119) (-345.773) -- 0:00:53
      184500 -- [-347.469] (-346.669) (-349.945) (-346.285) * [-345.009] (-350.164) (-350.054) (-345.852) -- 0:00:53
      185000 -- [-348.738] (-347.685) (-348.166) (-345.850) * (-344.810) [-355.277] (-347.428) (-348.879) -- 0:00:52

      Average standard deviation of split frequencies: 0.017994

      185500 -- (-345.275) (-346.947) [-345.986] (-348.705) * [-346.785] (-347.440) (-347.029) (-348.012) -- 0:00:52
      186000 -- (-346.082) (-349.487) [-345.996] (-346.915) * (-346.508) (-352.446) (-347.431) [-347.989] -- 0:00:52
      186500 -- (-348.551) (-345.292) (-349.111) [-345.616] * [-346.376] (-350.117) (-346.689) (-349.139) -- 0:00:52
      187000 -- (-346.984) [-346.214] (-347.337) (-348.211) * [-345.736] (-348.108) (-350.408) (-346.706) -- 0:00:52
      187500 -- (-347.046) [-347.176] (-348.901) (-348.986) * [-345.857] (-349.263) (-347.994) (-350.349) -- 0:00:52
      188000 -- [-347.354] (-349.342) (-347.803) (-346.823) * (-345.738) [-346.954] (-346.307) (-347.376) -- 0:00:51
      188500 -- [-349.696] (-348.006) (-346.852) (-352.444) * (-349.553) (-345.462) (-348.478) [-347.048] -- 0:00:51
      189000 -- (-346.842) [-347.545] (-347.223) (-349.575) * (-346.846) (-345.669) [-346.928] (-347.286) -- 0:00:51
      189500 -- (-346.088) (-346.373) (-348.688) [-348.460] * (-345.788) (-348.372) [-345.688] (-351.230) -- 0:00:51
      190000 -- (-345.902) (-347.060) (-351.399) [-346.564] * [-346.668] (-348.503) (-350.571) (-346.494) -- 0:00:51

      Average standard deviation of split frequencies: 0.017060

      190500 -- (-346.387) (-352.483) (-349.418) [-345.656] * [-345.543] (-346.725) (-350.066) (-346.945) -- 0:00:50
      191000 -- (-349.620) [-348.015] (-348.777) (-346.247) * (-345.723) (-345.523) [-346.045] (-346.894) -- 0:00:50
      191500 -- [-346.665] (-346.761) (-348.325) (-347.766) * (-346.995) (-349.469) [-347.167] (-347.293) -- 0:00:50
      192000 -- [-347.393] (-345.077) (-348.536) (-346.673) * [-346.861] (-345.953) (-345.232) (-347.960) -- 0:00:50
      192500 -- (-352.697) [-346.691] (-350.710) (-345.935) * [-345.563] (-346.952) (-347.228) (-349.356) -- 0:00:50
      193000 -- (-348.110) (-345.782) [-349.022] (-346.988) * (-347.757) (-346.036) (-346.838) [-346.600] -- 0:00:50
      193500 -- (-352.445) (-346.453) [-346.703] (-346.810) * [-347.366] (-346.628) (-346.543) (-345.168) -- 0:00:50
      194000 -- (-346.131) (-348.797) (-346.736) [-346.036] * (-348.475) [-346.702] (-348.843) (-346.446) -- 0:00:49
      194500 -- (-347.261) [-346.470] (-345.540) (-346.586) * (-347.521) (-348.273) [-346.323] (-346.320) -- 0:00:49
      195000 -- (-347.848) (-347.112) (-347.073) [-345.498] * (-345.784) [-346.651] (-346.117) (-344.818) -- 0:00:49

      Average standard deviation of split frequencies: 0.016355

      195500 -- (-350.000) [-349.228] (-345.450) (-348.006) * [-346.183] (-345.425) (-350.271) (-348.332) -- 0:00:49
      196000 -- [-349.677] (-348.939) (-346.844) (-345.960) * (-348.991) (-349.645) (-346.037) [-348.461] -- 0:00:53
      196500 -- (-345.221) (-350.243) [-346.914] (-344.969) * [-347.872] (-348.866) (-346.892) (-346.163) -- 0:00:53
      197000 -- (-346.002) (-345.862) (-345.338) [-346.984] * (-350.997) (-350.307) (-346.006) [-347.587] -- 0:00:52
      197500 -- (-345.492) (-347.826) [-346.914] (-348.411) * (-347.319) (-349.560) [-349.387] (-349.311) -- 0:00:52
      198000 -- (-346.308) (-347.928) (-347.618) [-346.868] * (-345.754) (-346.037) (-346.625) [-347.485] -- 0:00:52
      198500 -- [-347.727] (-347.343) (-347.688) (-348.429) * [-348.679] (-349.036) (-345.928) (-346.603) -- 0:00:52
      199000 -- (-346.681) (-345.557) [-345.330] (-348.282) * (-345.761) [-348.504] (-346.280) (-346.496) -- 0:00:52
      199500 -- [-348.717] (-345.856) (-346.622) (-351.070) * [-348.019] (-347.224) (-345.938) (-346.745) -- 0:00:52
      200000 -- (-347.878) (-346.328) (-347.062) [-346.215] * (-346.992) [-346.006] (-348.958) (-346.418) -- 0:00:51

      Average standard deviation of split frequencies: 0.015505

      200500 -- [-346.999] (-347.993) (-351.507) (-346.000) * (-345.488) [-347.144] (-348.335) (-345.567) -- 0:00:51
      201000 -- (-348.567) (-347.060) (-351.237) [-351.002] * (-346.862) [-346.632] (-348.334) (-346.738) -- 0:00:51
      201500 -- (-352.160) [-347.603] (-349.488) (-346.952) * [-345.375] (-348.706) (-351.053) (-350.104) -- 0:00:51
      202000 -- (-354.115) [-346.099] (-346.506) (-346.874) * [-348.033] (-345.795) (-347.841) (-352.395) -- 0:00:51
      202500 -- [-347.464] (-348.867) (-353.383) (-349.005) * (-346.623) (-351.360) [-350.493] (-349.564) -- 0:00:51
      203000 -- [-348.049] (-346.644) (-349.165) (-347.140) * (-347.285) [-346.373] (-347.710) (-345.745) -- 0:00:51
      203500 -- (-348.604) (-346.842) (-348.268) [-346.429] * [-345.864] (-349.776) (-348.409) (-348.909) -- 0:00:50
      204000 -- (-345.966) [-345.223] (-346.180) (-349.519) * (-347.988) (-348.874) [-349.154] (-348.885) -- 0:00:50
      204500 -- (-349.525) (-345.249) (-346.992) [-348.989] * (-346.909) [-348.622] (-345.179) (-349.167) -- 0:00:50
      205000 -- (-346.802) (-347.024) (-347.465) [-346.582] * (-344.914) (-345.733) (-346.540) [-347.621] -- 0:00:50

      Average standard deviation of split frequencies: 0.014989

      205500 -- (-346.038) [-346.919] (-348.071) (-348.144) * (-346.132) (-345.087) [-347.698] (-348.920) -- 0:00:50
      206000 -- [-348.376] (-345.953) (-349.321) (-347.186) * (-345.582) [-347.220] (-345.670) (-345.792) -- 0:00:50
      206500 -- (-347.848) [-346.481] (-346.403) (-347.063) * (-347.400) [-347.429] (-346.072) (-346.837) -- 0:00:49
      207000 -- (-345.515) (-347.722) [-346.150] (-346.592) * (-350.664) (-345.271) (-353.044) [-346.226] -- 0:00:49
      207500 -- (-346.941) [-348.586] (-346.582) (-346.852) * (-347.183) (-347.577) [-345.352] (-348.968) -- 0:00:49
      208000 -- (-346.408) [-345.605] (-345.101) (-346.830) * (-348.981) (-348.665) [-346.268] (-347.684) -- 0:00:49
      208500 -- [-346.362] (-348.452) (-345.303) (-346.460) * (-351.715) (-346.893) [-346.935] (-349.702) -- 0:00:49
      209000 -- (-345.863) (-347.375) [-349.148] (-347.579) * (-345.177) (-346.133) (-347.712) [-348.538] -- 0:00:49
      209500 -- (-347.046) (-347.536) [-346.430] (-346.032) * (-353.719) [-346.618] (-351.446) (-346.799) -- 0:00:49
      210000 -- (-347.713) [-347.871] (-347.663) (-344.903) * (-351.853) [-345.194] (-347.954) (-345.898) -- 0:00:48

      Average standard deviation of split frequencies: 0.016606

      210500 -- [-350.045] (-348.276) (-349.356) (-347.245) * [-347.905] (-345.334) (-345.549) (-350.734) -- 0:00:48
      211000 -- (-345.661) (-349.326) (-346.235) [-346.381] * (-349.029) (-348.675) [-350.921] (-348.056) -- 0:00:48
      211500 -- (-348.295) (-350.443) [-346.021] (-348.629) * (-347.142) (-345.946) [-345.047] (-347.264) -- 0:00:48
      212000 -- [-349.473] (-347.594) (-345.164) (-347.999) * (-345.294) (-345.710) (-347.601) [-344.801] -- 0:00:48
      212500 -- (-350.043) (-348.380) [-348.909] (-347.961) * (-346.997) (-345.497) (-345.825) [-345.038] -- 0:00:48
      213000 -- (-346.479) [-345.360] (-349.042) (-351.115) * [-346.320] (-346.182) (-345.836) (-346.697) -- 0:00:51
      213500 -- (-345.575) [-345.971] (-349.108) (-347.047) * [-345.707] (-346.335) (-347.610) (-350.028) -- 0:00:51
      214000 -- (-344.836) (-347.787) [-350.541] (-346.518) * (-345.978) (-347.198) [-346.555] (-349.555) -- 0:00:51
      214500 -- (-346.825) (-347.905) (-345.881) [-345.628] * (-348.089) (-350.350) [-346.695] (-349.127) -- 0:00:51
      215000 -- (-346.723) (-348.153) (-347.941) [-348.960] * (-349.037) [-346.726] (-347.727) (-349.464) -- 0:00:51

      Average standard deviation of split frequencies: 0.017338

      215500 -- [-345.512] (-345.467) (-346.670) (-348.883) * (-348.807) [-346.234] (-346.796) (-345.890) -- 0:00:50
      216000 -- (-346.465) (-346.778) [-345.359] (-346.378) * [-346.196] (-346.123) (-347.256) (-350.003) -- 0:00:50
      216500 -- (-345.509) [-350.234] (-344.950) (-346.802) * [-347.080] (-350.094) (-349.285) (-348.924) -- 0:00:50
      217000 -- [-351.499] (-347.705) (-348.700) (-349.592) * (-347.936) (-346.624) (-348.272) [-347.709] -- 0:00:50
      217500 -- (-347.862) (-348.048) [-345.967] (-350.135) * (-345.883) (-347.664) (-348.677) [-349.074] -- 0:00:50
      218000 -- (-346.274) (-346.817) [-346.592] (-346.295) * (-347.164) [-345.017] (-346.239) (-346.097) -- 0:00:50
      218500 -- (-349.177) [-346.883] (-347.881) (-349.854) * (-346.568) (-346.497) [-345.561] (-346.562) -- 0:00:50
      219000 -- (-346.737) (-347.471) (-347.942) [-348.622] * (-348.813) [-349.814] (-346.523) (-345.938) -- 0:00:49
      219500 -- (-348.461) (-347.411) (-348.135) [-348.014] * (-346.642) (-350.490) (-347.850) [-345.542] -- 0:00:49
      220000 -- (-347.947) [-345.809] (-345.961) (-346.572) * (-346.179) (-352.036) [-345.440] (-346.991) -- 0:00:49

      Average standard deviation of split frequencies: 0.016734

      220500 -- (-348.328) [-348.680] (-346.071) (-347.376) * (-347.744) (-346.425) [-346.568] (-350.951) -- 0:00:49
      221000 -- (-346.082) (-346.518) [-345.263] (-347.570) * (-348.992) (-349.142) [-345.913] (-349.686) -- 0:00:49
      221500 -- (-347.643) (-348.525) [-348.068] (-351.490) * (-346.579) [-346.972] (-347.449) (-346.732) -- 0:00:49
      222000 -- (-346.633) (-350.507) [-345.156] (-346.880) * (-346.296) [-345.591] (-346.886) (-349.824) -- 0:00:49
      222500 -- (-345.129) (-348.210) (-346.228) [-346.659] * [-346.049] (-350.489) (-346.655) (-348.457) -- 0:00:48
      223000 -- (-346.634) (-348.599) (-346.049) [-345.101] * (-349.178) [-347.776] (-345.790) (-348.013) -- 0:00:48
      223500 -- (-346.648) [-346.508] (-347.249) (-347.839) * [-351.333] (-347.367) (-345.992) (-345.199) -- 0:00:48
      224000 -- (-347.956) [-345.943] (-350.836) (-346.540) * (-345.415) [-347.466] (-348.072) (-348.434) -- 0:00:48
      224500 -- (-348.381) (-345.832) [-346.218] (-352.303) * (-345.291) [-348.454] (-346.489) (-349.108) -- 0:00:48
      225000 -- (-346.658) (-346.854) (-346.088) [-345.799] * (-345.403) (-346.783) [-347.068] (-346.938) -- 0:00:48

      Average standard deviation of split frequencies: 0.015644

      225500 -- [-346.045] (-350.256) (-346.936) (-347.712) * (-348.663) (-348.573) (-346.671) [-346.016] -- 0:00:48
      226000 -- [-347.349] (-346.512) (-348.197) (-346.372) * (-349.885) [-347.532] (-346.461) (-349.937) -- 0:00:47
      226500 -- (-348.368) (-348.078) (-346.467) [-347.000] * (-345.475) [-346.691] (-346.267) (-346.868) -- 0:00:47
      227000 -- (-348.349) (-347.542) (-345.943) [-347.700] * (-345.762) (-345.899) [-345.826] (-347.639) -- 0:00:47
      227500 -- (-348.564) (-345.545) (-345.686) [-345.729] * (-345.850) (-347.449) [-345.872] (-345.751) -- 0:00:47
      228000 -- (-345.467) [-345.279] (-345.670) (-347.787) * (-347.124) (-347.314) [-346.185] (-348.704) -- 0:00:47
      228500 -- (-347.038) (-348.023) [-346.238] (-348.217) * (-345.709) (-347.205) (-345.944) [-346.309] -- 0:00:47
      229000 -- [-349.607] (-347.427) (-347.034) (-345.291) * [-346.462] (-349.307) (-346.072) (-347.773) -- 0:00:47
      229500 -- (-346.477) (-345.930) (-344.944) [-345.628] * [-346.093] (-346.577) (-345.627) (-345.426) -- 0:00:47
      230000 -- (-348.600) (-346.153) (-345.514) [-346.193] * (-349.102) (-347.455) (-346.130) [-345.458] -- 0:00:50

      Average standard deviation of split frequencies: 0.017371

      230500 -- (-352.351) (-347.036) [-345.734] (-346.856) * [-345.371] (-346.840) (-345.641) (-347.941) -- 0:00:50
      231000 -- [-345.711] (-348.654) (-351.807) (-348.051) * [-345.117] (-347.028) (-346.124) (-347.291) -- 0:00:49
      231500 -- (-347.398) (-345.604) [-346.257] (-351.775) * (-345.975) [-347.755] (-345.912) (-346.933) -- 0:00:49
      232000 -- [-345.836] (-346.379) (-346.574) (-350.230) * (-345.962) (-346.906) (-350.581) [-345.310] -- 0:00:49
      232500 -- (-345.701) (-345.379) (-348.568) [-349.012] * (-346.422) [-345.092] (-346.728) (-346.634) -- 0:00:49
      233000 -- (-346.647) [-346.383] (-349.914) (-347.050) * (-345.536) (-346.320) (-345.559) [-345.247] -- 0:00:49
      233500 -- (-346.876) (-350.768) (-348.765) [-346.722] * (-348.425) [-348.729] (-347.798) (-348.121) -- 0:00:49
      234000 -- (-351.580) (-348.130) [-347.183] (-347.447) * (-345.051) [-345.675] (-348.210) (-345.461) -- 0:00:49
      234500 -- (-350.653) (-350.229) [-346.489] (-347.546) * [-348.127] (-346.498) (-348.065) (-347.904) -- 0:00:48
      235000 -- (-345.574) (-347.094) (-355.137) [-347.049] * (-348.352) [-345.665] (-348.240) (-348.346) -- 0:00:48

      Average standard deviation of split frequencies: 0.016836

      235500 -- (-350.495) (-349.202) [-352.115] (-347.136) * (-348.954) (-346.801) (-347.493) [-346.087] -- 0:00:48
      236000 -- (-347.840) (-349.014) [-348.865] (-348.489) * (-346.799) [-345.759] (-347.645) (-347.236) -- 0:00:48
      236500 -- [-345.712] (-349.226) (-346.016) (-347.129) * (-345.364) (-345.552) [-347.201] (-346.722) -- 0:00:48
      237000 -- (-348.690) (-354.196) [-346.889] (-347.745) * (-347.094) (-349.978) [-345.405] (-347.900) -- 0:00:48
      237500 -- (-346.010) (-345.087) [-348.377] (-346.532) * (-345.860) (-346.084) (-346.971) [-346.964] -- 0:00:48
      238000 -- (-351.187) [-346.339] (-347.040) (-346.455) * [-345.890] (-352.384) (-348.784) (-351.461) -- 0:00:48
      238500 -- (-347.971) (-345.683) [-347.853] (-350.976) * (-347.389) (-348.964) [-346.674] (-347.626) -- 0:00:47
      239000 -- [-346.975] (-347.400) (-349.132) (-349.775) * [-345.650] (-347.171) (-347.636) (-347.358) -- 0:00:47
      239500 -- [-346.224] (-351.561) (-347.206) (-347.113) * (-346.841) (-348.689) (-346.094) [-349.895] -- 0:00:47
      240000 -- [-346.834] (-348.149) (-350.194) (-346.545) * (-348.733) (-348.218) [-347.047] (-345.934) -- 0:00:47

      Average standard deviation of split frequencies: 0.016453

      240500 -- (-348.806) (-348.392) (-345.901) [-347.390] * (-348.333) [-348.169] (-347.999) (-347.384) -- 0:00:47
      241000 -- (-350.241) (-350.180) (-345.587) [-347.015] * (-346.973) (-347.879) (-346.012) [-346.599] -- 0:00:47
      241500 -- (-348.686) (-345.417) (-345.412) [-346.819] * (-346.863) (-348.787) [-345.692] (-347.675) -- 0:00:47
      242000 -- [-347.007] (-345.392) (-348.276) (-350.272) * [-346.208] (-350.936) (-347.017) (-345.620) -- 0:00:46
      242500 -- (-349.734) [-347.800] (-350.216) (-345.780) * [-345.963] (-347.095) (-345.451) (-345.624) -- 0:00:46
      243000 -- [-349.119] (-349.486) (-348.316) (-345.486) * (-347.842) (-345.501) [-347.131] (-346.368) -- 0:00:46
      243500 -- (-347.620) (-346.912) [-352.284] (-346.781) * [-347.343] (-347.063) (-346.097) (-347.086) -- 0:00:46
      244000 -- (-347.623) (-345.961) [-350.014] (-346.302) * [-345.872] (-347.802) (-350.046) (-346.279) -- 0:00:46
      244500 -- [-345.813] (-346.115) (-346.210) (-348.272) * (-345.843) (-348.733) (-345.849) [-352.210] -- 0:00:46
      245000 -- (-350.064) (-346.598) (-348.885) [-350.612] * [-346.903] (-353.343) (-346.350) (-349.459) -- 0:00:46

      Average standard deviation of split frequencies: 0.016973

      245500 -- (-345.892) (-345.252) (-348.001) [-348.367] * (-344.691) (-355.882) (-346.138) [-350.465] -- 0:00:46
      246000 -- (-347.341) [-347.321] (-349.764) (-348.883) * (-347.266) [-348.621] (-346.139) (-348.665) -- 0:00:45
      246500 -- [-347.078] (-345.150) (-346.519) (-352.312) * (-347.400) (-348.657) [-345.270] (-353.119) -- 0:00:45
      247000 -- [-347.125] (-345.516) (-346.471) (-346.605) * (-347.424) (-348.031) [-346.503] (-346.731) -- 0:00:45
      247500 -- (-350.627) (-346.154) [-348.553] (-346.336) * (-348.512) (-348.601) [-348.716] (-345.372) -- 0:00:48
      248000 -- (-346.001) (-345.592) (-345.624) [-345.746] * (-347.669) (-348.022) (-351.757) [-345.741] -- 0:00:48
      248500 -- [-347.133] (-346.305) (-346.378) (-345.733) * [-347.876] (-346.794) (-346.976) (-345.387) -- 0:00:48
      249000 -- (-348.497) (-348.851) (-348.342) [-345.131] * (-346.992) (-347.015) [-347.038] (-346.026) -- 0:00:48
      249500 -- (-356.114) (-346.063) (-345.735) [-347.765] * (-346.126) [-346.534] (-348.820) (-345.986) -- 0:00:48
      250000 -- (-345.263) (-347.379) [-347.155] (-344.919) * (-346.137) [-347.975] (-346.301) (-346.262) -- 0:00:48

      Average standard deviation of split frequencies: 0.017019

      250500 -- (-349.816) (-346.011) (-345.274) [-349.449] * (-346.773) (-348.180) (-346.048) [-347.520] -- 0:00:47
      251000 -- [-349.341] (-348.156) (-345.946) (-346.438) * (-347.299) [-352.820] (-347.882) (-346.996) -- 0:00:47
      251500 -- (-350.391) [-349.500] (-344.734) (-345.409) * (-347.843) (-347.347) [-347.806] (-346.028) -- 0:00:47
      252000 -- (-351.522) (-348.332) [-348.632] (-349.286) * (-346.802) (-346.383) [-346.946] (-345.577) -- 0:00:47
      252500 -- (-348.516) [-345.488] (-349.348) (-348.422) * (-346.411) [-346.592] (-347.484) (-344.833) -- 0:00:47
      253000 -- (-346.775) [-345.221] (-352.900) (-347.265) * [-346.683] (-349.886) (-348.396) (-345.916) -- 0:00:47
      253500 -- (-345.727) (-347.314) (-347.455) [-346.217] * (-346.879) (-347.375) (-348.908) [-347.423] -- 0:00:47
      254000 -- [-347.075] (-346.180) (-345.445) (-345.926) * (-352.855) (-355.160) (-348.564) [-348.899] -- 0:00:46
      254500 -- (-350.700) (-348.381) [-346.653] (-349.347) * (-347.281) (-354.758) (-347.748) [-345.740] -- 0:00:46
      255000 -- (-351.340) [-346.179] (-347.734) (-346.579) * (-346.897) [-345.649] (-346.625) (-347.018) -- 0:00:46

      Average standard deviation of split frequencies: 0.016397

      255500 -- (-347.486) (-350.111) [-346.045] (-349.416) * [-347.708] (-346.901) (-345.927) (-346.719) -- 0:00:46
      256000 -- [-345.554] (-348.744) (-346.087) (-345.257) * [-348.241] (-348.273) (-346.495) (-345.371) -- 0:00:46
      256500 -- (-348.987) (-349.559) (-347.257) [-346.546] * (-348.960) (-347.039) [-347.080] (-345.014) -- 0:00:46
      257000 -- [-346.355] (-345.672) (-345.245) (-348.050) * (-345.430) (-347.449) [-347.398] (-348.158) -- 0:00:46
      257500 -- (-345.542) [-346.097] (-345.243) (-346.587) * (-346.664) [-347.084] (-347.147) (-349.442) -- 0:00:46
      258000 -- [-345.413] (-346.075) (-349.024) (-345.772) * (-346.427) (-345.214) [-347.262] (-346.740) -- 0:00:46
      258500 -- (-346.129) (-349.528) [-346.867] (-347.022) * [-347.808] (-347.061) (-348.279) (-345.089) -- 0:00:45
      259000 -- [-347.214] (-348.450) (-348.042) (-345.829) * (-345.549) (-345.975) (-346.075) [-346.198] -- 0:00:45
      259500 -- (-348.448) (-348.911) [-346.987] (-346.946) * (-346.310) [-346.422] (-347.306) (-348.190) -- 0:00:45
      260000 -- [-347.790] (-346.641) (-346.738) (-349.345) * (-345.734) (-346.811) (-346.661) [-346.195] -- 0:00:45

      Average standard deviation of split frequencies: 0.015824

      260500 -- (-346.448) [-347.094] (-345.348) (-349.013) * [-346.339] (-346.321) (-349.534) (-346.545) -- 0:00:45
      261000 -- (-347.986) (-348.540) (-345.392) [-345.806] * (-345.246) (-347.108) (-352.147) [-346.649] -- 0:00:45
      261500 -- (-348.665) [-345.923] (-346.044) (-347.732) * [-348.306] (-349.753) (-348.529) (-348.872) -- 0:00:45
      262000 -- [-347.286] (-345.001) (-345.171) (-353.751) * [-345.811] (-349.159) (-348.821) (-348.623) -- 0:00:45
      262500 -- [-346.129] (-345.239) (-346.958) (-348.324) * (-349.514) [-345.480] (-346.272) (-347.805) -- 0:00:44
      263000 -- (-347.452) (-346.994) [-346.994] (-347.435) * (-346.378) (-348.092) (-347.841) [-347.241] -- 0:00:44
      263500 -- (-347.390) (-354.078) [-345.835] (-345.972) * (-349.459) (-346.415) (-350.342) [-346.068] -- 0:00:44
      264000 -- [-348.653] (-351.765) (-346.612) (-348.807) * (-351.108) (-348.236) [-345.079] (-345.172) -- 0:00:44
      264500 -- (-345.433) (-346.057) (-348.214) [-348.815] * (-348.149) (-349.692) (-346.865) [-347.096] -- 0:00:47
      265000 -- (-345.659) [-345.668] (-349.998) (-346.779) * (-346.464) (-347.834) [-346.231] (-345.009) -- 0:00:47

      Average standard deviation of split frequencies: 0.016216

      265500 -- (-345.751) (-347.779) [-344.834] (-347.936) * (-346.165) (-348.881) (-346.887) [-348.585] -- 0:00:47
      266000 -- (-346.856) (-348.822) [-344.732] (-349.632) * [-345.494] (-350.701) (-345.494) (-346.775) -- 0:00:46
      266500 -- (-347.730) (-349.695) [-346.516] (-346.797) * (-346.625) (-346.481) (-349.481) [-347.015] -- 0:00:46
      267000 -- (-347.664) (-350.484) [-345.109] (-347.521) * (-350.315) [-347.676] (-346.876) (-347.700) -- 0:00:46
      267500 -- [-350.086] (-353.195) (-348.014) (-347.952) * (-346.415) (-349.620) (-348.432) [-346.892] -- 0:00:46
      268000 -- [-347.451] (-349.828) (-350.690) (-348.624) * [-345.458] (-345.048) (-347.713) (-346.938) -- 0:00:46
      268500 -- (-347.958) (-350.164) [-347.576] (-348.686) * [-345.328] (-346.764) (-349.065) (-350.078) -- 0:00:46
      269000 -- (-348.314) (-349.683) (-345.181) [-345.067] * (-346.562) [-348.759] (-346.864) (-347.331) -- 0:00:46
      269500 -- (-348.401) (-350.571) (-344.926) [-346.155] * (-349.871) (-346.051) (-351.435) [-347.586] -- 0:00:46
      270000 -- [-348.351] (-346.591) (-345.391) (-345.962) * (-347.927) (-346.397) [-345.787] (-347.239) -- 0:00:45

      Average standard deviation of split frequencies: 0.015675

      270500 -- (-348.387) (-347.802) [-349.685] (-346.575) * (-349.854) [-345.839] (-345.856) (-346.240) -- 0:00:45
      271000 -- (-347.559) (-350.131) (-347.381) [-345.358] * (-346.526) [-345.797] (-355.986) (-347.708) -- 0:00:45
      271500 -- (-350.957) [-349.748] (-346.392) (-350.833) * (-350.263) (-347.663) (-350.252) [-349.689] -- 0:00:45
      272000 -- [-349.340] (-347.031) (-347.772) (-353.079) * [-350.046] (-351.525) (-347.793) (-348.001) -- 0:00:45
      272500 -- (-348.771) (-349.054) [-347.497] (-346.553) * (-348.916) (-348.977) [-347.666] (-348.217) -- 0:00:45
      273000 -- (-348.633) [-345.807] (-346.704) (-346.201) * (-348.560) (-346.773) (-346.807) [-348.430] -- 0:00:45
      273500 -- (-346.398) (-350.091) [-345.917] (-349.169) * (-348.857) [-347.466] (-345.915) (-348.464) -- 0:00:45
      274000 -- (-346.008) (-345.506) [-347.878] (-351.357) * (-348.750) (-346.212) (-347.415) [-347.397] -- 0:00:45
      274500 -- (-347.024) (-350.293) [-346.694] (-347.206) * (-347.713) (-346.588) (-348.979) [-346.247] -- 0:00:44
      275000 -- (-346.957) (-350.250) [-345.732] (-346.795) * (-346.329) (-348.985) (-347.624) [-344.839] -- 0:00:44

      Average standard deviation of split frequencies: 0.016001

      275500 -- [-350.494] (-349.345) (-349.357) (-347.446) * (-346.087) (-346.421) (-348.483) [-346.150] -- 0:00:44
      276000 -- (-347.486) [-344.982] (-347.166) (-351.169) * (-345.732) (-345.732) [-346.843] (-347.013) -- 0:00:44
      276500 -- (-348.687) [-346.637] (-348.911) (-347.602) * (-349.008) (-345.716) [-347.440] (-345.664) -- 0:00:44
      277000 -- (-350.477) [-347.366] (-347.396) (-346.198) * (-346.742) (-347.102) (-346.151) [-347.657] -- 0:00:44
      277500 -- [-346.391] (-346.998) (-346.806) (-347.734) * (-348.021) (-347.149) [-346.526] (-348.275) -- 0:00:44
      278000 -- (-346.323) (-347.333) (-345.060) [-347.109] * (-347.134) (-346.514) (-347.462) [-350.876] -- 0:00:44
      278500 -- (-347.248) (-346.479) (-347.158) [-347.629] * (-348.404) (-350.523) [-345.502] (-345.712) -- 0:00:44
      279000 -- (-349.716) (-353.575) [-347.620] (-347.851) * [-347.889] (-347.727) (-349.710) (-351.328) -- 0:00:43
      279500 -- (-348.225) [-348.849] (-345.928) (-346.510) * (-349.008) (-346.254) [-347.792] (-347.354) -- 0:00:43
      280000 -- (-346.463) [-349.779] (-350.047) (-347.923) * (-347.016) (-346.428) [-348.745] (-352.641) -- 0:00:43

      Average standard deviation of split frequencies: 0.014851

      280500 -- (-349.655) (-349.213) [-346.199] (-350.171) * (-348.016) (-346.534) [-348.970] (-347.606) -- 0:00:43
      281000 -- (-347.080) (-351.223) [-346.755] (-346.309) * (-346.041) (-347.302) (-347.957) [-346.076] -- 0:00:43
      281500 -- (-346.491) (-351.528) [-345.480] (-347.376) * (-347.009) (-346.886) (-348.152) [-346.543] -- 0:00:43
      282000 -- [-345.419] (-348.460) (-344.898) (-347.916) * (-347.418) (-346.899) (-351.648) [-349.123] -- 0:00:45
      282500 -- (-346.672) [-348.516] (-346.804) (-347.984) * [-347.658] (-347.350) (-347.981) (-348.181) -- 0:00:45
      283000 -- (-348.984) (-346.343) [-345.570] (-345.781) * (-347.050) (-345.397) (-345.783) [-345.895] -- 0:00:45
      283500 -- [-348.111] (-346.855) (-348.252) (-347.436) * (-351.521) (-346.411) (-350.056) [-347.785] -- 0:00:45
      284000 -- (-347.422) (-348.660) (-345.838) [-348.137] * [-346.721] (-348.922) (-347.059) (-349.554) -- 0:00:45
      284500 -- (-346.643) [-347.755] (-351.189) (-347.891) * [-346.371] (-346.250) (-351.349) (-345.106) -- 0:00:45
      285000 -- (-351.758) [-347.333] (-345.992) (-349.311) * (-345.846) (-349.168) (-345.487) [-346.388] -- 0:00:45

      Average standard deviation of split frequencies: 0.015494

      285500 -- (-346.329) (-346.488) (-346.961) [-349.244] * (-345.532) (-348.752) (-349.024) [-345.414] -- 0:00:45
      286000 -- (-345.364) [-345.404] (-347.567) (-345.663) * [-348.980] (-350.728) (-347.011) (-347.986) -- 0:00:44
      286500 -- [-346.720] (-347.959) (-349.900) (-345.360) * (-348.451) [-344.977] (-352.738) (-347.641) -- 0:00:44
      287000 -- (-346.196) [-351.094] (-350.199) (-347.971) * (-345.897) (-346.190) [-347.945] (-348.695) -- 0:00:44
      287500 -- (-349.548) [-349.709] (-349.729) (-346.207) * (-349.343) (-347.961) [-346.410] (-348.899) -- 0:00:44
      288000 -- (-346.215) (-348.885) [-349.391] (-348.247) * [-348.588] (-346.676) (-347.056) (-346.958) -- 0:00:44
      288500 -- [-346.436] (-348.268) (-346.139) (-348.354) * (-347.118) (-347.865) [-345.835] (-346.937) -- 0:00:44
      289000 -- (-349.689) [-347.229] (-345.718) (-346.309) * (-347.605) (-353.376) [-346.380] (-347.586) -- 0:00:44
      289500 -- (-353.954) [-346.041] (-347.024) (-345.285) * (-356.406) (-345.458) (-346.186) [-346.652] -- 0:00:44
      290000 -- (-350.000) (-345.724) [-348.700] (-350.207) * (-346.421) (-346.611) [-345.258] (-349.537) -- 0:00:44

      Average standard deviation of split frequencies: 0.015858

      290500 -- (-345.592) (-347.174) (-348.434) [-350.601] * (-347.705) (-347.323) (-345.357) [-348.567] -- 0:00:43
      291000 -- (-346.767) (-347.382) [-347.069] (-347.971) * (-345.064) (-345.315) [-347.344] (-346.006) -- 0:00:43
      291500 -- (-350.544) [-348.435] (-352.746) (-348.330) * [-348.537] (-350.130) (-349.284) (-351.352) -- 0:00:43
      292000 -- (-349.542) (-346.079) (-350.209) [-348.827] * [-345.841] (-347.068) (-345.373) (-350.208) -- 0:00:43
      292500 -- (-346.763) [-345.554] (-348.356) (-345.710) * [-346.534] (-345.542) (-346.230) (-347.850) -- 0:00:43
      293000 -- (-346.127) [-346.035] (-351.816) (-347.222) * (-347.157) (-351.676) (-346.925) [-346.567] -- 0:00:43
      293500 -- (-346.028) [-348.502] (-345.696) (-345.979) * [-345.918] (-352.313) (-347.299) (-348.615) -- 0:00:43
      294000 -- (-356.232) (-348.053) [-345.720] (-345.646) * (-347.878) (-351.566) [-346.213] (-349.149) -- 0:00:43
      294500 -- (-348.942) [-347.991] (-345.733) (-345.355) * (-347.279) [-349.851] (-351.659) (-347.656) -- 0:00:43
      295000 -- (-347.186) (-345.602) [-348.695] (-352.444) * (-348.625) (-347.577) [-346.888] (-346.243) -- 0:00:43

      Average standard deviation of split frequencies: 0.016722

      295500 -- [-349.802] (-347.134) (-348.673) (-347.257) * (-346.721) (-347.331) [-349.340] (-347.413) -- 0:00:42
      296000 -- (-351.272) (-346.859) [-347.943] (-347.928) * (-349.753) (-349.684) [-349.416] (-345.311) -- 0:00:42
      296500 -- [-346.065] (-350.829) (-347.241) (-345.452) * (-348.188) (-347.406) (-347.624) [-351.428] -- 0:00:42
      297000 -- (-347.259) [-350.585] (-346.247) (-347.950) * (-348.191) [-348.703] (-353.970) (-349.757) -- 0:00:42
      297500 -- (-345.095) (-349.719) [-344.978] (-347.839) * (-350.802) (-349.336) (-355.320) [-347.466] -- 0:00:42
      298000 -- (-346.936) [-346.242] (-346.563) (-348.668) * (-347.900) (-348.451) [-347.801] (-346.300) -- 0:00:42
      298500 -- (-346.455) [-350.017] (-346.789) (-346.850) * (-346.693) (-348.103) (-346.826) [-350.140] -- 0:00:42
      299000 -- (-346.176) (-347.381) (-349.919) [-345.143] * (-346.663) (-346.616) [-348.632] (-347.814) -- 0:00:44
      299500 -- (-344.808) [-347.450] (-344.872) (-348.495) * [-346.980] (-345.462) (-349.085) (-347.076) -- 0:00:44
      300000 -- (-345.701) (-347.524) [-349.894] (-351.740) * (-348.425) (-348.174) (-347.749) [-348.514] -- 0:00:44

      Average standard deviation of split frequencies: 0.016637

      300500 -- [-345.438] (-345.708) (-346.448) (-348.980) * (-347.764) (-346.991) [-345.690] (-347.160) -- 0:00:44
      301000 -- (-345.090) [-345.262] (-346.811) (-350.185) * [-347.596] (-350.890) (-347.657) (-347.243) -- 0:00:44
      301500 -- (-350.024) (-348.794) (-345.601) [-348.545] * (-346.430) [-349.862] (-346.313) (-345.620) -- 0:00:44
      302000 -- (-346.515) (-346.510) (-346.143) [-347.852] * (-348.577) [-348.607] (-346.567) (-345.545) -- 0:00:43
      302500 -- (-345.473) [-347.939] (-351.223) (-347.797) * (-345.014) [-347.891] (-346.119) (-345.798) -- 0:00:43
      303000 -- (-348.210) (-350.391) (-348.813) [-346.053] * (-347.784) (-348.983) (-346.800) [-347.603] -- 0:00:43
      303500 -- [-344.771] (-349.644) (-347.718) (-345.270) * [-349.665] (-350.514) (-345.773) (-347.188) -- 0:00:43
      304000 -- (-348.635) (-348.219) [-347.170] (-351.500) * [-348.134] (-350.235) (-345.122) (-347.681) -- 0:00:43
      304500 -- (-349.622) (-350.541) (-348.367) [-345.703] * (-348.945) (-348.779) [-346.256] (-345.031) -- 0:00:43
      305000 -- (-348.079) (-351.041) [-347.549] (-345.903) * (-350.488) (-345.626) [-345.618] (-344.855) -- 0:00:43

      Average standard deviation of split frequencies: 0.016054

      305500 -- (-348.279) [-347.190] (-346.201) (-347.465) * (-348.608) [-347.664] (-347.156) (-346.939) -- 0:00:43
      306000 -- (-348.602) (-344.993) (-345.841) [-345.865] * (-347.982) (-347.763) [-345.829] (-346.050) -- 0:00:43
      306500 -- (-346.462) (-345.876) [-346.200] (-346.352) * (-350.277) (-347.153) (-351.913) [-345.239] -- 0:00:42
      307000 -- (-348.355) [-346.825] (-347.914) (-350.078) * (-347.514) (-347.651) (-346.653) [-346.920] -- 0:00:42
      307500 -- (-348.349) (-346.777) [-351.086] (-347.088) * [-346.944] (-346.900) (-345.152) (-347.502) -- 0:00:42
      308000 -- (-349.362) (-345.678) (-346.672) [-347.519] * (-345.468) (-347.768) (-346.331) [-344.909] -- 0:00:42
      308500 -- (-346.657) (-348.209) [-348.357] (-348.828) * (-345.322) (-345.987) [-347.047] (-345.557) -- 0:00:42
      309000 -- [-346.638] (-346.701) (-348.714) (-348.137) * (-345.239) (-346.581) (-346.340) [-347.672] -- 0:00:42
      309500 -- (-346.063) (-346.066) (-348.265) [-349.011] * (-346.982) (-346.635) (-345.740) [-348.112] -- 0:00:42
      310000 -- (-347.775) [-345.184] (-348.395) (-347.925) * (-345.680) [-349.005] (-348.594) (-345.518) -- 0:00:42

      Average standard deviation of split frequencies: 0.016186

      310500 -- [-348.490] (-347.268) (-352.313) (-348.416) * (-347.047) [-347.067] (-346.697) (-346.813) -- 0:00:42
      311000 -- (-347.715) (-346.899) [-348.459] (-348.881) * [-347.092] (-345.446) (-345.585) (-348.514) -- 0:00:42
      311500 -- [-348.995] (-345.881) (-347.402) (-347.594) * [-348.371] (-347.667) (-348.192) (-346.436) -- 0:00:41
      312000 -- (-349.282) [-345.665] (-345.867) (-350.419) * (-346.224) [-345.739] (-350.476) (-347.242) -- 0:00:41
      312500 -- (-348.971) (-346.680) (-349.026) [-346.960] * (-348.790) [-349.314] (-346.434) (-349.408) -- 0:00:41
      313000 -- (-344.784) (-347.148) [-345.193] (-346.738) * (-346.240) [-346.368] (-350.149) (-347.391) -- 0:00:41
      313500 -- (-346.876) [-347.916] (-345.196) (-349.223) * [-346.584] (-348.770) (-348.999) (-345.184) -- 0:00:41
      314000 -- [-346.032] (-347.976) (-349.223) (-350.077) * (-346.150) (-347.475) (-348.146) [-344.901] -- 0:00:41
      314500 -- (-346.386) (-345.304) (-348.041) [-349.322] * (-352.154) (-345.457) (-348.510) [-347.085] -- 0:00:41
      315000 -- [-347.145] (-345.849) (-345.919) (-348.038) * (-346.593) [-346.742] (-351.282) (-345.510) -- 0:00:41

      Average standard deviation of split frequencies: 0.014835

      315500 -- (-346.179) (-346.523) [-345.397] (-347.472) * [-346.546] (-346.298) (-345.917) (-347.037) -- 0:00:41
      316000 -- [-347.950] (-346.595) (-345.955) (-345.218) * (-349.940) [-345.662] (-345.772) (-348.544) -- 0:00:41
      316500 -- (-345.889) (-346.272) (-348.239) [-348.359] * (-345.193) (-347.639) (-347.861) [-350.335] -- 0:00:43
      317000 -- (-346.026) (-347.191) (-346.540) [-345.477] * (-347.860) [-346.954] (-346.176) (-348.492) -- 0:00:43
      317500 -- [-344.967] (-345.954) (-349.295) (-348.469) * (-348.067) [-346.271] (-347.829) (-348.132) -- 0:00:42
      318000 -- [-346.749] (-345.671) (-348.648) (-346.822) * (-347.437) (-345.271) [-346.020] (-348.510) -- 0:00:42
      318500 -- (-345.073) (-345.700) [-344.818] (-347.217) * [-347.059] (-348.419) (-346.165) (-347.545) -- 0:00:42
      319000 -- (-349.282) [-346.405] (-347.674) (-345.699) * (-345.279) (-349.578) (-347.366) [-353.053] -- 0:00:42
      319500 -- (-345.110) (-345.146) (-345.962) [-346.686] * (-345.169) (-346.468) (-350.532) [-347.250] -- 0:00:42
      320000 -- (-345.955) [-347.688] (-347.120) (-346.104) * (-346.386) [-346.898] (-349.865) (-345.234) -- 0:00:42

      Average standard deviation of split frequencies: 0.014469

      320500 -- (-348.928) [-346.550] (-350.613) (-348.058) * (-347.722) (-347.564) (-349.885) [-347.524] -- 0:00:42
      321000 -- (-345.142) (-347.736) (-349.904) [-345.486] * (-349.445) (-352.265) [-346.700] (-348.412) -- 0:00:42
      321500 -- (-351.543) [-346.560] (-345.004) (-345.273) * (-350.776) (-346.906) [-346.770] (-348.500) -- 0:00:42
      322000 -- (-354.475) (-345.921) [-345.701] (-347.283) * (-346.404) (-347.114) [-345.636] (-347.094) -- 0:00:42
      322500 -- (-351.477) [-347.804] (-348.137) (-346.272) * [-347.786] (-348.890) (-348.164) (-350.515) -- 0:00:42
      323000 -- (-354.440) (-346.844) (-348.343) [-347.243] * [-347.142] (-346.813) (-348.583) (-347.814) -- 0:00:41
      323500 -- (-346.355) [-346.064] (-349.303) (-350.325) * (-347.495) [-346.755] (-347.240) (-351.230) -- 0:00:41
      324000 -- (-346.573) (-349.041) [-346.227] (-348.623) * [-345.565] (-350.119) (-345.730) (-347.169) -- 0:00:41
      324500 -- (-352.535) (-346.426) [-345.751] (-350.268) * (-347.590) (-347.669) (-345.441) [-346.435] -- 0:00:41
      325000 -- (-351.251) [-347.102] (-347.061) (-346.610) * (-345.731) (-347.870) (-346.846) [-346.783] -- 0:00:41

      Average standard deviation of split frequencies: 0.014612

      325500 -- (-348.034) (-346.814) [-346.426] (-345.687) * [-348.540] (-349.798) (-346.498) (-348.521) -- 0:00:41
      326000 -- [-348.292] (-348.544) (-346.153) (-349.217) * (-346.384) [-348.252] (-348.702) (-350.993) -- 0:00:41
      326500 -- [-346.047] (-347.110) (-345.876) (-348.654) * (-345.984) [-346.885] (-349.059) (-348.197) -- 0:00:41
      327000 -- [-349.297] (-349.431) (-345.316) (-348.869) * (-345.669) (-345.925) [-346.032] (-347.008) -- 0:00:41
      327500 -- [-346.646] (-347.724) (-346.995) (-348.840) * (-347.783) [-348.959] (-345.553) (-349.005) -- 0:00:41
      328000 -- [-348.683] (-345.493) (-345.309) (-347.617) * [-346.459] (-351.969) (-345.283) (-346.750) -- 0:00:40
      328500 -- (-349.138) (-345.547) [-345.053] (-345.289) * (-345.620) (-346.572) (-347.801) [-347.325] -- 0:00:40
      329000 -- (-352.936) (-345.776) (-346.731) [-345.352] * (-348.194) (-350.848) (-347.094) [-346.283] -- 0:00:40
      329500 -- (-352.496) [-345.093] (-350.975) (-350.522) * (-346.411) (-346.874) (-349.321) [-344.983] -- 0:00:40
      330000 -- (-348.613) [-346.579] (-349.361) (-346.303) * [-346.375] (-349.647) (-345.897) (-347.340) -- 0:00:40

      Average standard deviation of split frequencies: 0.013356

      330500 -- (-349.031) (-345.184) (-348.000) [-347.059] * (-346.044) [-345.591] (-346.896) (-346.637) -- 0:00:40
      331000 -- [-348.839] (-346.291) (-346.604) (-347.317) * (-348.086) (-346.138) (-346.353) [-345.891] -- 0:00:40
      331500 -- (-345.837) (-347.533) [-346.300] (-349.701) * (-348.356) (-345.815) (-348.553) [-347.919] -- 0:00:40
      332000 -- (-348.346) [-346.041] (-345.639) (-351.514) * (-347.539) (-349.040) [-345.240] (-346.963) -- 0:00:40
      332500 -- [-345.031] (-345.729) (-348.868) (-348.938) * (-345.794) [-345.305] (-345.219) (-347.072) -- 0:00:40
      333000 -- (-349.593) (-346.158) (-347.433) [-348.722] * (-345.296) (-345.239) [-347.357] (-348.116) -- 0:00:40
      333500 -- (-345.975) (-345.769) [-346.555] (-345.726) * (-349.353) (-345.940) [-347.029] (-347.472) -- 0:00:41
      334000 -- (-345.998) (-345.515) (-347.723) [-350.590] * (-347.978) (-347.423) (-346.733) [-345.824] -- 0:00:41
      334500 -- (-346.595) (-347.851) [-349.334] (-349.498) * (-347.553) [-349.591] (-346.978) (-350.642) -- 0:00:41
      335000 -- [-346.697] (-345.271) (-349.691) (-348.666) * (-348.550) (-347.871) [-345.012] (-347.793) -- 0:00:41

      Average standard deviation of split frequencies: 0.012036

      335500 -- [-347.262] (-350.567) (-346.577) (-348.612) * (-346.044) (-347.178) [-349.393] (-346.801) -- 0:00:41
      336000 -- (-345.548) [-348.076] (-345.539) (-348.738) * (-347.793) [-346.617] (-345.788) (-348.122) -- 0:00:41
      336500 -- [-346.618] (-348.306) (-353.521) (-348.601) * (-347.733) (-349.983) (-345.626) [-347.017] -- 0:00:41
      337000 -- (-347.701) [-347.931] (-346.796) (-346.530) * (-345.370) (-346.592) (-349.344) [-347.230] -- 0:00:41
      337500 -- (-351.628) (-346.786) [-350.891] (-345.369) * (-346.049) [-345.254] (-348.907) (-348.598) -- 0:00:41
      338000 -- (-345.573) [-346.429] (-345.922) (-345.658) * [-349.483] (-347.281) (-347.158) (-346.083) -- 0:00:41
      338500 -- (-345.982) [-348.282] (-347.499) (-347.022) * (-349.108) [-346.517] (-347.790) (-347.420) -- 0:00:41
      339000 -- [-345.424] (-349.713) (-348.552) (-351.598) * (-346.701) (-345.853) (-347.192) [-346.942] -- 0:00:40
      339500 -- (-349.563) (-346.924) (-346.757) [-345.146] * (-348.476) (-347.901) (-347.054) [-348.768] -- 0:00:40
      340000 -- (-350.727) [-346.293] (-346.359) (-350.475) * (-345.409) (-345.529) [-347.663] (-347.641) -- 0:00:40

      Average standard deviation of split frequencies: 0.012090

      340500 -- (-347.570) [-345.477] (-347.729) (-346.496) * (-346.770) (-349.048) [-345.347] (-349.270) -- 0:00:40
      341000 -- [-347.278] (-345.926) (-349.116) (-347.081) * (-347.555) (-350.317) (-347.808) [-347.776] -- 0:00:40
      341500 -- (-347.529) (-345.007) (-347.739) [-348.079] * (-346.007) (-348.596) [-345.305] (-346.834) -- 0:00:40
      342000 -- (-347.967) (-345.484) [-346.248] (-351.027) * (-345.449) (-349.032) [-351.321] (-348.953) -- 0:00:40
      342500 -- (-346.986) (-347.038) (-345.924) [-347.073] * (-348.809) (-347.997) [-346.338] (-349.350) -- 0:00:40
      343000 -- [-348.364] (-345.717) (-347.371) (-346.774) * (-347.465) (-347.418) (-347.326) [-349.073] -- 0:00:40
      343500 -- (-347.390) [-345.708] (-346.365) (-345.863) * (-345.160) [-346.867] (-345.686) (-353.402) -- 0:00:40
      344000 -- (-351.612) [-348.078] (-345.664) (-345.372) * [-346.211] (-348.921) (-346.665) (-345.151) -- 0:00:40
      344500 -- (-346.448) (-346.604) [-346.817] (-345.192) * (-347.642) (-352.423) [-348.280] (-346.741) -- 0:00:39
      345000 -- [-350.910] (-347.271) (-345.932) (-346.241) * (-348.116) (-345.083) (-349.783) [-351.789] -- 0:00:39

      Average standard deviation of split frequencies: 0.011330

      345500 -- [-353.420] (-346.216) (-346.341) (-349.916) * (-347.782) [-345.536] (-345.294) (-347.686) -- 0:00:39
      346000 -- (-349.760) [-348.855] (-349.683) (-346.608) * (-347.592) (-346.662) [-346.617] (-349.065) -- 0:00:39
      346500 -- (-347.195) (-348.435) (-346.957) [-345.640] * [-346.027] (-352.137) (-348.978) (-351.536) -- 0:00:39
      347000 -- (-347.535) (-346.146) (-346.969) [-347.713] * [-349.872] (-349.354) (-347.211) (-349.465) -- 0:00:39
      347500 -- (-346.188) [-349.137] (-347.418) (-349.788) * (-348.553) (-346.235) [-346.342] (-353.563) -- 0:00:39
      348000 -- (-349.166) (-354.656) (-345.787) [-346.255] * (-346.854) (-347.630) [-348.144] (-351.279) -- 0:00:39
      348500 -- (-346.993) (-345.195) (-346.060) [-346.180] * (-346.327) [-345.659] (-348.129) (-346.574) -- 0:00:39
      349000 -- [-346.206] (-345.524) (-347.949) (-345.399) * [-346.050] (-346.823) (-345.468) (-346.360) -- 0:00:39
      349500 -- (-347.172) (-345.127) (-349.219) [-346.433] * [-349.804] (-345.620) (-349.049) (-348.569) -- 0:00:39
      350000 -- (-344.931) [-347.200] (-346.452) (-349.463) * [-346.755] (-346.612) (-345.740) (-350.682) -- 0:00:39

      Average standard deviation of split frequencies: 0.010967

      350500 -- (-345.905) [-346.961] (-346.493) (-347.697) * [-348.119] (-346.292) (-346.248) (-347.083) -- 0:00:38
      351000 -- (-347.488) [-346.597] (-349.377) (-346.613) * (-348.942) [-348.032] (-346.226) (-345.998) -- 0:00:40
      351500 -- (-346.988) [-346.572] (-349.666) (-345.466) * (-348.660) (-349.033) (-348.793) [-346.159] -- 0:00:40
      352000 -- [-346.945] (-347.804) (-349.388) (-345.446) * (-349.479) (-349.953) [-345.179] (-347.775) -- 0:00:40
      352500 -- (-346.294) (-346.487) (-347.614) [-345.668] * [-345.320] (-349.794) (-345.620) (-347.257) -- 0:00:40
      353000 -- [-353.037] (-347.318) (-346.581) (-348.312) * (-346.861) (-349.800) (-345.374) [-347.210] -- 0:00:40
      353500 -- [-348.771] (-346.791) (-345.895) (-345.329) * (-352.025) (-345.430) [-346.939] (-346.708) -- 0:00:40
      354000 -- [-352.877] (-348.365) (-346.944) (-345.618) * (-346.052) (-348.164) [-346.456] (-346.092) -- 0:00:40
      354500 -- (-346.566) (-349.164) [-348.231] (-346.857) * (-349.488) (-346.188) [-345.715] (-349.543) -- 0:00:40
      355000 -- (-348.656) [-345.614] (-346.641) (-346.147) * (-349.957) [-346.520] (-347.123) (-345.733) -- 0:00:39

      Average standard deviation of split frequencies: 0.011708

      355500 -- (-345.358) (-346.658) [-345.439] (-345.118) * (-346.208) (-345.427) [-347.845] (-346.425) -- 0:00:39
      356000 -- (-345.809) (-347.585) [-346.402] (-345.592) * (-346.944) (-349.553) [-346.060] (-345.315) -- 0:00:39
      356500 -- (-349.117) [-346.736] (-348.703) (-344.691) * (-347.530) [-345.731] (-348.695) (-347.218) -- 0:00:39
      357000 -- (-346.046) (-347.760) [-347.562] (-347.207) * (-345.884) (-346.383) (-351.063) [-346.279] -- 0:00:39
      357500 -- [-344.891] (-347.194) (-349.431) (-346.663) * (-347.566) [-348.884] (-349.649) (-345.064) -- 0:00:39
      358000 -- (-346.613) (-347.405) [-345.578] (-349.214) * (-352.471) [-347.675] (-347.555) (-348.069) -- 0:00:39
      358500 -- (-346.206) (-346.373) [-345.309] (-345.494) * (-350.569) [-347.700] (-345.216) (-347.532) -- 0:00:39
      359000 -- (-346.058) (-346.335) [-347.339] (-346.788) * [-352.991] (-350.554) (-347.383) (-349.788) -- 0:00:39
      359500 -- (-345.199) (-345.579) [-347.484] (-346.463) * [-346.788] (-346.230) (-348.746) (-346.777) -- 0:00:39
      360000 -- (-346.464) (-345.663) [-345.500] (-349.000) * (-351.385) [-347.712] (-346.386) (-347.085) -- 0:00:39

      Average standard deviation of split frequencies: 0.011351

      360500 -- (-345.294) [-346.583] (-345.530) (-348.345) * [-347.216] (-345.544) (-349.179) (-350.214) -- 0:00:39
      361000 -- [-347.094] (-345.757) (-350.333) (-345.699) * [-347.996] (-346.899) (-348.259) (-344.937) -- 0:00:38
      361500 -- (-347.934) [-347.370] (-348.052) (-347.217) * (-346.533) [-347.764] (-347.679) (-346.350) -- 0:00:38
      362000 -- (-345.985) (-347.882) [-347.667] (-348.819) * [-345.061] (-346.321) (-348.430) (-345.395) -- 0:00:38
      362500 -- [-347.412] (-346.521) (-346.988) (-350.368) * (-348.961) (-347.768) [-349.151] (-344.942) -- 0:00:38
      363000 -- (-347.331) [-347.003] (-345.013) (-346.795) * (-348.543) (-347.783) [-347.175] (-347.293) -- 0:00:38
      363500 -- (-345.874) (-348.354) (-346.782) [-348.740] * (-347.496) (-346.443) (-346.238) [-346.665] -- 0:00:38
      364000 -- (-346.032) [-348.080] (-349.504) (-345.991) * (-348.267) [-345.453] (-348.520) (-347.237) -- 0:00:38
      364500 -- (-347.644) (-346.830) [-347.715] (-348.757) * (-353.249) (-346.321) [-346.910] (-346.033) -- 0:00:38
      365000 -- [-351.033] (-346.640) (-345.900) (-351.636) * (-346.642) (-346.957) [-345.327] (-349.152) -- 0:00:38

      Average standard deviation of split frequencies: 0.010711

      365500 -- (-347.396) (-347.118) (-347.558) [-346.442] * (-345.550) (-345.089) [-347.216] (-347.611) -- 0:00:38
      366000 -- (-346.598) (-348.448) (-345.504) [-348.452] * (-348.289) [-346.006] (-346.283) (-347.294) -- 0:00:38
      366500 -- (-345.114) [-347.349] (-348.391) (-345.730) * (-347.260) (-345.613) [-347.435] (-344.981) -- 0:00:38
      367000 -- (-346.997) [-349.798] (-350.609) (-350.293) * (-347.267) [-346.623] (-346.058) (-346.578) -- 0:00:37
      367500 -- (-346.625) [-345.007] (-351.423) (-347.516) * (-350.628) [-345.759] (-346.581) (-346.276) -- 0:00:37
      368000 -- [-346.513] (-346.425) (-347.692) (-349.130) * (-350.263) (-347.026) (-349.023) [-347.483] -- 0:00:39
      368500 -- (-345.583) (-348.472) [-348.496] (-346.863) * (-345.066) [-345.770] (-347.581) (-348.251) -- 0:00:39
      369000 -- (-346.420) (-346.549) [-350.677] (-348.641) * (-349.208) [-348.515] (-347.175) (-348.114) -- 0:00:39
      369500 -- (-347.067) (-346.815) [-348.521] (-346.130) * (-346.705) [-346.878] (-347.140) (-347.600) -- 0:00:39
      370000 -- (-347.932) [-349.269] (-351.667) (-351.009) * [-346.724] (-351.712) (-347.976) (-349.173) -- 0:00:39

      Average standard deviation of split frequencies: 0.010777

      370500 -- (-352.724) (-350.126) (-350.483) [-347.289] * (-347.513) [-348.401] (-349.114) (-347.126) -- 0:00:39
      371000 -- [-346.482] (-351.034) (-347.129) (-347.042) * (-345.941) [-349.925] (-346.300) (-346.689) -- 0:00:38
      371500 -- [-348.359] (-345.142) (-346.879) (-347.868) * (-346.497) (-346.966) (-346.810) [-346.280] -- 0:00:38
      372000 -- (-347.552) (-344.968) [-346.637] (-352.347) * (-345.509) (-352.284) (-348.133) [-345.907] -- 0:00:38
      372500 -- [-345.915] (-346.031) (-349.294) (-346.603) * (-345.220) (-348.151) (-348.193) [-345.402] -- 0:00:38
      373000 -- [-346.011] (-346.427) (-346.609) (-347.546) * (-347.305) (-347.412) [-345.401] (-345.629) -- 0:00:38
      373500 -- (-348.130) (-345.561) (-346.810) [-347.238] * [-345.076] (-353.476) (-345.318) (-344.961) -- 0:00:38
      374000 -- [-345.378] (-350.420) (-346.153) (-347.030) * [-345.947] (-348.330) (-345.994) (-346.917) -- 0:00:38
      374500 -- [-348.520] (-348.054) (-347.928) (-347.346) * (-345.318) [-348.802] (-345.487) (-345.266) -- 0:00:38
      375000 -- (-346.363) (-346.033) [-346.603] (-346.076) * (-346.700) (-345.020) [-345.298] (-345.392) -- 0:00:38

      Average standard deviation of split frequencies: 0.010426

      375500 -- (-348.885) (-347.533) (-348.637) [-346.563] * (-347.933) (-347.646) [-345.235] (-346.453) -- 0:00:38
      376000 -- (-346.037) (-350.147) (-347.866) [-346.829] * (-347.388) (-348.213) (-347.248) [-345.284] -- 0:00:38
      376500 -- (-351.098) (-348.660) (-346.555) [-345.648] * [-347.180] (-346.537) (-345.628) (-346.339) -- 0:00:38
      377000 -- (-346.433) (-347.392) [-347.976] (-345.219) * (-347.285) (-349.717) [-347.249] (-347.361) -- 0:00:38
      377500 -- [-346.844] (-347.202) (-345.064) (-353.050) * (-346.325) [-354.691] (-346.972) (-347.180) -- 0:00:37
      378000 -- [-346.030] (-348.370) (-345.487) (-346.789) * (-345.581) (-346.574) (-345.126) [-346.049] -- 0:00:37
      378500 -- [-347.542] (-351.757) (-348.807) (-347.302) * [-346.223] (-345.087) (-346.481) (-346.637) -- 0:00:37
      379000 -- (-348.310) [-345.061] (-347.630) (-348.207) * (-347.849) (-345.340) [-345.175] (-346.814) -- 0:00:37
      379500 -- [-347.086] (-346.077) (-348.267) (-348.697) * (-346.675) (-346.220) (-345.339) [-348.433] -- 0:00:37
      380000 -- (-346.671) (-345.450) (-345.534) [-348.728] * (-349.833) (-348.907) [-346.808] (-347.633) -- 0:00:37

      Average standard deviation of split frequencies: 0.010298

      380500 -- (-347.546) [-346.737] (-349.331) (-346.211) * (-347.410) (-347.904) [-346.234] (-348.610) -- 0:00:37
      381000 -- [-346.583] (-347.706) (-347.974) (-346.870) * (-349.539) (-349.706) (-345.841) [-347.176] -- 0:00:37
      381500 -- (-345.522) (-353.725) (-347.150) [-349.963] * (-345.741) (-346.751) [-347.402] (-348.129) -- 0:00:37
      382000 -- [-345.935] (-347.997) (-347.810) (-348.806) * (-350.760) [-345.677] (-348.530) (-347.763) -- 0:00:37
      382500 -- (-347.944) (-346.530) [-347.417] (-348.248) * (-347.532) (-347.145) (-348.130) [-346.965] -- 0:00:37
      383000 -- (-345.192) [-347.765] (-346.223) (-347.198) * (-347.841) (-350.048) (-346.939) [-349.920] -- 0:00:37
      383500 -- [-345.485] (-347.512) (-347.016) (-345.911) * [-345.441] (-346.754) (-346.002) (-345.001) -- 0:00:36
      384000 -- [-347.276] (-346.915) (-346.877) (-350.458) * (-346.522) [-345.781] (-345.339) (-346.796) -- 0:00:36
      384500 -- (-348.958) (-348.832) [-346.898] (-349.380) * [-348.727] (-349.575) (-347.860) (-347.126) -- 0:00:36
      385000 -- (-345.957) [-348.028] (-346.063) (-346.395) * (-349.456) (-353.273) (-345.871) [-345.945] -- 0:00:36

      Average standard deviation of split frequencies: 0.010413

      385500 -- (-347.696) (-347.537) [-348.168] (-346.331) * [-346.737] (-352.711) (-350.569) (-346.375) -- 0:00:38
      386000 -- (-347.746) [-346.494] (-344.946) (-349.226) * [-346.283] (-347.279) (-353.267) (-347.978) -- 0:00:38
      386500 -- (-347.487) (-346.827) [-346.996] (-345.437) * [-345.545] (-346.003) (-353.538) (-345.669) -- 0:00:38
      387000 -- (-347.707) [-347.373] (-347.678) (-346.509) * (-347.241) (-346.785) [-349.833] (-353.373) -- 0:00:38
      387500 -- (-347.483) (-346.062) [-347.205] (-346.898) * (-347.089) (-346.036) [-345.449] (-352.853) -- 0:00:37
      388000 -- [-345.436] (-346.680) (-347.787) (-347.214) * [-349.415] (-345.578) (-347.398) (-349.270) -- 0:00:37
      388500 -- (-345.743) (-346.627) (-345.054) [-345.497] * (-348.904) (-344.931) (-353.537) [-346.491] -- 0:00:37
      389000 -- (-349.100) (-348.786) [-350.015] (-349.479) * [-348.590] (-346.940) (-348.979) (-348.467) -- 0:00:37
      389500 -- [-346.528] (-348.817) (-347.472) (-350.496) * (-346.158) (-347.974) [-350.389] (-346.733) -- 0:00:37
      390000 -- (-346.031) (-346.917) [-346.514] (-348.268) * (-345.768) (-348.740) (-346.802) [-347.186] -- 0:00:37

      Average standard deviation of split frequencies: 0.010415

      390500 -- (-346.840) [-348.110] (-345.930) (-349.130) * (-346.392) (-347.718) (-348.836) [-347.678] -- 0:00:37
      391000 -- (-345.757) (-347.537) (-345.766) [-346.265] * (-346.457) (-348.573) [-346.899] (-346.288) -- 0:00:37
      391500 -- [-353.074] (-346.359) (-352.096) (-346.568) * (-345.913) (-351.757) [-345.294] (-346.868) -- 0:00:37
      392000 -- (-347.849) (-346.172) [-348.629] (-347.327) * [-349.081] (-345.504) (-346.708) (-350.129) -- 0:00:37
      392500 -- (-350.239) (-347.424) (-349.354) [-347.456] * [-347.641] (-345.684) (-346.729) (-348.804) -- 0:00:37
      393000 -- [-345.530] (-345.189) (-353.761) (-346.343) * (-350.700) [-348.376] (-346.227) (-345.655) -- 0:00:37
      393500 -- [-346.166] (-348.241) (-345.172) (-347.312) * (-350.819) (-347.120) (-348.510) [-346.667] -- 0:00:36
      394000 -- (-353.188) (-346.405) (-345.729) [-345.812] * (-351.197) (-348.292) (-346.794) [-345.539] -- 0:00:36
      394500 -- (-349.789) (-346.513) (-347.707) [-346.680] * (-347.784) (-347.370) (-348.903) [-347.485] -- 0:00:36
      395000 -- [-349.946] (-344.893) (-346.535) (-345.861) * [-348.131] (-345.093) (-351.054) (-346.343) -- 0:00:36

      Average standard deviation of split frequencies: 0.010338

      395500 -- (-347.154) (-347.729) [-348.357] (-347.220) * (-349.080) [-348.836] (-348.278) (-347.162) -- 0:00:36
      396000 -- (-345.782) [-345.012] (-346.021) (-346.466) * (-348.803) (-346.456) (-349.359) [-345.495] -- 0:00:36
      396500 -- (-349.450) (-350.161) [-345.502] (-349.389) * (-349.126) [-345.430] (-347.946) (-345.878) -- 0:00:36
      397000 -- [-351.805] (-346.127) (-345.260) (-347.753) * [-345.701] (-347.332) (-346.209) (-346.334) -- 0:00:36
      397500 -- (-347.269) (-349.005) (-349.288) [-347.027] * (-345.227) (-347.018) [-346.388] (-345.053) -- 0:00:36
      398000 -- [-346.082] (-348.824) (-347.631) (-345.729) * (-346.827) (-346.025) (-353.067) [-346.070] -- 0:00:36
      398500 -- (-348.753) [-347.276] (-348.925) (-348.235) * (-348.266) (-352.059) (-346.699) [-344.952] -- 0:00:36
      399000 -- (-347.475) (-347.510) (-346.245) [-348.655] * (-347.616) (-348.230) (-351.105) [-346.353] -- 0:00:36
      399500 -- (-347.301) [-348.281] (-346.929) (-347.741) * (-347.062) (-345.539) (-349.044) [-345.457] -- 0:00:36
      400000 -- [-344.715] (-347.225) (-346.713) (-347.407) * (-347.157) (-347.311) (-346.101) [-345.329] -- 0:00:36

      Average standard deviation of split frequencies: 0.010403

      400500 -- [-345.737] (-349.110) (-349.622) (-348.064) * [-345.652] (-345.584) (-348.262) (-346.016) -- 0:00:35
      401000 -- (-347.432) (-347.393) [-345.199] (-349.092) * [-345.117] (-345.677) (-351.036) (-348.629) -- 0:00:35
      401500 -- (-345.356) (-346.033) [-345.947] (-347.677) * [-346.543] (-347.196) (-348.255) (-347.850) -- 0:00:35
      402000 -- (-345.761) [-345.727] (-347.418) (-346.248) * (-344.909) [-346.474] (-346.109) (-349.359) -- 0:00:35
      402500 -- (-346.191) [-347.428] (-347.326) (-348.010) * (-347.663) (-346.706) [-345.340] (-345.939) -- 0:00:37
      403000 -- [-345.656] (-347.316) (-348.764) (-349.179) * (-351.747) (-346.544) [-345.911] (-345.757) -- 0:00:37
      403500 -- [-346.707] (-346.140) (-346.728) (-345.453) * (-348.694) [-345.372] (-345.450) (-345.591) -- 0:00:36
      404000 -- (-347.354) [-345.553] (-347.821) (-345.772) * (-346.107) (-350.042) (-346.341) [-345.386] -- 0:00:36
      404500 -- (-347.568) [-345.886] (-347.489) (-347.191) * (-345.010) [-345.253] (-349.172) (-345.789) -- 0:00:36
      405000 -- (-347.199) (-346.348) [-345.323] (-347.155) * (-348.574) (-346.724) [-347.306] (-349.680) -- 0:00:36

      Average standard deviation of split frequencies: 0.010817

      405500 -- (-345.327) (-347.511) [-345.835] (-345.984) * [-345.577] (-348.247) (-349.091) (-348.027) -- 0:00:36
      406000 -- (-345.586) (-348.668) [-349.373] (-346.435) * (-348.511) (-346.661) (-347.753) [-346.611] -- 0:00:36
      406500 -- (-345.808) [-347.338] (-345.345) (-348.405) * [-347.753] (-345.485) (-346.392) (-346.422) -- 0:00:36
      407000 -- (-348.878) [-346.549] (-345.466) (-346.815) * (-351.187) [-345.803] (-348.580) (-349.232) -- 0:00:36
      407500 -- (-346.343) (-346.675) (-345.967) [-347.414] * (-345.361) [-346.054] (-345.718) (-349.874) -- 0:00:36
      408000 -- (-346.808) (-345.299) (-345.130) [-346.632] * (-346.185) (-345.880) (-347.198) [-347.368] -- 0:00:36
      408500 -- (-346.150) (-345.413) (-346.939) [-346.698] * [-346.899] (-348.889) (-347.193) (-345.827) -- 0:00:36
      409000 -- (-345.645) (-346.510) (-347.360) [-346.984] * [-346.325] (-346.399) (-347.809) (-345.775) -- 0:00:36
      409500 -- (-347.023) (-349.079) (-346.658) [-347.064] * (-346.361) (-346.589) [-346.238] (-345.516) -- 0:00:36
      410000 -- (-349.585) (-350.032) [-347.303] (-349.342) * (-348.654) (-346.063) (-346.896) [-348.853] -- 0:00:35

      Average standard deviation of split frequencies: 0.011056

      410500 -- (-345.986) [-348.522] (-346.079) (-349.565) * (-347.780) (-347.674) [-345.574] (-347.720) -- 0:00:35
      411000 -- [-346.128] (-347.117) (-345.320) (-348.000) * (-346.224) (-345.748) [-348.932] (-348.631) -- 0:00:35
      411500 -- [-346.043] (-348.453) (-345.694) (-347.801) * [-350.755] (-347.721) (-346.100) (-350.197) -- 0:00:35
      412000 -- (-346.840) [-345.288] (-346.720) (-345.316) * (-350.865) (-348.309) [-346.829] (-350.255) -- 0:00:35
      412500 -- [-347.307] (-347.028) (-347.198) (-345.772) * [-346.405] (-348.753) (-345.599) (-347.128) -- 0:00:35
      413000 -- (-346.933) [-348.380] (-346.637) (-345.959) * (-348.035) [-347.809] (-346.798) (-347.600) -- 0:00:35
      413500 -- (-349.705) (-349.204) (-345.868) [-350.797] * (-347.778) (-346.220) [-345.523] (-347.060) -- 0:00:35
      414000 -- (-353.740) [-345.411] (-351.312) (-351.873) * [-346.206] (-345.229) (-347.038) (-349.157) -- 0:00:35
      414500 -- [-346.554] (-347.770) (-349.620) (-347.678) * [-346.024] (-346.437) (-344.775) (-346.072) -- 0:00:35
      415000 -- [-346.511] (-346.695) (-346.453) (-348.371) * (-345.294) (-348.024) (-348.519) [-351.245] -- 0:00:35

      Average standard deviation of split frequencies: 0.010974

      415500 -- [-346.235] (-345.512) (-346.921) (-350.603) * (-345.815) (-348.710) (-347.269) [-346.418] -- 0:00:35
      416000 -- [-346.995] (-345.521) (-347.455) (-347.444) * (-346.314) (-348.248) [-348.993] (-346.862) -- 0:00:35
      416500 -- (-346.304) [-345.934] (-346.373) (-347.747) * (-345.188) [-347.220] (-346.328) (-344.865) -- 0:00:35
      417000 -- (-345.361) (-345.481) (-347.361) [-348.096] * (-345.026) (-350.446) [-346.879] (-348.627) -- 0:00:34
      417500 -- (-345.701) [-346.026] (-350.095) (-347.616) * [-346.626] (-356.255) (-349.305) (-346.409) -- 0:00:34
      418000 -- (-347.388) [-346.311] (-346.315) (-346.183) * (-346.074) (-358.979) [-347.639] (-348.669) -- 0:00:34
      418500 -- (-352.692) (-346.189) [-344.973] (-351.662) * [-349.490] (-351.107) (-346.818) (-347.017) -- 0:00:34
      419000 -- [-346.518] (-345.376) (-346.463) (-348.706) * (-347.833) [-346.540] (-345.443) (-345.804) -- 0:00:34
      419500 -- (-349.104) (-349.024) [-345.220] (-348.370) * (-347.677) (-350.180) (-346.257) [-347.116] -- 0:00:34
      420000 -- [-345.534] (-346.171) (-345.522) (-347.542) * [-345.702] (-346.898) (-347.063) (-345.471) -- 0:00:35

      Average standard deviation of split frequencies: 0.010557

      420500 -- (-348.475) (-345.461) (-345.694) [-347.581] * (-346.689) (-345.981) (-345.413) [-345.214] -- 0:00:35
      421000 -- (-348.005) [-345.538] (-346.914) (-345.857) * [-346.961] (-347.640) (-346.240) (-346.155) -- 0:00:35
      421500 -- (-345.735) (-346.902) (-345.994) [-348.209] * (-345.971) [-351.041] (-346.966) (-345.618) -- 0:00:35
      422000 -- (-349.594) (-350.105) (-346.889) [-346.595] * (-348.272) (-347.012) (-352.826) [-347.048] -- 0:00:35
      422500 -- (-347.949) [-347.540] (-344.799) (-348.323) * (-346.550) (-351.358) (-352.332) [-347.821] -- 0:00:35
      423000 -- (-350.051) (-350.108) [-347.035] (-349.081) * (-345.934) [-346.472] (-346.115) (-347.502) -- 0:00:35
      423500 -- (-345.848) [-349.305] (-346.813) (-346.451) * (-349.450) (-347.319) (-354.543) [-346.457] -- 0:00:35
      424000 -- (-347.540) (-349.755) [-347.196] (-348.202) * (-348.345) (-345.596) (-346.277) [-347.378] -- 0:00:35
      424500 -- (-348.023) (-347.661) (-349.056) [-347.733] * [-347.742] (-346.506) (-347.766) (-348.854) -- 0:00:35
      425000 -- (-347.201) (-349.215) [-348.431] (-348.285) * (-346.836) (-345.747) [-346.413] (-346.010) -- 0:00:35

      Average standard deviation of split frequencies: 0.010017

      425500 -- (-348.286) (-346.808) [-354.052] (-346.054) * [-351.472] (-345.760) (-347.505) (-350.314) -- 0:00:35
      426000 -- (-356.475) (-346.440) (-349.201) [-347.838] * (-348.594) (-350.394) [-348.167] (-349.283) -- 0:00:35
      426500 -- (-345.204) (-346.696) (-348.197) [-350.237] * [-345.696] (-349.856) (-352.222) (-349.596) -- 0:00:34
      427000 -- (-345.692) (-345.820) [-347.300] (-346.411) * (-346.385) (-349.831) (-345.852) [-346.480] -- 0:00:34
      427500 -- (-349.114) (-347.618) (-345.109) [-347.889] * [-345.998] (-349.039) (-346.206) (-347.456) -- 0:00:34
      428000 -- (-346.253) (-350.251) (-345.561) [-347.807] * (-347.267) [-347.122] (-347.551) (-348.053) -- 0:00:34
      428500 -- (-345.556) (-346.023) [-346.656] (-347.226) * (-349.369) (-347.001) (-346.231) [-347.697] -- 0:00:34
      429000 -- [-345.508] (-346.791) (-350.278) (-347.871) * [-348.070] (-350.284) (-349.214) (-346.142) -- 0:00:34
      429500 -- (-347.963) (-351.464) (-349.503) [-347.288] * (-351.582) (-350.373) (-346.311) [-347.248] -- 0:00:34
      430000 -- (-347.800) [-347.825] (-355.283) (-349.921) * (-349.861) (-350.939) [-349.752] (-348.164) -- 0:00:34

      Average standard deviation of split frequencies: 0.010831

      430500 -- (-350.057) (-347.088) (-351.326) [-347.342] * (-350.181) [-348.834] (-345.114) (-348.404) -- 0:00:34
      431000 -- (-347.845) [-348.411] (-347.201) (-351.397) * [-346.104] (-348.890) (-345.291) (-347.828) -- 0:00:34
      431500 -- [-345.918] (-348.748) (-348.358) (-345.986) * (-348.032) [-349.731] (-346.404) (-349.524) -- 0:00:34
      432000 -- (-345.867) (-346.585) [-346.079] (-345.796) * [-345.620] (-348.203) (-346.390) (-344.907) -- 0:00:34
      432500 -- (-349.379) (-346.005) (-347.104) [-349.764] * [-346.508] (-348.497) (-350.318) (-345.536) -- 0:00:34
      433000 -- (-346.788) (-345.240) [-346.172] (-349.244) * (-346.618) (-346.601) [-346.424] (-350.447) -- 0:00:34
      433500 -- (-345.293) (-350.896) (-350.378) [-346.703] * (-348.922) [-351.552] (-346.173) (-345.988) -- 0:00:33
      434000 -- (-348.698) [-346.085] (-345.947) (-345.842) * (-349.379) [-345.752] (-348.418) (-350.136) -- 0:00:33
      434500 -- [-345.583] (-348.941) (-348.245) (-346.641) * [-347.740] (-346.149) (-350.325) (-347.832) -- 0:00:33
      435000 -- [-348.407] (-348.088) (-347.413) (-348.251) * (-346.286) (-348.829) (-345.466) [-346.699] -- 0:00:33

      Average standard deviation of split frequencies: 0.009902

      435500 -- (-350.708) (-346.120) [-346.453] (-347.157) * [-345.397] (-348.497) (-346.742) (-350.830) -- 0:00:33
      436000 -- (-353.446) (-347.089) [-346.922] (-348.410) * (-348.525) (-345.157) [-347.686] (-346.660) -- 0:00:33
      436500 -- (-348.721) [-347.284] (-345.041) (-347.753) * (-351.101) (-351.706) [-349.352] (-345.539) -- 0:00:33
      437000 -- [-349.200] (-346.286) (-348.948) (-347.979) * (-346.031) (-346.271) [-346.846] (-346.668) -- 0:00:34
      437500 -- (-345.927) [-346.789] (-345.857) (-348.528) * (-346.581) [-346.218] (-348.415) (-345.782) -- 0:00:34
      438000 -- (-347.043) (-348.763) (-345.316) [-346.804] * (-351.049) [-346.640] (-347.456) (-348.070) -- 0:00:34
      438500 -- (-345.652) (-348.318) (-348.600) [-345.915] * (-357.250) (-351.148) (-345.953) [-348.126] -- 0:00:34
      439000 -- (-350.637) (-349.045) (-346.233) [-344.908] * (-347.926) (-349.100) (-348.604) [-347.417] -- 0:00:34
      439500 -- [-346.773] (-349.237) (-346.876) (-344.870) * (-348.151) (-348.417) (-345.426) [-347.093] -- 0:00:34
      440000 -- (-346.699) (-348.035) (-348.251) [-346.825] * (-345.795) (-345.207) (-353.012) [-346.088] -- 0:00:34

      Average standard deviation of split frequencies: 0.009568

      440500 -- (-346.563) (-348.194) (-348.561) [-346.762] * (-347.353) (-346.169) [-346.117] (-346.755) -- 0:00:34
      441000 -- [-345.603] (-347.850) (-348.296) (-349.455) * (-346.240) [-348.384] (-346.389) (-353.900) -- 0:00:34
      441500 -- (-346.655) [-345.559] (-353.874) (-351.726) * (-345.639) [-347.080] (-346.772) (-345.483) -- 0:00:34
      442000 -- (-346.484) [-347.503] (-351.473) (-346.764) * [-348.033] (-345.704) (-346.299) (-347.634) -- 0:00:34
      442500 -- [-346.898] (-345.052) (-347.736) (-345.643) * (-349.466) [-345.729] (-348.116) (-349.809) -- 0:00:34
      443000 -- (-349.289) (-344.858) (-346.157) [-348.299] * (-347.554) (-346.377) [-348.056] (-350.430) -- 0:00:33
      443500 -- (-346.907) (-346.735) (-351.117) [-348.500] * [-347.955] (-346.508) (-344.978) (-347.812) -- 0:00:33
      444000 -- (-349.529) (-348.252) (-350.740) [-349.145] * (-352.697) (-347.266) [-345.565] (-347.545) -- 0:00:33
      444500 -- [-350.055] (-349.719) (-348.589) (-347.203) * (-349.966) [-345.532] (-346.885) (-349.364) -- 0:00:33
      445000 -- (-346.126) (-346.841) (-345.724) [-346.606] * [-345.885] (-347.581) (-346.106) (-345.815) -- 0:00:33

      Average standard deviation of split frequencies: 0.009336

      445500 -- [-345.519] (-346.203) (-351.308) (-345.836) * (-344.854) (-348.023) [-348.300] (-348.138) -- 0:00:33
      446000 -- (-348.396) [-345.293] (-347.807) (-346.658) * [-345.000] (-347.957) (-352.839) (-347.486) -- 0:00:33
      446500 -- (-352.358) [-347.390] (-349.792) (-345.382) * (-346.674) [-345.784] (-349.866) (-346.549) -- 0:00:33
      447000 -- (-348.012) (-346.392) (-347.489) [-346.444] * (-346.423) (-345.318) [-345.974] (-347.320) -- 0:00:33
      447500 -- [-346.873] (-349.652) (-348.440) (-347.502) * (-347.050) (-347.117) [-346.549] (-350.277) -- 0:00:33
      448000 -- (-353.672) [-346.989] (-348.815) (-346.223) * [-345.783] (-352.676) (-349.862) (-349.183) -- 0:00:33
      448500 -- (-345.332) (-346.019) [-346.096] (-347.336) * (-346.753) (-345.880) [-349.109] (-348.483) -- 0:00:33
      449000 -- [-347.326] (-345.279) (-352.626) (-347.480) * [-346.758] (-347.209) (-345.883) (-350.184) -- 0:00:33
      449500 -- (-345.872) [-349.594] (-348.943) (-347.717) * [-348.913] (-346.690) (-350.903) (-346.871) -- 0:00:33
      450000 -- (-349.055) [-348.997] (-347.094) (-347.952) * (-349.159) (-345.324) (-349.302) [-346.494] -- 0:00:33

      Average standard deviation of split frequencies: 0.008891

      450500 -- [-345.762] (-346.095) (-345.752) (-346.552) * (-347.592) (-345.771) [-348.596] (-345.555) -- 0:00:32
      451000 -- (-352.091) (-346.805) [-346.668] (-348.396) * [-346.143] (-346.898) (-350.375) (-347.885) -- 0:00:32
      451500 -- (-349.730) (-347.559) (-345.834) [-347.208] * (-347.855) (-345.548) (-349.327) [-347.595] -- 0:00:32
      452000 -- (-348.372) (-348.637) (-347.447) [-347.715] * [-346.650] (-347.126) (-347.395) (-346.297) -- 0:00:32
      452500 -- (-346.094) (-348.668) (-345.842) [-346.363] * (-345.372) [-346.225] (-345.756) (-347.390) -- 0:00:32
      453000 -- [-345.710] (-348.581) (-345.102) (-346.987) * (-346.315) (-345.677) [-347.916] (-346.295) -- 0:00:32
      453500 -- [-347.513] (-346.231) (-346.393) (-345.856) * (-346.996) (-352.673) [-347.011] (-346.915) -- 0:00:32
      454000 -- [-348.585] (-345.521) (-351.254) (-349.749) * (-350.204) (-348.962) (-349.000) [-346.354] -- 0:00:33
      454500 -- [-345.834] (-347.808) (-346.515) (-346.489) * (-346.035) (-349.882) (-346.150) [-345.894] -- 0:00:33
      455000 -- [-345.264] (-346.214) (-349.940) (-346.704) * [-345.415] (-348.618) (-348.111) (-350.375) -- 0:00:33

      Average standard deviation of split frequencies: 0.009189

      455500 -- [-346.109] (-348.436) (-351.980) (-351.647) * (-346.751) (-350.083) [-348.178] (-347.326) -- 0:00:33
      456000 -- [-346.427] (-347.198) (-347.231) (-349.576) * (-345.086) [-349.866] (-349.142) (-346.635) -- 0:00:33
      456500 -- [-345.451] (-345.574) (-346.780) (-348.011) * (-345.453) (-350.374) [-346.114] (-349.146) -- 0:00:33
      457000 -- (-345.390) (-345.581) (-347.051) [-348.230] * (-347.388) (-347.178) (-346.370) [-349.033] -- 0:00:33
      457500 -- (-345.929) (-350.885) (-349.221) [-348.362] * (-350.606) (-347.940) [-347.190] (-350.614) -- 0:00:33
      458000 -- (-347.517) (-354.432) (-348.938) [-345.763] * (-348.678) (-347.349) [-347.073] (-350.923) -- 0:00:33
      458500 -- (-346.495) (-349.605) [-348.366] (-348.129) * (-350.714) (-345.347) (-346.046) [-352.038] -- 0:00:33
      459000 -- (-345.440) (-350.348) (-348.440) [-347.866] * (-352.356) (-348.109) [-346.091] (-349.820) -- 0:00:33
      459500 -- (-348.626) (-348.475) [-345.290] (-346.776) * (-347.181) [-345.743] (-346.685) (-350.289) -- 0:00:32
      460000 -- (-351.419) (-348.833) (-349.886) [-346.462] * (-345.948) (-347.622) [-348.421] (-350.227) -- 0:00:32

      Average standard deviation of split frequencies: 0.009096

      460500 -- (-348.484) [-346.234] (-351.132) (-346.604) * (-345.326) (-349.896) (-346.930) [-349.725] -- 0:00:32
      461000 -- (-351.804) (-347.090) [-347.430] (-348.024) * (-345.810) (-348.025) (-345.399) [-347.423] -- 0:00:32
      461500 -- (-346.436) [-346.546] (-349.512) (-346.763) * (-345.620) (-345.610) [-345.732] (-348.662) -- 0:00:32
      462000 -- [-347.951] (-345.555) (-345.110) (-345.572) * (-349.473) (-346.036) (-345.159) [-346.251] -- 0:00:32
      462500 -- (-345.922) (-346.601) (-348.703) [-346.369] * (-347.281) [-345.861] (-348.010) (-351.001) -- 0:00:32
      463000 -- [-347.812] (-345.670) (-346.354) (-344.866) * (-346.467) (-346.683) (-348.500) [-349.232] -- 0:00:32
      463500 -- (-346.462) [-346.229] (-346.544) (-346.112) * (-345.755) (-351.874) (-346.718) [-345.507] -- 0:00:32
      464000 -- (-347.144) (-345.921) [-347.404] (-345.727) * (-346.914) (-348.813) [-346.872] (-345.083) -- 0:00:32
      464500 -- [-345.252] (-346.118) (-349.649) (-345.295) * (-352.537) [-345.272] (-345.665) (-345.242) -- 0:00:32
      465000 -- (-346.746) [-345.190] (-347.087) (-346.492) * [-350.000] (-347.928) (-346.841) (-345.236) -- 0:00:32

      Average standard deviation of split frequencies: 0.008655

      465500 -- [-347.482] (-346.986) (-345.765) (-346.927) * (-351.529) (-351.574) (-348.088) [-347.748] -- 0:00:32
      466000 -- (-345.821) (-347.637) [-346.464] (-347.362) * (-345.443) [-347.424] (-347.208) (-345.011) -- 0:00:32
      466500 -- (-346.213) [-346.148] (-352.435) (-347.934) * (-349.197) [-346.455] (-346.434) (-347.013) -- 0:00:32
      467000 -- (-349.865) (-346.013) [-350.876] (-346.097) * (-345.119) [-350.537] (-347.670) (-347.196) -- 0:00:31
      467500 -- [-347.327] (-346.766) (-347.028) (-345.563) * [-346.735] (-347.832) (-346.500) (-349.092) -- 0:00:31
      468000 -- (-348.831) (-350.938) (-354.110) [-346.935] * [-346.688] (-350.978) (-350.748) (-349.435) -- 0:00:31
      468500 -- (-347.823) (-346.707) (-349.701) [-346.489] * [-345.937] (-347.461) (-349.688) (-347.879) -- 0:00:31
      469000 -- (-347.674) (-348.781) [-349.975] (-346.115) * [-345.400] (-348.919) (-348.747) (-346.692) -- 0:00:31
      469500 -- [-345.840] (-346.677) (-355.467) (-345.365) * (-345.153) (-345.703) (-347.806) [-346.008] -- 0:00:31
      470000 -- (-346.461) (-350.751) [-348.574] (-348.308) * (-345.837) (-346.048) (-346.196) [-348.657] -- 0:00:31

      Average standard deviation of split frequencies: 0.007957

      470500 -- [-347.459] (-348.515) (-347.887) (-346.586) * (-347.027) (-346.535) (-349.903) [-347.718] -- 0:00:31
      471000 -- (-347.795) (-348.396) (-348.055) [-346.390] * [-346.366] (-347.816) (-346.299) (-345.812) -- 0:00:32
      471500 -- (-346.239) (-350.488) [-348.906] (-344.996) * [-347.217] (-350.939) (-346.462) (-347.443) -- 0:00:32
      472000 -- (-347.462) [-346.311] (-346.508) (-345.527) * (-348.287) [-346.167] (-345.144) (-346.031) -- 0:00:32
      472500 -- (-348.669) (-345.922) [-344.905] (-347.130) * (-346.404) (-348.275) (-346.927) [-347.852] -- 0:00:32
      473000 -- (-346.560) (-346.334) [-346.254] (-346.239) * (-345.210) [-344.690] (-348.623) (-344.697) -- 0:00:32
      473500 -- (-347.939) (-347.645) (-348.147) [-344.691] * (-346.788) [-344.863] (-348.829) (-346.755) -- 0:00:32
      474000 -- (-347.353) [-345.316] (-355.498) (-345.119) * (-347.476) [-346.869] (-347.003) (-349.375) -- 0:00:32
      474500 -- (-346.636) (-347.303) (-348.325) [-345.230] * [-345.704] (-348.222) (-346.897) (-348.511) -- 0:00:32
      475000 -- [-345.665] (-347.494) (-349.660) (-347.756) * [-347.088] (-344.754) (-346.870) (-347.836) -- 0:00:32

      Average standard deviation of split frequencies: 0.007428

      475500 -- (-346.586) (-347.526) (-348.031) [-345.530] * (-349.400) (-346.028) (-349.053) [-348.167] -- 0:00:31
      476000 -- (-351.041) (-345.651) [-349.964] (-347.175) * (-350.413) [-348.129] (-350.395) (-345.640) -- 0:00:31
      476500 -- (-347.301) (-345.660) (-346.587) [-346.399] * (-349.459) (-348.336) [-347.918] (-345.677) -- 0:00:31
      477000 -- (-347.394) (-350.489) [-346.416] (-354.162) * (-348.114) [-347.389] (-349.287) (-345.166) -- 0:00:31
      477500 -- [-347.288] (-346.551) (-345.122) (-347.829) * (-345.399) (-346.690) [-345.738] (-346.731) -- 0:00:31
      478000 -- [-347.321] (-348.765) (-344.843) (-346.931) * (-347.560) (-347.743) [-346.187] (-346.760) -- 0:00:31
      478500 -- (-347.544) (-350.332) [-346.127] (-348.959) * [-347.856] (-349.783) (-347.978) (-349.719) -- 0:00:31
      479000 -- (-346.872) [-346.344] (-346.510) (-347.864) * [-348.591] (-348.930) (-347.041) (-350.070) -- 0:00:31
      479500 -- (-357.110) [-346.119] (-347.131) (-349.008) * (-350.314) [-347.807] (-345.999) (-347.120) -- 0:00:31
      480000 -- (-345.396) [-346.536] (-347.780) (-345.601) * (-352.248) (-347.274) [-346.793] (-347.157) -- 0:00:31

      Average standard deviation of split frequencies: 0.007682

      480500 -- (-348.491) (-347.595) (-347.191) [-346.388] * [-346.402] (-346.993) (-348.036) (-347.070) -- 0:00:31
      481000 -- (-345.905) (-348.981) (-349.089) [-346.451] * (-345.912) (-349.172) [-349.064] (-346.631) -- 0:00:31
      481500 -- (-346.161) (-347.082) [-345.870] (-350.143) * (-347.265) (-349.211) (-346.180) [-345.978] -- 0:00:31
      482000 -- (-345.114) (-347.670) [-345.861] (-347.675) * [-350.104] (-348.134) (-345.470) (-347.764) -- 0:00:31
      482500 -- (-346.848) [-345.817] (-348.862) (-349.324) * (-346.906) [-346.793] (-353.209) (-348.038) -- 0:00:31
      483000 -- (-349.394) [-345.259] (-345.203) (-350.606) * (-348.101) (-349.114) [-345.503] (-347.122) -- 0:00:31
      483500 -- (-347.936) [-344.915] (-348.008) (-345.921) * (-346.690) (-345.851) [-346.394] (-345.628) -- 0:00:30
      484000 -- (-348.740) (-345.636) [-346.396] (-345.109) * (-347.744) (-347.526) [-350.856] (-345.838) -- 0:00:30
      484500 -- [-347.650] (-348.122) (-348.440) (-346.826) * [-347.876] (-350.299) (-347.406) (-347.808) -- 0:00:30
      485000 -- [-347.485] (-347.860) (-350.022) (-346.153) * (-346.480) (-348.138) (-351.466) [-346.615] -- 0:00:30

      Average standard deviation of split frequencies: 0.007598

      485500 -- (-348.076) (-348.355) (-345.764) [-348.203] * [-350.511] (-351.151) (-347.887) (-348.151) -- 0:00:30
      486000 -- (-347.388) (-349.346) (-346.404) [-347.965] * (-345.866) [-346.285] (-346.842) (-347.014) -- 0:00:30
      486500 -- [-345.015] (-346.835) (-346.211) (-347.191) * (-348.784) [-345.333] (-346.759) (-348.175) -- 0:00:30
      487000 -- (-348.943) (-346.102) [-345.289] (-345.075) * (-345.757) (-345.280) [-346.389] (-350.130) -- 0:00:30
      487500 -- (-346.187) (-346.301) (-344.706) [-346.202] * (-346.622) (-348.188) [-346.353] (-347.559) -- 0:00:30
      488000 -- (-348.053) [-345.318] (-348.910) (-344.754) * (-345.562) (-345.321) [-345.851] (-350.552) -- 0:00:30
      488500 -- (-346.039) (-346.488) (-346.178) [-348.254] * (-345.673) [-349.898] (-346.392) (-346.935) -- 0:00:31
      489000 -- (-346.111) (-345.562) (-346.049) [-346.873] * (-345.035) (-349.008) (-346.426) [-345.812] -- 0:00:31
      489500 -- [-345.925] (-345.886) (-345.912) (-350.014) * (-347.266) (-348.888) [-350.500] (-347.010) -- 0:00:31
      490000 -- (-348.452) [-347.240] (-347.646) (-346.348) * (-345.175) (-345.174) (-348.552) [-346.982] -- 0:00:31

      Average standard deviation of split frequencies: 0.007579

      490500 -- (-345.751) (-346.881) (-347.718) [-345.611] * [-345.851] (-347.002) (-345.767) (-349.039) -- 0:00:31
      491000 -- (-345.858) [-346.215] (-346.779) (-345.414) * (-346.601) (-349.477) (-345.893) [-348.032] -- 0:00:31
      491500 -- (-346.971) (-347.152) (-345.502) [-346.417] * (-350.589) (-345.784) [-348.299] (-349.139) -- 0:00:31
      492000 -- [-347.586] (-348.690) (-349.709) (-347.458) * (-350.686) [-345.158] (-347.480) (-347.426) -- 0:00:30
      492500 -- (-353.342) (-348.836) (-348.466) [-347.352] * (-346.353) [-345.170] (-346.887) (-348.665) -- 0:00:30
      493000 -- [-346.799] (-347.193) (-346.869) (-348.974) * (-351.096) (-345.129) [-345.544] (-346.470) -- 0:00:30
      493500 -- (-347.847) (-348.862) (-345.984) [-347.016] * (-346.729) [-346.556] (-346.087) (-346.978) -- 0:00:30
      494000 -- (-346.912) (-346.713) [-345.369] (-346.951) * (-350.628) [-346.317] (-345.354) (-345.124) -- 0:00:30
      494500 -- (-345.226) [-346.340] (-347.954) (-347.923) * (-351.620) (-348.250) [-348.604] (-345.686) -- 0:00:30
      495000 -- (-346.161) (-347.681) (-350.628) [-346.491] * (-345.538) (-348.638) [-347.094] (-346.400) -- 0:00:30

      Average standard deviation of split frequencies: 0.007815

      495500 -- [-346.568] (-350.420) (-351.183) (-348.487) * (-347.784) (-348.619) (-347.232) [-347.324] -- 0:00:30
      496000 -- (-345.581) (-346.636) (-348.486) [-347.151] * (-346.119) [-345.665] (-345.726) (-349.437) -- 0:00:30
      496500 -- (-346.045) (-346.100) [-347.096] (-347.220) * (-346.596) (-348.605) (-352.874) [-345.778] -- 0:00:30
      497000 -- [-346.385] (-348.656) (-347.286) (-347.257) * (-345.101) [-348.240] (-348.992) (-346.928) -- 0:00:30
      497500 -- (-345.918) (-345.388) [-345.478] (-347.085) * (-345.372) (-346.036) (-346.063) [-348.102] -- 0:00:30
      498000 -- (-344.674) (-349.145) [-348.954] (-347.209) * (-347.445) (-347.984) [-345.039] (-345.254) -- 0:00:30
      498500 -- (-347.629) (-348.748) (-346.770) [-344.919] * (-350.585) [-350.963] (-345.885) (-345.350) -- 0:00:30
      499000 -- (-345.245) (-350.695) [-346.523] (-345.047) * (-350.161) [-349.173] (-344.889) (-350.415) -- 0:00:30
      499500 -- (-347.493) (-347.071) [-346.174] (-344.864) * (-347.390) (-352.362) [-344.676] (-345.936) -- 0:00:30
      500000 -- [-346.774] (-346.880) (-345.225) (-345.090) * (-347.308) (-352.745) [-346.052] (-345.887) -- 0:00:30

      Average standard deviation of split frequencies: 0.007323

      500500 -- [-346.888] (-345.799) (-345.672) (-345.177) * (-345.218) (-345.497) [-345.734] (-348.294) -- 0:00:29
      501000 -- (-345.687) (-346.803) [-349.181] (-346.467) * [-347.943] (-347.155) (-344.886) (-345.811) -- 0:00:29
      501500 -- (-346.710) (-345.176) [-347.501] (-346.946) * (-350.922) [-349.608] (-346.732) (-347.462) -- 0:00:29
      502000 -- (-349.605) [-346.347] (-351.968) (-351.413) * [-346.130] (-347.826) (-346.603) (-348.218) -- 0:00:29
      502500 -- (-347.626) (-347.881) (-350.796) [-345.139] * (-349.942) [-347.080] (-348.885) (-349.332) -- 0:00:29
      503000 -- (-346.962) (-347.520) [-347.172] (-349.785) * [-347.779] (-346.473) (-354.378) (-347.470) -- 0:00:29
      503500 -- (-346.329) (-350.771) [-345.833] (-346.344) * (-347.329) [-347.590] (-347.432) (-345.956) -- 0:00:29
      504000 -- (-347.896) (-350.666) [-346.048] (-347.176) * (-347.265) [-346.295] (-345.871) (-345.838) -- 0:00:29
      504500 -- (-346.467) (-345.986) [-347.249] (-346.351) * (-345.432) [-347.747] (-345.253) (-350.272) -- 0:00:29
      505000 -- (-347.227) (-354.853) [-347.733] (-347.933) * [-345.592] (-346.774) (-345.885) (-346.845) -- 0:00:29

      Average standard deviation of split frequencies: 0.007992

      505500 -- (-347.603) (-345.600) (-348.164) [-346.252] * (-345.983) (-348.585) (-346.575) [-345.235] -- 0:00:30
      506000 -- (-347.356) (-345.026) [-346.254] (-346.778) * (-348.840) (-354.668) [-348.569] (-345.269) -- 0:00:30
      506500 -- [-347.441] (-346.529) (-345.365) (-347.965) * (-347.863) (-350.828) [-347.391] (-348.597) -- 0:00:30
      507000 -- (-344.875) [-349.454] (-345.722) (-350.137) * (-346.625) (-348.309) (-346.174) [-349.113] -- 0:00:30
      507500 -- [-345.617] (-349.431) (-345.843) (-350.160) * (-346.080) (-346.808) (-346.376) [-346.788] -- 0:00:30
      508000 -- (-345.335) (-347.405) [-345.746] (-345.355) * (-345.481) (-347.788) [-345.918] (-355.370) -- 0:00:30
      508500 -- (-349.600) (-347.915) (-345.537) [-344.688] * (-346.447) (-347.665) (-345.685) [-347.762] -- 0:00:29
      509000 -- (-350.860) (-347.594) (-349.482) [-345.830] * [-348.642] (-350.814) (-345.448) (-349.284) -- 0:00:29
      509500 -- [-350.218] (-349.293) (-346.685) (-345.061) * (-346.351) (-351.208) [-346.860] (-347.171) -- 0:00:29
      510000 -- [-348.189] (-353.604) (-349.455) (-349.226) * (-347.670) (-349.437) (-347.405) [-345.713] -- 0:00:29

      Average standard deviation of split frequencies: 0.008462

      510500 -- [-346.552] (-348.258) (-346.132) (-345.860) * (-345.243) (-345.804) (-345.644) [-346.463] -- 0:00:29
      511000 -- (-347.022) [-345.822] (-348.222) (-349.900) * [-347.923] (-347.145) (-346.052) (-344.826) -- 0:00:29
      511500 -- (-347.949) (-346.814) [-346.708] (-346.265) * (-345.706) [-346.107] (-347.364) (-345.866) -- 0:00:29
      512000 -- (-347.724) (-347.562) [-345.141] (-345.274) * [-346.179] (-346.826) (-345.995) (-347.466) -- 0:00:29
      512500 -- (-348.377) (-349.845) (-346.102) [-350.440] * [-348.287] (-347.136) (-347.771) (-345.293) -- 0:00:29
      513000 -- (-348.688) [-347.576] (-352.398) (-346.783) * (-350.584) (-346.569) (-344.928) [-350.243] -- 0:00:29
      513500 -- (-345.754) (-345.896) (-346.668) [-345.946] * (-349.704) (-346.775) [-346.808] (-348.877) -- 0:00:29
      514000 -- (-345.170) [-347.406] (-350.357) (-347.034) * (-347.677) [-345.291] (-345.819) (-347.092) -- 0:00:29
      514500 -- (-346.120) [-346.048] (-350.414) (-348.826) * [-346.556] (-345.372) (-348.992) (-345.904) -- 0:00:29
      515000 -- (-346.155) (-346.209) [-346.505] (-347.309) * (-347.337) (-344.862) [-346.795] (-345.299) -- 0:00:29

      Average standard deviation of split frequencies: 0.008171

      515500 -- (-344.845) (-346.347) (-348.982) [-347.436] * (-351.695) (-346.312) [-347.056] (-347.098) -- 0:00:29
      516000 -- (-345.029) [-345.961] (-350.734) (-347.297) * (-346.849) (-348.047) (-348.540) [-347.382] -- 0:00:29
      516500 -- (-350.134) [-345.165] (-347.195) (-348.199) * (-347.214) (-348.137) (-348.553) [-346.291] -- 0:00:29
      517000 -- (-350.043) [-345.084] (-346.913) (-348.132) * (-346.458) (-349.368) [-347.303] (-344.849) -- 0:00:28
      517500 -- [-347.431] (-350.852) (-346.552) (-348.094) * (-346.927) (-352.613) [-345.829] (-345.357) -- 0:00:28
      518000 -- (-347.809) [-347.383] (-346.566) (-347.082) * [-345.965] (-350.178) (-345.426) (-349.460) -- 0:00:28
      518500 -- (-347.118) (-349.101) (-348.446) [-345.169] * (-345.292) [-346.931] (-347.068) (-346.430) -- 0:00:28
      519000 -- (-345.407) (-347.573) (-345.676) [-346.632] * (-349.976) (-347.594) (-348.493) [-345.152] -- 0:00:28
      519500 -- (-348.941) (-346.963) [-345.278] (-346.955) * [-348.709] (-347.366) (-346.563) (-345.515) -- 0:00:28
      520000 -- [-351.561] (-347.883) (-345.113) (-348.953) * [-346.989] (-347.792) (-345.807) (-348.209) -- 0:00:28

      Average standard deviation of split frequencies: 0.007897

      520500 -- (-350.820) [-346.540] (-345.722) (-347.233) * (-346.276) (-347.736) [-351.873] (-346.348) -- 0:00:28
      521000 -- (-348.282) (-347.111) (-345.512) [-348.181] * (-346.068) (-347.198) [-346.711] (-346.025) -- 0:00:28
      521500 -- [-345.938] (-348.847) (-350.306) (-346.598) * (-346.965) [-345.226] (-345.843) (-345.410) -- 0:00:28
      522000 -- (-349.645) (-346.642) [-346.122] (-346.951) * (-347.781) (-345.305) [-346.423] (-349.269) -- 0:00:28
      522500 -- (-346.605) (-346.723) [-346.683] (-348.159) * (-346.974) (-345.721) [-345.832] (-347.419) -- 0:00:28
      523000 -- (-345.738) (-346.841) [-350.009] (-347.351) * (-346.528) (-346.452) [-347.811] (-348.040) -- 0:00:29
      523500 -- (-344.878) (-346.830) [-347.816] (-345.522) * (-347.480) (-347.551) [-345.542] (-346.848) -- 0:00:29
      524000 -- (-345.868) (-347.392) [-345.548] (-346.517) * (-348.580) [-346.373] (-346.960) (-347.111) -- 0:00:29
      524500 -- [-345.451] (-349.907) (-346.123) (-352.629) * [-347.684] (-348.571) (-347.330) (-345.434) -- 0:00:29
      525000 -- [-348.396] (-349.358) (-346.438) (-346.227) * (-351.853) (-349.238) [-348.657] (-346.733) -- 0:00:28

      Average standard deviation of split frequencies: 0.007547

      525500 -- (-347.377) (-346.624) (-346.865) [-348.468] * (-347.211) (-352.582) (-344.960) [-347.507] -- 0:00:28
      526000 -- (-350.476) (-345.085) (-346.329) [-345.830] * (-347.847) [-345.938] (-344.996) (-347.185) -- 0:00:28
      526500 -- (-345.614) (-346.864) (-347.541) [-345.394] * [-348.416] (-346.753) (-345.903) (-345.877) -- 0:00:28
      527000 -- (-345.614) (-349.148) (-346.665) [-345.871] * (-345.605) (-345.951) (-345.760) [-347.061] -- 0:00:28
      527500 -- (-347.639) (-345.218) (-350.527) [-346.217] * (-349.792) [-347.166] (-347.490) (-346.464) -- 0:00:28
      528000 -- [-347.377] (-345.721) (-350.812) (-346.972) * [-348.577] (-349.912) (-351.446) (-346.447) -- 0:00:28
      528500 -- [-347.752] (-347.542) (-349.656) (-348.473) * (-345.641) (-346.214) (-347.434) [-345.730] -- 0:00:28
      529000 -- (-345.224) (-348.939) [-346.961] (-345.692) * (-344.940) (-348.093) [-347.550] (-346.595) -- 0:00:28
      529500 -- (-344.940) (-347.154) [-347.387] (-347.803) * [-347.227] (-345.960) (-352.122) (-348.573) -- 0:00:28
      530000 -- [-345.342] (-345.871) (-345.370) (-348.560) * (-347.866) (-345.533) (-351.667) [-346.610] -- 0:00:28

      Average standard deviation of split frequencies: 0.007434

      530500 -- (-347.085) (-345.271) (-345.717) [-349.391] * (-346.664) (-346.901) (-347.149) [-345.401] -- 0:00:28
      531000 -- (-346.822) [-345.209] (-347.411) (-349.266) * (-348.687) [-348.757] (-346.874) (-346.094) -- 0:00:28
      531500 -- (-347.538) (-348.774) [-347.644] (-347.173) * (-345.426) (-347.656) [-346.902] (-348.996) -- 0:00:28
      532000 -- (-347.278) (-347.310) (-347.409) [-346.895] * (-345.238) (-351.491) [-346.189] (-350.678) -- 0:00:28
      532500 -- (-349.281) (-347.004) [-347.595] (-352.493) * [-348.163] (-346.888) (-346.416) (-348.966) -- 0:00:28
      533000 -- (-347.874) (-347.443) [-347.843] (-349.145) * (-347.493) (-345.196) [-345.317] (-353.727) -- 0:00:28
      533500 -- [-346.988] (-348.014) (-350.167) (-348.001) * (-345.762) (-347.126) (-346.265) [-346.220] -- 0:00:27
      534000 -- (-350.491) [-346.713] (-353.818) (-346.469) * (-346.835) [-345.322] (-349.262) (-345.462) -- 0:00:27
      534500 -- (-346.683) (-348.555) (-349.558) [-346.308] * (-346.799) (-347.810) (-352.031) [-349.196] -- 0:00:27
      535000 -- (-346.866) (-345.220) [-347.994] (-349.525) * (-345.523) (-346.128) [-348.449] (-348.705) -- 0:00:27

      Average standard deviation of split frequencies: 0.007398

      535500 -- (-347.864) (-353.292) [-347.648] (-352.460) * (-348.159) (-349.200) (-348.036) [-347.210] -- 0:00:27
      536000 -- [-347.033] (-354.836) (-347.003) (-349.459) * (-346.107) (-346.422) (-346.420) [-347.995] -- 0:00:27
      536500 -- (-353.291) (-345.458) [-348.453] (-347.281) * (-351.120) (-344.730) (-345.662) [-351.936] -- 0:00:27
      537000 -- [-346.881] (-353.174) (-348.610) (-346.635) * (-347.039) (-348.121) (-345.794) [-345.708] -- 0:00:27
      537500 -- (-351.953) (-345.905) [-345.024] (-345.130) * (-350.599) [-345.997] (-347.713) (-344.868) -- 0:00:27
      538000 -- [-345.924] (-346.817) (-346.044) (-345.222) * (-346.727) (-346.392) [-347.315] (-345.592) -- 0:00:27
      538500 -- (-347.534) (-347.193) (-346.589) [-347.866] * (-347.405) (-350.930) (-350.683) [-347.267] -- 0:00:27
      539000 -- [-346.250] (-345.692) (-346.636) (-350.192) * (-347.393) (-347.522) [-346.375] (-347.415) -- 0:00:27
      539500 -- (-345.113) [-346.565] (-346.457) (-345.361) * (-348.507) [-347.409] (-347.202) (-345.861) -- 0:00:27
      540000 -- [-346.598] (-347.596) (-347.162) (-347.071) * (-347.031) [-350.183] (-348.871) (-346.063) -- 0:00:27

      Average standard deviation of split frequencies: 0.006719

      540500 -- (-347.406) (-351.887) [-348.234] (-347.163) * [-349.949] (-346.604) (-349.562) (-348.041) -- 0:00:28
      541000 -- (-346.760) (-347.000) [-348.495] (-347.515) * (-347.585) (-351.742) (-349.802) [-346.148] -- 0:00:27
      541500 -- (-347.126) [-345.576] (-346.500) (-350.001) * (-347.571) (-347.407) (-348.776) [-346.207] -- 0:00:27
      542000 -- (-346.632) [-345.112] (-347.629) (-350.328) * (-347.415) (-349.039) [-348.669] (-345.227) -- 0:00:27
      542500 -- (-348.432) [-347.305] (-346.761) (-347.796) * (-347.920) (-352.389) (-346.576) [-346.113] -- 0:00:27
      543000 -- (-351.412) [-346.918] (-348.856) (-347.416) * (-347.620) (-345.650) [-347.014] (-347.038) -- 0:00:27
      543500 -- (-349.992) (-348.242) [-345.581] (-345.930) * [-346.713] (-350.756) (-347.056) (-349.916) -- 0:00:27
      544000 -- (-351.593) [-348.786] (-346.746) (-345.909) * (-346.678) (-349.656) [-348.205] (-350.291) -- 0:00:27
      544500 -- (-347.067) (-352.231) (-348.084) [-346.555] * [-345.881] (-348.277) (-347.492) (-347.274) -- 0:00:27
      545000 -- (-347.543) [-347.245] (-346.004) (-347.916) * [-347.845] (-349.000) (-346.787) (-351.171) -- 0:00:27

      Average standard deviation of split frequencies: 0.006399

      545500 -- (-347.936) (-346.113) [-347.154] (-347.664) * [-350.142] (-346.685) (-349.824) (-344.683) -- 0:00:27
      546000 -- (-348.489) (-347.661) [-350.671] (-348.848) * [-348.535] (-347.769) (-347.611) (-348.108) -- 0:00:27
      546500 -- (-345.816) (-348.576) [-347.806] (-349.164) * [-348.524] (-349.816) (-348.138) (-346.646) -- 0:00:27
      547000 -- (-347.501) (-347.210) (-347.334) [-346.552] * [-347.252] (-350.241) (-345.401) (-346.369) -- 0:00:27
      547500 -- (-346.371) [-350.643] (-347.244) (-353.092) * (-347.663) (-344.900) (-345.430) [-345.862] -- 0:00:27
      548000 -- [-347.760] (-349.531) (-346.536) (-345.194) * (-346.237) [-346.855] (-348.918) (-346.385) -- 0:00:27
      548500 -- (-348.041) (-346.810) [-348.970] (-345.972) * (-346.980) (-351.258) (-349.333) [-345.293] -- 0:00:27
      549000 -- (-347.382) (-346.892) (-351.551) [-346.436] * (-347.868) (-347.412) (-346.853) [-352.070] -- 0:00:27
      549500 -- (-348.680) (-345.608) [-346.998] (-345.632) * (-346.130) [-350.287] (-346.427) (-350.298) -- 0:00:27
      550000 -- [-347.926] (-345.987) (-347.599) (-346.617) * (-346.593) [-346.581] (-346.162) (-347.438) -- 0:00:27

      Average standard deviation of split frequencies: 0.006194

      550500 -- (-348.798) (-345.261) [-345.868] (-349.171) * [-346.162] (-349.302) (-348.743) (-346.811) -- 0:00:26
      551000 -- (-346.193) [-349.527] (-347.826) (-349.607) * [-346.960] (-348.045) (-346.197) (-348.072) -- 0:00:26
      551500 -- (-346.512) (-348.433) (-349.587) [-345.505] * [-347.027] (-349.037) (-346.714) (-356.955) -- 0:00:26
      552000 -- [-346.473] (-346.244) (-347.204) (-345.795) * [-349.828] (-346.655) (-346.947) (-348.381) -- 0:00:26
      552500 -- [-345.592] (-345.846) (-349.114) (-346.891) * [-345.597] (-350.872) (-345.537) (-346.366) -- 0:00:26
      553000 -- (-346.624) (-346.691) [-350.784] (-345.602) * (-344.985) [-347.683] (-349.412) (-347.916) -- 0:00:26
      553500 -- (-347.480) [-347.356] (-345.897) (-347.519) * (-347.995) (-345.087) [-346.802] (-347.576) -- 0:00:26
      554000 -- [-348.377] (-349.537) (-347.229) (-346.490) * (-345.276) (-346.221) (-348.735) [-346.694] -- 0:00:26
      554500 -- (-346.513) (-345.066) (-354.903) [-348.620] * (-349.582) [-350.214] (-347.270) (-346.326) -- 0:00:26
      555000 -- (-348.782) [-346.291] (-346.551) (-348.112) * (-347.255) [-353.790] (-346.060) (-346.976) -- 0:00:26

      Average standard deviation of split frequencies: 0.005885

      555500 -- (-347.354) (-345.579) (-346.391) [-344.998] * (-345.962) [-346.904] (-348.854) (-348.567) -- 0:00:26
      556000 -- (-347.872) [-345.065] (-346.459) (-345.744) * (-347.525) (-346.834) [-346.568] (-346.619) -- 0:00:26
      556500 -- [-349.103] (-345.915) (-346.334) (-346.110) * (-346.618) (-347.570) [-345.991] (-354.472) -- 0:00:26
      557000 -- (-347.079) (-347.918) [-346.314] (-345.649) * (-345.437) (-346.965) (-349.334) [-346.037] -- 0:00:26
      557500 -- (-348.812) [-347.177] (-350.648) (-346.135) * (-346.145) [-345.261] (-346.869) (-346.413) -- 0:00:26
      558000 -- (-345.503) (-347.081) (-347.367) [-346.423] * (-347.399) (-348.241) [-345.227] (-346.327) -- 0:00:26
      558500 -- [-346.041] (-347.300) (-347.892) (-348.186) * (-347.312) [-345.192] (-346.360) (-345.574) -- 0:00:26
      559000 -- [-349.721] (-345.957) (-347.249) (-345.213) * (-348.649) (-346.379) (-345.038) [-345.694] -- 0:00:26
      559500 -- (-346.814) [-347.699] (-348.820) (-347.480) * (-350.724) [-346.529] (-351.958) (-346.903) -- 0:00:26
      560000 -- (-348.718) [-348.745] (-346.120) (-352.625) * [-354.573] (-348.914) (-350.566) (-347.885) -- 0:00:26

      Average standard deviation of split frequencies: 0.007023

      560500 -- (-346.841) (-348.332) (-347.149) [-345.432] * (-346.733) (-352.219) [-346.645] (-347.246) -- 0:00:26
      561000 -- (-346.563) [-347.420] (-346.853) (-347.472) * (-346.725) (-346.558) [-347.928] (-349.727) -- 0:00:26
      561500 -- (-349.458) [-346.009] (-345.496) (-350.795) * [-345.722] (-347.504) (-345.741) (-345.689) -- 0:00:26
      562000 -- (-353.714) [-353.279] (-348.964) (-347.696) * [-345.891] (-346.478) (-346.976) (-348.393) -- 0:00:26
      562500 -- (-347.185) [-346.495] (-346.521) (-346.955) * (-346.030) (-346.206) (-345.196) [-346.732] -- 0:00:26
      563000 -- (-348.252) [-345.549] (-347.083) (-346.764) * (-348.993) (-346.376) (-346.199) [-347.080] -- 0:00:26
      563500 -- (-347.436) (-349.648) [-347.661] (-346.961) * (-351.623) (-348.815) [-344.845] (-347.096) -- 0:00:26
      564000 -- (-348.556) (-344.953) [-348.184] (-347.010) * (-346.341) (-347.621) (-346.512) [-347.612] -- 0:00:26
      564500 -- (-347.387) (-347.511) (-350.709) [-348.744] * (-345.429) (-348.091) [-347.720] (-348.397) -- 0:00:26
      565000 -- (-347.254) (-345.715) [-345.045] (-348.076) * [-345.104] (-348.680) (-347.671) (-346.626) -- 0:00:26

      Average standard deviation of split frequencies: 0.006663

      565500 -- (-346.563) (-348.282) (-345.958) [-345.157] * (-345.913) (-346.892) (-346.891) [-347.491] -- 0:00:26
      566000 -- (-346.019) [-348.376] (-346.546) (-346.909) * (-347.232) (-345.052) [-347.189] (-351.426) -- 0:00:26
      566500 -- (-346.288) (-345.724) [-345.572] (-346.613) * (-346.993) (-346.378) (-347.382) [-347.120] -- 0:00:26
      567000 -- (-347.595) (-345.981) [-345.592] (-347.847) * (-346.306) [-351.407] (-346.094) (-349.067) -- 0:00:25
      567500 -- (-348.256) (-349.756) (-345.525) [-347.711] * (-347.407) (-350.490) [-345.632] (-347.974) -- 0:00:25
      568000 -- (-347.320) [-347.332] (-348.459) (-347.437) * [-345.808] (-347.730) (-348.046) (-346.522) -- 0:00:25
      568500 -- (-344.997) (-346.288) (-351.461) [-347.812] * (-345.517) (-347.166) [-346.175] (-348.044) -- 0:00:25
      569000 -- (-345.709) [-345.829] (-347.631) (-346.992) * (-345.994) [-349.478] (-347.437) (-349.832) -- 0:00:25
      569500 -- (-346.455) [-344.789] (-346.485) (-349.453) * [-347.026] (-348.485) (-350.937) (-345.151) -- 0:00:25
      570000 -- [-345.769] (-345.982) (-346.108) (-348.412) * (-346.234) (-347.765) [-349.800] (-345.642) -- 0:00:25

      Average standard deviation of split frequencies: 0.006379

      570500 -- (-348.581) (-349.671) [-347.331] (-345.575) * (-347.441) (-346.142) [-346.870] (-351.387) -- 0:00:25
      571000 -- (-346.819) (-345.707) [-345.737] (-345.399) * (-347.473) (-346.459) [-345.830] (-347.821) -- 0:00:25
      571500 -- [-346.376] (-351.220) (-345.674) (-345.461) * (-347.931) (-349.685) (-345.636) [-347.578] -- 0:00:25
      572000 -- (-347.611) (-346.456) [-348.556] (-345.851) * (-346.342) (-347.982) [-346.441] (-347.612) -- 0:00:25
      572500 -- (-350.843) (-348.289) (-348.331) [-348.011] * [-346.396] (-346.126) (-348.366) (-348.393) -- 0:00:25
      573000 -- (-347.182) (-346.892) [-351.597] (-347.245) * (-347.274) (-346.791) [-347.633] (-347.406) -- 0:00:25
      573500 -- (-345.497) [-347.344] (-346.066) (-349.301) * [-347.505] (-351.066) (-347.253) (-344.978) -- 0:00:25
      574000 -- (-345.721) (-347.445) [-347.737] (-346.290) * [-345.907] (-353.199) (-347.209) (-345.830) -- 0:00:25
      574500 -- (-345.698) (-350.372) [-349.791] (-349.202) * (-348.176) (-347.761) [-345.213] (-349.382) -- 0:00:25
      575000 -- (-346.604) [-347.262] (-346.210) (-344.977) * (-345.486) [-345.428] (-345.939) (-350.261) -- 0:00:25

      Average standard deviation of split frequencies: 0.006820

      575500 -- (-348.611) [-345.070] (-350.000) (-345.967) * [-345.511] (-348.009) (-348.909) (-346.800) -- 0:00:25
      576000 -- [-347.080] (-344.814) (-347.481) (-346.520) * (-345.540) (-346.500) (-346.614) [-346.882] -- 0:00:25
      576500 -- (-351.149) [-346.308] (-350.196) (-349.153) * [-348.015] (-347.688) (-345.418) (-346.254) -- 0:00:25
      577000 -- [-347.486] (-350.005) (-349.210) (-347.836) * (-348.733) (-345.347) [-347.667] (-347.554) -- 0:00:25
      577500 -- (-349.846) (-350.372) (-346.283) [-345.800] * (-346.146) (-345.497) [-350.151] (-345.476) -- 0:00:25
      578000 -- (-348.402) (-346.321) [-345.929] (-346.507) * (-349.984) [-346.645] (-347.107) (-345.433) -- 0:00:25
      578500 -- (-347.286) (-345.438) (-347.578) [-347.523] * (-345.337) [-346.610] (-347.363) (-345.254) -- 0:00:25
      579000 -- (-346.197) (-346.586) (-346.558) [-345.162] * (-345.872) [-349.144] (-346.027) (-346.518) -- 0:00:25
      579500 -- (-346.411) [-346.405] (-345.697) (-346.346) * (-346.661) [-346.654] (-349.264) (-354.209) -- 0:00:25
      580000 -- (-347.935) (-347.825) (-344.948) [-346.376] * [-348.345] (-346.461) (-349.013) (-348.067) -- 0:00:25

      Average standard deviation of split frequencies: 0.006991

      580500 -- (-347.755) [-346.643] (-346.508) (-347.815) * (-346.217) [-345.435] (-347.217) (-348.250) -- 0:00:25
      581000 -- [-346.030] (-345.950) (-347.337) (-350.239) * (-346.310) (-346.096) (-348.860) [-345.404] -- 0:00:25
      581500 -- (-347.263) (-345.448) (-346.345) [-345.512] * [-350.322] (-346.889) (-345.852) (-346.686) -- 0:00:25
      582000 -- [-348.991] (-346.546) (-349.641) (-345.631) * (-346.798) [-345.655] (-347.090) (-350.542) -- 0:00:25
      582500 -- (-346.496) [-346.108] (-349.663) (-347.648) * (-348.911) (-345.534) [-346.303] (-351.053) -- 0:00:25
      583000 -- (-346.945) [-346.262] (-348.465) (-346.036) * (-348.449) (-347.014) [-345.772] (-345.867) -- 0:00:25
      583500 -- (-348.159) [-345.116] (-349.650) (-349.256) * (-348.132) (-347.442) (-347.765) [-345.502] -- 0:00:24
      584000 -- (-348.640) [-345.473] (-349.054) (-347.671) * (-346.400) (-345.871) (-351.285) [-345.986] -- 0:00:24
      584500 -- (-347.549) (-347.584) [-346.525] (-345.754) * (-347.062) [-346.892] (-347.435) (-346.296) -- 0:00:24
      585000 -- (-348.264) [-346.535] (-346.316) (-345.871) * (-349.190) (-350.913) [-347.716] (-345.486) -- 0:00:24

      Average standard deviation of split frequencies: 0.006570

      585500 -- (-349.079) (-346.966) (-348.272) [-346.340] * (-347.463) (-347.617) [-346.200] (-346.044) -- 0:00:24
      586000 -- (-348.858) [-348.203] (-350.423) (-346.630) * (-347.258) (-346.819) [-348.180] (-346.577) -- 0:00:24
      586500 -- (-346.316) (-348.524) (-346.287) [-352.997] * (-345.280) [-349.887] (-345.146) (-347.125) -- 0:00:24
      587000 -- (-351.726) (-350.032) [-346.641] (-348.055) * [-345.416] (-350.737) (-344.854) (-350.702) -- 0:00:24
      587500 -- [-348.439] (-346.641) (-350.916) (-347.964) * (-346.025) [-349.906] (-350.138) (-350.057) -- 0:00:24
      588000 -- (-347.014) (-345.329) (-349.362) [-345.086] * (-347.330) [-346.861] (-348.736) (-347.688) -- 0:00:24
      588500 -- (-346.860) (-347.137) [-347.386] (-345.938) * (-347.452) (-348.654) [-347.580] (-345.611) -- 0:00:24
      589000 -- [-346.178] (-347.145) (-346.067) (-346.781) * (-346.484) [-345.726] (-345.799) (-345.823) -- 0:00:24
      589500 -- [-346.240] (-345.603) (-345.055) (-345.413) * (-347.389) (-345.717) [-345.853] (-346.460) -- 0:00:24
      590000 -- (-346.382) (-347.383) (-344.632) [-347.030] * (-347.554) [-345.458] (-348.182) (-346.156) -- 0:00:24

      Average standard deviation of split frequencies: 0.006695

      590500 -- [-346.320] (-351.466) (-345.889) (-348.657) * (-349.428) (-346.630) [-345.687] (-355.312) -- 0:00:24
      591000 -- [-346.384] (-347.767) (-346.437) (-346.755) * (-345.546) (-349.985) (-346.472) [-349.267] -- 0:00:24
      591500 -- (-348.311) (-346.443) [-349.823] (-346.182) * (-345.676) (-348.961) [-345.556] (-349.329) -- 0:00:24
      592000 -- (-347.020) [-345.959] (-355.543) (-347.413) * (-346.345) (-348.024) (-345.685) [-348.635] -- 0:00:24
      592500 -- (-345.652) [-345.217] (-347.123) (-347.299) * (-348.420) [-347.115] (-344.999) (-346.481) -- 0:00:24
      593000 -- (-348.322) (-346.596) [-347.746] (-348.445) * (-351.139) (-348.253) (-347.828) [-350.128] -- 0:00:24
      593500 -- (-348.160) (-350.373) [-347.623] (-348.494) * (-350.271) [-345.275] (-346.696) (-348.932) -- 0:00:24
      594000 -- (-346.557) [-347.355] (-348.122) (-351.032) * (-347.473) (-347.164) (-349.494) [-347.251] -- 0:00:24
      594500 -- (-345.756) [-344.846] (-348.169) (-352.925) * (-346.380) (-349.083) [-346.468] (-349.248) -- 0:00:24
      595000 -- (-347.566) [-347.509] (-345.970) (-351.367) * (-347.463) [-348.212] (-349.381) (-348.917) -- 0:00:24

      Average standard deviation of split frequencies: 0.006372

      595500 -- (-345.858) [-346.555] (-349.192) (-345.009) * (-347.669) [-348.087] (-351.015) (-347.979) -- 0:00:24
      596000 -- (-347.956) [-346.996] (-346.125) (-347.033) * [-350.516] (-347.627) (-347.915) (-350.324) -- 0:00:24
      596500 -- (-346.071) [-348.963] (-346.279) (-346.760) * (-345.356) (-349.025) [-347.317] (-353.376) -- 0:00:24
      597000 -- (-345.929) [-351.771] (-346.264) (-347.404) * (-349.647) [-348.800] (-347.434) (-350.358) -- 0:00:24
      597500 -- (-345.187) (-346.919) [-344.997] (-347.439) * (-348.319) (-351.347) [-345.672] (-346.018) -- 0:00:24
      598000 -- [-345.630] (-347.060) (-347.977) (-348.340) * (-346.726) (-348.511) [-347.315] (-346.526) -- 0:00:24
      598500 -- (-346.780) [-346.214] (-346.737) (-349.316) * (-348.048) (-344.972) (-345.008) [-350.495] -- 0:00:24
      599000 -- (-344.813) (-354.868) (-348.740) [-346.627] * (-352.531) [-345.111] (-346.150) (-346.023) -- 0:00:24
      599500 -- (-349.079) (-352.922) [-347.041] (-346.695) * (-345.662) (-345.779) (-347.018) [-345.482] -- 0:00:24
      600000 -- (-347.149) (-347.599) [-349.695] (-347.729) * (-345.923) (-346.560) (-349.107) [-345.002] -- 0:00:24

      Average standard deviation of split frequencies: 0.006627

      600500 -- [-346.473] (-347.454) (-346.414) (-349.573) * (-347.132) (-346.309) (-345.608) [-349.731] -- 0:00:23
      601000 -- (-346.955) [-347.959] (-347.868) (-349.845) * (-346.338) [-346.863] (-346.983) (-350.086) -- 0:00:23
      601500 -- [-346.486] (-347.072) (-349.348) (-345.702) * (-345.826) (-347.371) (-346.874) [-349.012] -- 0:00:23
      602000 -- (-350.174) (-346.211) (-347.457) [-347.870] * (-348.332) (-348.600) (-346.150) [-347.907] -- 0:00:23
      602500 -- (-350.856) [-346.014] (-351.406) (-345.622) * (-346.741) (-348.520) [-346.909] (-347.936) -- 0:00:23
      603000 -- [-347.798] (-346.917) (-346.070) (-348.447) * (-347.664) (-354.311) [-349.134] (-346.004) -- 0:00:23
      603500 -- [-347.396] (-349.007) (-346.743) (-346.624) * (-345.257) (-351.173) (-345.657) [-347.298] -- 0:00:23
      604000 -- [-349.299] (-347.185) (-352.233) (-346.739) * (-361.159) (-346.841) (-350.400) [-345.489] -- 0:00:23
      604500 -- (-347.125) [-346.405] (-351.906) (-346.077) * (-357.162) (-348.293) (-348.732) [-346.311] -- 0:00:23
      605000 -- (-351.322) (-346.979) (-350.456) [-351.313] * (-347.616) (-351.235) (-346.692) [-349.417] -- 0:00:23

      Average standard deviation of split frequencies: 0.006915

      605500 -- (-348.594) [-346.593] (-348.158) (-348.045) * (-347.689) (-346.199) [-347.608] (-347.173) -- 0:00:23
      606000 -- (-348.197) (-345.965) (-345.594) [-345.950] * (-346.660) (-346.053) (-349.594) [-347.921] -- 0:00:23
      606500 -- [-346.796] (-346.236) (-345.983) (-350.037) * (-349.555) [-346.908] (-350.487) (-346.775) -- 0:00:23
      607000 -- (-345.217) (-349.142) [-345.984] (-346.937) * (-345.546) (-348.227) (-346.399) [-345.693] -- 0:00:23
      607500 -- [-347.817] (-346.069) (-345.680) (-351.329) * (-347.712) [-350.782] (-348.265) (-345.410) -- 0:00:23
      608000 -- [-345.471] (-346.149) (-347.531) (-346.972) * (-348.937) [-348.956] (-351.553) (-347.702) -- 0:00:23
      608500 -- (-347.438) [-346.349] (-351.395) (-345.612) * (-346.052) (-351.403) (-349.965) [-348.139] -- 0:00:23
      609000 -- [-346.550] (-346.070) (-347.939) (-347.227) * (-348.023) (-350.051) [-345.349] (-345.419) -- 0:00:23
      609500 -- [-347.377] (-348.567) (-349.349) (-345.207) * [-345.527] (-345.755) (-345.439) (-348.939) -- 0:00:23
      610000 -- [-347.731] (-346.728) (-350.724) (-347.701) * (-346.562) (-349.326) [-345.460] (-348.625) -- 0:00:23

      Average standard deviation of split frequencies: 0.006519

      610500 -- [-347.879] (-346.258) (-346.552) (-346.310) * [-346.595] (-346.665) (-346.435) (-345.695) -- 0:00:23
      611000 -- (-346.663) (-345.751) [-347.839] (-347.135) * (-347.794) (-347.705) (-345.010) [-348.247] -- 0:00:23
      611500 -- (-345.942) (-347.673) (-346.175) [-346.377] * (-345.670) [-344.815] (-345.789) (-345.805) -- 0:00:23
      612000 -- (-348.392) [-347.586] (-348.084) (-345.616) * [-348.043] (-346.973) (-347.224) (-349.774) -- 0:00:23
      612500 -- (-347.254) (-346.390) (-346.351) [-345.541] * [-346.541] (-346.824) (-345.705) (-345.582) -- 0:00:23
      613000 -- (-348.748) (-348.172) [-346.420] (-346.829) * (-351.298) (-345.808) (-345.563) [-346.028] -- 0:00:23
      613500 -- (-347.854) (-347.907) [-345.799] (-347.195) * (-353.744) (-348.883) [-348.699] (-347.810) -- 0:00:23
      614000 -- (-346.522) (-345.664) [-350.535] (-348.733) * [-346.973] (-346.758) (-348.346) (-348.637) -- 0:00:23
      614500 -- (-348.584) (-346.831) (-347.137) [-347.410] * [-348.590] (-346.589) (-352.370) (-346.085) -- 0:00:23
      615000 -- (-346.623) (-346.149) [-347.828] (-350.165) * (-346.997) [-347.605] (-347.584) (-346.555) -- 0:00:23

      Average standard deviation of split frequencies: 0.006420

      615500 -- (-345.800) [-346.399] (-345.369) (-349.047) * (-347.414) (-347.357) [-346.012] (-347.217) -- 0:00:23
      616000 -- (-346.396) (-347.109) [-345.571] (-346.848) * [-345.099] (-348.016) (-345.555) (-349.336) -- 0:00:23
      616500 -- (-345.115) (-348.333) [-347.080] (-347.425) * [-345.746] (-346.422) (-347.331) (-346.259) -- 0:00:23
      617000 -- [-345.037] (-345.714) (-348.587) (-348.475) * (-350.270) (-345.882) (-348.020) [-345.262] -- 0:00:22
      617500 -- (-345.060) [-347.711] (-346.689) (-348.035) * (-345.594) [-345.886] (-347.717) (-348.599) -- 0:00:22
      618000 -- [-346.895] (-344.846) (-348.231) (-350.530) * (-349.441) (-347.688) [-349.135] (-349.968) -- 0:00:22
      618500 -- (-346.644) [-346.189] (-345.640) (-349.434) * (-349.155) [-347.153] (-352.011) (-347.045) -- 0:00:22
      619000 -- (-346.674) (-348.605) (-347.641) [-347.721] * (-349.073) [-347.139] (-349.244) (-347.634) -- 0:00:22
      619500 -- (-347.141) (-348.389) [-351.179] (-347.224) * (-350.321) [-346.546] (-345.780) (-347.768) -- 0:00:22
      620000 -- (-349.950) (-345.978) [-347.965] (-347.201) * (-346.753) [-347.639] (-345.177) (-349.969) -- 0:00:22

      Average standard deviation of split frequencies: 0.006160

      620500 -- (-347.257) (-348.034) (-348.174) [-345.618] * (-345.706) (-347.108) [-346.190] (-351.201) -- 0:00:22
      621000 -- [-346.570] (-349.760) (-347.082) (-355.462) * (-349.064) (-348.049) (-350.836) [-349.293] -- 0:00:22
      621500 -- (-348.529) (-347.141) (-349.188) [-351.527] * (-346.279) (-349.558) [-353.982] (-348.099) -- 0:00:22
      622000 -- (-346.705) [-347.288] (-346.093) (-352.373) * [-346.494] (-351.191) (-349.433) (-346.360) -- 0:00:22
      622500 -- (-346.202) [-348.136] (-345.828) (-347.481) * [-347.972] (-350.330) (-348.589) (-346.928) -- 0:00:22
      623000 -- (-347.582) (-346.867) (-345.464) [-345.664] * [-349.660] (-346.131) (-347.451) (-351.681) -- 0:00:22
      623500 -- (-352.540) (-347.400) (-347.532) [-346.201] * (-347.079) [-348.920] (-345.964) (-348.283) -- 0:00:22
      624000 -- (-346.772) (-346.569) [-345.956] (-346.753) * (-349.147) [-345.328] (-346.064) (-346.457) -- 0:00:22
      624500 -- (-345.977) (-348.276) [-346.267] (-345.401) * (-346.120) (-345.253) [-347.397] (-347.814) -- 0:00:22
      625000 -- [-345.665] (-347.572) (-346.082) (-344.830) * [-347.207] (-350.634) (-346.910) (-345.529) -- 0:00:22

      Average standard deviation of split frequencies: 0.006443

      625500 -- (-351.583) (-348.220) (-347.311) [-345.536] * [-348.697] (-349.767) (-345.448) (-347.562) -- 0:00:22
      626000 -- [-345.797] (-349.296) (-346.104) (-348.994) * [-350.158] (-346.307) (-350.905) (-348.900) -- 0:00:22
      626500 -- (-345.822) [-346.868] (-346.823) (-350.287) * (-351.708) [-346.845] (-349.211) (-346.137) -- 0:00:22
      627000 -- (-349.049) (-345.438) (-347.759) [-350.555] * (-346.334) [-345.162] (-349.993) (-350.837) -- 0:00:22
      627500 -- (-346.178) (-345.461) (-347.631) [-347.604] * [-348.764] (-346.207) (-346.352) (-348.094) -- 0:00:22
      628000 -- (-347.932) (-347.135) (-348.581) [-347.962] * (-345.364) (-345.595) (-349.107) [-346.478] -- 0:00:22
      628500 -- (-349.223) [-346.163] (-345.449) (-353.626) * [-345.169] (-350.355) (-348.925) (-347.767) -- 0:00:22
      629000 -- (-347.126) [-347.401] (-346.465) (-349.079) * (-346.757) (-356.824) (-350.132) [-346.102] -- 0:00:22
      629500 -- (-346.956) (-346.233) [-347.331] (-345.226) * (-347.678) (-348.812) (-348.879) [-347.853] -- 0:00:22
      630000 -- (-350.260) (-347.444) (-346.689) [-346.347] * (-348.083) [-350.279] (-348.165) (-346.060) -- 0:00:22

      Average standard deviation of split frequencies: 0.006561

      630500 -- (-346.569) (-346.271) (-345.791) [-346.411] * (-347.762) (-347.389) [-349.789] (-347.330) -- 0:00:22
      631000 -- (-346.411) [-348.600] (-346.749) (-345.531) * (-346.760) (-349.225) [-345.945] (-345.812) -- 0:00:22
      631500 -- (-346.845) (-346.914) [-345.702] (-360.165) * (-346.907) [-347.250] (-347.595) (-344.984) -- 0:00:22
      632000 -- (-348.152) (-350.040) [-348.216] (-349.028) * (-346.366) [-347.253] (-346.068) (-345.588) -- 0:00:22
      632500 -- [-345.481] (-345.229) (-346.014) (-350.989) * [-347.268] (-345.187) (-349.682) (-346.929) -- 0:00:22
      633000 -- (-347.851) (-346.307) [-345.693] (-349.726) * (-347.873) (-345.013) (-350.307) [-345.323] -- 0:00:22
      633500 -- [-345.399] (-345.629) (-347.145) (-348.837) * (-350.941) (-346.201) [-345.820] (-345.593) -- 0:00:21
      634000 -- (-346.752) (-351.066) (-345.645) [-348.257] * (-349.082) [-346.080] (-344.830) (-348.146) -- 0:00:21
      634500 -- (-349.086) [-345.852] (-345.100) (-346.387) * (-345.534) [-347.201] (-345.511) (-347.473) -- 0:00:21
      635000 -- (-361.631) (-348.941) (-347.794) [-345.087] * (-348.759) [-346.731] (-348.890) (-346.227) -- 0:00:21

      Average standard deviation of split frequencies: 0.006496

      635500 -- (-355.420) (-346.148) (-346.702) [-346.421] * (-345.194) (-346.810) (-347.264) [-348.082] -- 0:00:21
      636000 -- (-348.045) (-346.238) [-345.013] (-345.690) * (-347.325) (-353.344) (-348.606) [-347.260] -- 0:00:21
      636500 -- (-346.250) [-347.202] (-347.215) (-350.105) * [-345.684] (-346.145) (-346.438) (-347.456) -- 0:00:21
      637000 -- (-346.806) (-347.737) (-345.750) [-347.918] * (-348.270) [-346.201] (-346.245) (-349.180) -- 0:00:21
      637500 -- (-345.539) (-345.819) [-348.678] (-348.402) * (-345.606) [-345.584] (-347.948) (-348.192) -- 0:00:21
      638000 -- (-345.965) [-345.805] (-347.132) (-345.720) * (-347.804) (-348.370) (-348.747) [-346.317] -- 0:00:21
      638500 -- (-346.696) (-346.006) [-346.209] (-347.933) * (-345.520) [-348.556] (-346.204) (-346.529) -- 0:00:21
      639000 -- (-347.310) [-346.883] (-352.269) (-346.789) * [-348.999] (-346.976) (-345.963) (-345.262) -- 0:00:21
      639500 -- (-346.432) (-348.833) (-348.193) [-347.186] * (-345.182) (-347.629) [-344.745] (-348.719) -- 0:00:21
      640000 -- (-350.538) (-346.734) [-347.715] (-346.030) * (-348.259) (-347.632) [-348.512] (-346.348) -- 0:00:21

      Average standard deviation of split frequencies: 0.006418

      640500 -- (-347.441) (-349.391) (-347.115) [-345.065] * (-348.555) (-349.199) [-346.370] (-347.293) -- 0:00:21
      641000 -- (-347.690) (-349.461) [-348.390] (-346.615) * (-346.161) (-346.280) [-348.535] (-348.351) -- 0:00:21
      641500 -- (-346.063) (-348.116) (-346.901) [-346.173] * (-345.691) (-352.679) [-347.108] (-350.468) -- 0:00:21
      642000 -- (-345.464) (-350.107) [-346.059] (-344.814) * (-348.531) (-345.311) (-346.059) [-344.941] -- 0:00:21
      642500 -- [-346.050] (-349.186) (-345.700) (-347.485) * (-347.224) (-346.940) (-351.040) [-347.174] -- 0:00:21
      643000 -- [-346.223] (-348.490) (-350.058) (-345.758) * (-345.932) (-346.161) (-346.383) [-345.774] -- 0:00:21
      643500 -- (-346.190) [-346.667] (-348.008) (-345.640) * (-345.537) [-349.074] (-352.866) (-348.501) -- 0:00:21
      644000 -- (-346.634) (-348.927) [-347.464] (-347.601) * (-346.453) (-347.502) [-348.024] (-346.875) -- 0:00:21
      644500 -- (-350.442) (-353.685) (-347.112) [-347.152] * [-346.458] (-347.554) (-345.012) (-349.268) -- 0:00:21
      645000 -- (-347.857) (-347.998) (-349.405) [-348.219] * (-347.987) [-346.588] (-344.917) (-353.720) -- 0:00:21

      Average standard deviation of split frequencies: 0.006041

      645500 -- [-347.303] (-350.613) (-348.327) (-346.531) * [-346.746] (-345.711) (-346.086) (-347.701) -- 0:00:21
      646000 -- (-347.094) (-348.021) (-349.344) [-346.780] * (-347.011) (-348.844) [-346.209] (-346.490) -- 0:00:21
      646500 -- (-345.764) (-349.186) [-346.209] (-347.368) * [-348.096] (-348.664) (-345.639) (-345.958) -- 0:00:21
      647000 -- (-345.692) (-348.855) (-349.084) [-346.694] * [-346.804] (-348.376) (-345.097) (-348.293) -- 0:00:21
      647500 -- (-346.191) (-348.122) [-348.526] (-347.922) * (-346.594) (-347.547) (-347.113) [-345.558] -- 0:00:21
      648000 -- (-344.942) (-348.262) (-346.806) [-344.776] * (-346.540) [-345.256] (-345.379) (-346.612) -- 0:00:21
      648500 -- (-345.167) (-346.201) (-347.231) [-347.161] * (-348.049) (-347.217) (-347.550) [-346.855] -- 0:00:21
      649000 -- (-345.395) [-345.065] (-345.941) (-345.454) * (-345.469) [-345.872] (-348.291) (-347.450) -- 0:00:21
      649500 -- [-347.075] (-349.663) (-347.333) (-345.931) * (-347.449) (-346.706) (-346.355) [-346.574] -- 0:00:21
      650000 -- (-345.766) (-347.949) [-346.732] (-346.216) * (-348.293) (-347.262) [-347.228] (-346.058) -- 0:00:21

      Average standard deviation of split frequencies: 0.005876

      650500 -- (-346.256) [-345.339] (-346.002) (-347.060) * (-347.449) [-346.891] (-349.934) (-346.494) -- 0:00:20
      651000 -- (-347.670) [-346.875] (-347.655) (-345.478) * [-347.027] (-348.893) (-346.729) (-346.504) -- 0:00:20
      651500 -- [-350.318] (-348.305) (-346.206) (-346.727) * (-345.862) (-352.227) [-346.185] (-345.118) -- 0:00:20
      652000 -- (-345.310) (-347.101) [-345.680] (-352.529) * (-347.243) (-347.124) [-348.437] (-345.352) -- 0:00:20
      652500 -- [-345.357] (-347.257) (-346.300) (-350.045) * (-348.676) [-346.809] (-350.080) (-345.327) -- 0:00:20
      653000 -- (-352.109) (-346.862) [-346.451] (-353.478) * (-347.761) [-348.017] (-347.152) (-347.500) -- 0:00:20
      653500 -- (-347.287) (-348.866) (-349.711) [-347.279] * [-346.081] (-348.944) (-347.932) (-345.985) -- 0:00:20
      654000 -- (-344.779) (-346.667) (-350.970) [-349.370] * (-347.137) (-346.358) (-345.610) [-351.395] -- 0:00:20
      654500 -- (-349.055) (-350.947) [-347.478] (-352.155) * [-347.514] (-347.812) (-347.216) (-351.089) -- 0:00:20
      655000 -- [-348.922] (-350.281) (-346.515) (-349.381) * (-346.171) (-351.165) [-348.485] (-349.295) -- 0:00:20

      Average standard deviation of split frequencies: 0.005120

      655500 -- (-346.509) (-346.893) [-346.479] (-347.282) * (-345.006) (-348.062) (-347.693) [-347.530] -- 0:00:20
      656000 -- (-345.483) [-345.139] (-346.702) (-345.662) * (-346.514) (-347.758) [-348.230] (-345.929) -- 0:00:20
      656500 -- (-350.649) [-346.339] (-345.827) (-349.447) * (-347.103) (-349.918) (-345.305) [-346.889] -- 0:00:20
      657000 -- (-347.916) (-347.041) [-346.730] (-347.925) * [-345.312] (-348.247) (-346.562) (-346.316) -- 0:00:20
      657500 -- (-346.870) (-345.793) [-346.802] (-346.255) * [-346.117] (-345.828) (-346.465) (-348.495) -- 0:00:20
      658000 -- [-345.225] (-346.626) (-345.770) (-346.481) * [-345.250] (-346.632) (-345.802) (-344.833) -- 0:00:20
      658500 -- (-346.723) [-346.970] (-346.605) (-346.822) * (-349.180) (-352.614) [-347.356] (-350.438) -- 0:00:20
      659000 -- (-346.721) (-346.265) (-348.466) [-345.976] * (-347.334) (-344.787) (-350.843) [-349.193] -- 0:00:20
      659500 -- [-345.718] (-346.344) (-345.536) (-346.919) * (-345.334) [-350.246] (-349.665) (-349.865) -- 0:00:20
      660000 -- (-348.454) (-346.245) [-348.186] (-351.612) * [-345.138] (-352.650) (-345.870) (-351.207) -- 0:00:20

      Average standard deviation of split frequencies: 0.005834

      660500 -- (-346.242) (-348.784) [-347.055] (-347.891) * (-349.026) [-347.950] (-345.669) (-347.761) -- 0:00:20
      661000 -- (-345.984) (-349.241) [-345.217] (-350.696) * (-346.233) (-346.966) (-347.064) [-349.709] -- 0:00:20
      661500 -- [-345.629] (-350.252) (-345.953) (-346.956) * (-346.512) (-345.803) [-348.848] (-349.250) -- 0:00:20
      662000 -- (-345.172) [-346.054] (-347.008) (-346.179) * [-348.108] (-349.672) (-346.403) (-347.902) -- 0:00:20
      662500 -- [-345.476] (-347.879) (-347.356) (-348.942) * [-346.070] (-346.242) (-346.164) (-352.010) -- 0:00:20
      663000 -- (-348.346) (-349.402) [-348.284] (-345.459) * (-349.265) (-352.320) (-345.286) [-349.662] -- 0:00:20
      663500 -- [-350.561] (-345.538) (-348.376) (-347.892) * (-350.923) (-348.121) (-349.983) [-349.414] -- 0:00:20
      664000 -- (-350.621) (-344.820) (-348.858) [-345.721] * (-351.060) [-346.424] (-347.978) (-346.297) -- 0:00:20
      664500 -- (-348.115) (-346.702) (-345.383) [-347.117] * (-348.689) (-345.630) (-348.930) [-345.661] -- 0:00:20
      665000 -- [-347.622] (-347.360) (-347.534) (-345.681) * [-352.292] (-347.009) (-345.570) (-345.843) -- 0:00:20

      Average standard deviation of split frequencies: 0.005996

      665500 -- (-347.065) (-346.910) [-348.672] (-346.318) * (-348.416) (-345.248) (-345.853) [-345.706] -- 0:00:20
      666000 -- [-346.715] (-348.968) (-346.633) (-346.450) * (-347.705) (-349.221) [-347.093] (-348.253) -- 0:00:20
      666500 -- (-347.123) [-346.510] (-346.742) (-347.390) * [-346.509] (-346.572) (-347.045) (-349.592) -- 0:00:20
      667000 -- (-346.522) (-347.666) [-346.125] (-347.129) * (-345.860) (-349.873) [-346.708] (-346.068) -- 0:00:19
      667500 -- (-349.091) (-348.937) [-347.907] (-349.195) * (-347.998) (-346.541) [-345.652] (-351.268) -- 0:00:19
      668000 -- [-346.553] (-347.445) (-347.572) (-351.512) * (-352.678) (-349.500) [-349.014] (-349.648) -- 0:00:19
      668500 -- (-350.639) (-345.576) [-345.093] (-350.649) * [-348.097] (-347.485) (-346.173) (-351.075) -- 0:00:19
      669000 -- [-346.491] (-347.128) (-348.868) (-347.357) * (-348.518) (-345.957) (-349.272) [-345.802] -- 0:00:19
      669500 -- (-347.135) [-348.795] (-348.310) (-352.371) * (-348.742) [-350.573] (-349.064) (-345.272) -- 0:00:19
      670000 -- (-346.146) [-350.094] (-352.483) (-350.572) * (-348.474) [-346.171] (-347.317) (-347.319) -- 0:00:19

      Average standard deviation of split frequencies: 0.005755

      670500 -- [-346.592] (-347.140) (-346.630) (-351.952) * (-349.834) [-350.546] (-356.947) (-349.314) -- 0:00:19
      671000 -- (-346.937) [-345.770] (-345.731) (-345.985) * (-347.795) (-349.445) (-351.073) [-347.580] -- 0:00:19
      671500 -- (-346.147) (-349.130) (-346.704) [-345.900] * [-348.975] (-347.730) (-348.053) (-346.974) -- 0:00:19
      672000 -- (-346.306) [-347.048] (-348.399) (-346.747) * (-346.699) (-351.699) (-347.098) [-349.170] -- 0:00:19
      672500 -- (-346.465) [-350.408] (-351.610) (-345.880) * (-350.626) [-346.531] (-347.008) (-349.406) -- 0:00:19
      673000 -- (-347.987) [-346.471] (-346.325) (-346.061) * (-347.232) (-347.309) (-347.741) [-346.375] -- 0:00:19
      673500 -- (-347.249) [-348.049] (-345.754) (-345.390) * (-349.979) [-346.455] (-350.564) (-351.957) -- 0:00:19
      674000 -- (-347.253) (-347.512) (-346.376) [-346.394] * (-348.190) (-347.381) [-347.621] (-353.681) -- 0:00:19
      674500 -- (-348.986) (-349.030) (-349.904) [-347.944] * (-345.258) [-352.092] (-346.279) (-346.366) -- 0:00:19
      675000 -- (-345.287) (-349.407) [-347.911] (-347.913) * (-350.653) (-351.582) (-347.100) [-345.468] -- 0:00:19

      Average standard deviation of split frequencies: 0.005884

      675500 -- (-345.165) [-347.671] (-348.239) (-349.473) * [-346.772] (-347.621) (-346.033) (-345.738) -- 0:00:19
      676000 -- (-346.357) [-347.213] (-345.984) (-348.181) * (-348.814) [-345.521] (-349.307) (-346.520) -- 0:00:19
      676500 -- (-347.362) [-347.880] (-346.740) (-347.696) * [-347.927] (-345.582) (-345.655) (-350.039) -- 0:00:19
      677000 -- (-346.840) (-349.119) (-348.193) [-347.957] * (-347.318) [-348.538] (-345.805) (-347.937) -- 0:00:19
      677500 -- (-348.260) (-348.368) [-346.661] (-348.286) * [-345.660] (-349.388) (-349.107) (-346.275) -- 0:00:19
      678000 -- (-349.176) [-345.769] (-346.634) (-346.714) * (-345.307) [-350.348] (-345.832) (-346.935) -- 0:00:19
      678500 -- (-346.639) [-347.848] (-347.439) (-345.896) * (-345.315) (-349.497) (-348.552) [-348.876] -- 0:00:19
      679000 -- (-348.013) (-349.067) (-348.467) [-348.946] * [-346.568] (-347.284) (-346.236) (-346.367) -- 0:00:19
      679500 -- [-349.626] (-345.762) (-349.729) (-349.005) * (-346.999) (-349.706) (-347.806) [-346.800] -- 0:00:19
      680000 -- (-348.180) (-345.014) (-345.322) [-348.179] * [-345.079] (-346.737) (-347.606) (-347.972) -- 0:00:19

      Average standard deviation of split frequencies: 0.005541

      680500 -- (-352.159) (-345.652) (-347.290) [-346.973] * [-345.986] (-346.423) (-348.952) (-350.981) -- 0:00:19
      681000 -- (-349.184) (-346.686) [-347.384] (-347.380) * [-346.652] (-347.893) (-348.658) (-348.642) -- 0:00:19
      681500 -- (-346.039) [-348.097] (-348.922) (-345.720) * [-349.092] (-346.396) (-347.658) (-347.456) -- 0:00:19
      682000 -- (-349.551) [-351.808] (-346.379) (-344.803) * [-348.840] (-345.656) (-347.917) (-348.677) -- 0:00:19
      682500 -- (-346.743) (-349.791) [-347.291] (-346.411) * [-345.986] (-347.319) (-346.456) (-347.859) -- 0:00:19
      683000 -- (-348.451) [-351.901] (-347.435) (-346.473) * [-346.411] (-349.287) (-347.020) (-345.812) -- 0:00:19
      683500 -- (-346.970) (-347.295) (-346.067) [-346.099] * (-350.771) (-346.308) [-349.673] (-347.546) -- 0:00:18
      684000 -- (-346.754) (-347.458) (-349.315) [-346.266] * (-345.178) (-346.175) (-346.598) [-346.866] -- 0:00:18
      684500 -- [-345.394] (-350.892) (-345.290) (-347.118) * (-346.339) (-348.417) [-346.961] (-346.926) -- 0:00:18
      685000 -- (-346.526) (-347.857) [-345.026] (-346.765) * (-346.475) (-345.936) [-344.851] (-344.937) -- 0:00:18

      Average standard deviation of split frequencies: 0.005755

      685500 -- (-345.739) (-346.955) [-346.485] (-350.322) * (-348.681) [-345.764] (-347.031) (-346.566) -- 0:00:18
      686000 -- (-352.345) (-345.642) [-345.960] (-347.512) * (-346.258) [-347.754] (-348.910) (-346.563) -- 0:00:18
      686500 -- [-347.531] (-345.232) (-347.685) (-344.892) * [-347.047] (-347.846) (-347.026) (-345.809) -- 0:00:18
      687000 -- [-346.537] (-348.086) (-347.250) (-345.746) * (-354.731) [-347.169] (-350.740) (-347.761) -- 0:00:18
      687500 -- (-354.471) (-347.484) [-346.141] (-347.792) * (-351.004) (-346.240) (-346.621) [-348.938] -- 0:00:18
      688000 -- (-350.513) (-347.449) (-347.945) [-346.959] * [-348.713] (-346.342) (-346.265) (-347.482) -- 0:00:18
      688500 -- (-350.371) [-345.352] (-346.242) (-345.160) * [-348.911] (-347.296) (-347.148) (-346.253) -- 0:00:18
      689000 -- (-347.287) (-348.885) (-346.238) [-346.708] * (-346.943) (-347.575) (-346.546) [-349.764] -- 0:00:18
      689500 -- [-347.767] (-345.458) (-349.543) (-349.771) * [-346.974] (-346.522) (-345.963) (-347.658) -- 0:00:18
      690000 -- [-346.791] (-349.290) (-348.620) (-347.999) * (-350.069) [-347.370] (-349.639) (-351.323) -- 0:00:18

      Average standard deviation of split frequencies: 0.006356

      690500 -- (-349.527) (-350.260) [-347.579] (-351.371) * (-347.927) [-349.736] (-346.308) (-345.612) -- 0:00:18
      691000 -- (-346.575) [-346.195] (-345.700) (-349.731) * [-346.172] (-350.621) (-349.195) (-346.130) -- 0:00:18
      691500 -- [-345.705] (-347.214) (-346.235) (-347.475) * (-351.658) (-352.427) (-348.958) [-347.003] -- 0:00:18
      692000 -- [-347.302] (-346.970) (-345.630) (-347.225) * (-350.197) (-345.487) (-346.076) [-349.344] -- 0:00:18
      692500 -- (-345.874) (-345.676) [-347.505] (-353.197) * (-347.667) (-347.674) [-349.265] (-346.002) -- 0:00:18
      693000 -- (-347.477) (-347.299) [-349.116] (-350.263) * (-346.949) (-347.384) [-346.057] (-348.484) -- 0:00:18
      693500 -- (-347.828) [-349.430] (-350.990) (-349.608) * (-345.663) (-347.120) [-347.087] (-348.502) -- 0:00:18
      694000 -- (-347.345) (-347.442) (-348.114) [-345.911] * (-345.354) (-349.809) (-348.813) [-345.681] -- 0:00:18
      694500 -- (-347.306) [-351.192] (-346.203) (-349.941) * (-347.885) [-346.428] (-346.408) (-350.441) -- 0:00:18
      695000 -- [-345.168] (-349.547) (-345.542) (-350.807) * [-346.696] (-347.871) (-349.383) (-347.892) -- 0:00:18

      Average standard deviation of split frequencies: 0.004877

      695500 -- (-345.795) (-352.243) (-347.464) [-347.345] * (-345.094) (-346.423) [-346.087] (-347.698) -- 0:00:18
      696000 -- (-345.650) [-345.999] (-348.567) (-347.857) * (-347.305) (-347.274) (-345.938) [-347.668] -- 0:00:18
      696500 -- (-345.191) [-345.589] (-345.164) (-347.291) * (-347.737) (-346.767) (-347.431) [-345.367] -- 0:00:18
      697000 -- (-346.401) (-348.954) [-346.124] (-346.092) * (-349.782) [-352.962] (-346.121) (-346.951) -- 0:00:18
      697500 -- (-346.907) (-348.751) [-345.818] (-346.379) * [-349.386] (-350.608) (-345.516) (-346.247) -- 0:00:18
      698000 -- (-349.152) [-346.869] (-345.394) (-347.744) * (-346.231) [-349.797] (-350.225) (-349.353) -- 0:00:18
      698500 -- (-346.746) [-345.413] (-346.905) (-345.285) * (-345.615) [-348.117] (-348.289) (-349.808) -- 0:00:18
      699000 -- (-346.196) [-346.253] (-347.503) (-345.416) * [-349.042] (-346.537) (-348.691) (-348.850) -- 0:00:18
      699500 -- [-346.119] (-345.015) (-349.481) (-345.260) * (-345.923) (-345.055) [-348.787] (-353.280) -- 0:00:18
      700000 -- (-348.100) (-347.550) (-353.852) [-346.224] * (-347.629) (-350.985) (-346.790) [-347.268] -- 0:00:18

      Average standard deviation of split frequencies: 0.005845

      700500 -- (-348.108) [-345.182] (-346.682) (-347.925) * (-349.950) [-345.873] (-345.539) (-347.271) -- 0:00:17
      701000 -- [-346.461] (-345.678) (-346.196) (-346.759) * (-351.435) (-346.197) (-346.718) [-345.823] -- 0:00:17
      701500 -- (-347.478) (-346.416) (-348.176) [-344.755] * [-345.926] (-348.850) (-345.584) (-347.613) -- 0:00:17
      702000 -- (-345.017) (-345.048) [-348.145] (-347.341) * [-347.722] (-345.890) (-349.637) (-346.147) -- 0:00:17
      702500 -- [-347.603] (-344.918) (-356.894) (-351.176) * (-346.437) (-346.530) [-345.209] (-349.058) -- 0:00:17
      703000 -- (-345.638) (-346.020) (-347.701) [-347.740] * (-347.278) (-345.841) (-347.869) [-346.254] -- 0:00:17
      703500 -- (-346.160) (-346.291) [-347.931] (-346.352) * (-348.384) (-348.519) [-346.947] (-344.821) -- 0:00:17
      704000 -- [-346.239] (-347.850) (-345.959) (-346.932) * (-346.061) [-346.776] (-345.721) (-346.553) -- 0:00:17
      704500 -- [-349.857] (-345.661) (-348.431) (-347.177) * (-346.668) [-346.891] (-352.089) (-347.327) -- 0:00:17
      705000 -- (-345.559) (-346.576) (-346.491) [-345.938] * (-346.984) (-351.449) (-350.523) [-347.546] -- 0:00:17

      Average standard deviation of split frequencies: 0.006127

      705500 -- (-346.302) [-346.109] (-345.200) (-347.742) * [-345.136] (-347.923) (-345.277) (-346.606) -- 0:00:17
      706000 -- (-345.923) [-345.139] (-345.411) (-346.510) * (-345.776) (-346.639) [-347.418] (-345.729) -- 0:00:17
      706500 -- (-347.806) (-348.655) (-348.551) [-347.945] * (-347.175) (-347.634) [-347.061] (-351.465) -- 0:00:17
      707000 -- (-347.817) [-344.746] (-350.634) (-346.255) * (-347.446) (-348.106) [-344.728] (-350.421) -- 0:00:17
      707500 -- (-346.621) (-346.920) [-350.224] (-350.022) * (-350.307) (-346.344) [-346.648] (-348.579) -- 0:00:17
      708000 -- (-346.812) (-348.189) [-348.573] (-347.991) * [-346.161] (-345.544) (-346.620) (-346.541) -- 0:00:17
      708500 -- (-347.265) (-347.895) (-349.547) [-347.015] * (-345.087) [-347.883] (-345.983) (-349.232) -- 0:00:17
      709000 -- (-348.095) [-347.590] (-348.267) (-346.964) * (-345.626) (-349.446) [-346.023] (-349.116) -- 0:00:17
      709500 -- (-347.178) (-345.516) [-345.685] (-347.494) * (-346.318) [-345.221] (-345.638) (-345.277) -- 0:00:17
      710000 -- (-348.920) (-346.601) (-346.678) [-347.198] * (-345.706) (-348.129) (-349.355) [-345.323] -- 0:00:17

      Average standard deviation of split frequencies: 0.005721

      710500 -- (-349.220) (-345.750) [-346.467] (-348.931) * (-349.065) (-350.196) [-349.778] (-346.855) -- 0:00:17
      711000 -- (-345.342) (-347.648) (-346.740) [-348.615] * [-346.740] (-346.881) (-355.330) (-347.166) -- 0:00:17
      711500 -- [-347.608] (-347.489) (-354.323) (-349.033) * [-347.173] (-348.689) (-351.698) (-351.657) -- 0:00:17
      712000 -- (-350.188) [-346.948] (-346.450) (-346.917) * [-349.121] (-347.339) (-349.321) (-346.381) -- 0:00:17
      712500 -- (-347.766) (-349.555) (-346.609) [-345.088] * (-346.239) (-347.998) (-345.649) [-346.788] -- 0:00:17
      713000 -- (-346.641) [-346.337] (-345.516) (-348.749) * (-350.306) (-349.268) (-345.166) [-347.153] -- 0:00:17
      713500 -- (-346.306) (-347.452) [-351.126] (-347.717) * [-346.706] (-346.951) (-347.988) (-346.214) -- 0:00:17
      714000 -- (-349.862) (-346.328) [-348.471] (-348.292) * [-346.293] (-349.640) (-347.296) (-345.846) -- 0:00:17
      714500 -- (-347.039) [-347.086] (-346.923) (-345.545) * (-348.023) (-346.168) (-349.156) [-348.281] -- 0:00:17
      715000 -- (-346.576) (-347.126) (-348.904) [-346.194] * (-348.249) (-345.801) [-346.688] (-346.981) -- 0:00:17

      Average standard deviation of split frequencies: 0.005349

      715500 -- (-346.999) [-349.882] (-346.372) (-348.689) * [-347.640] (-345.800) (-348.959) (-347.325) -- 0:00:17
      716000 -- (-347.061) [-350.841] (-346.686) (-350.876) * (-347.787) [-345.514] (-345.917) (-348.039) -- 0:00:17
      716500 -- (-347.863) [-348.293] (-351.700) (-345.163) * (-347.198) (-348.443) [-346.687] (-345.748) -- 0:00:17
      717000 -- (-352.702) [-346.612] (-349.160) (-348.210) * [-353.277] (-348.579) (-350.605) (-348.259) -- 0:00:16
      717500 -- (-347.363) (-347.357) (-346.106) [-348.332] * (-348.342) (-348.138) (-350.615) [-345.335] -- 0:00:16
      718000 -- (-353.118) [-347.739] (-345.392) (-346.997) * (-346.039) [-345.789] (-346.104) (-350.650) -- 0:00:16
      718500 -- (-344.792) (-348.749) (-346.837) [-346.956] * (-346.311) [-345.796] (-349.795) (-347.284) -- 0:00:16
      719000 -- (-347.612) [-347.935] (-345.948) (-348.847) * (-346.405) [-346.093] (-346.524) (-348.153) -- 0:00:16
      719500 -- (-346.513) (-349.765) (-348.038) [-348.221] * (-347.789) [-348.732] (-346.634) (-348.262) -- 0:00:16
      720000 -- (-346.738) (-349.550) (-347.901) [-346.059] * (-350.014) (-346.461) [-348.242] (-345.601) -- 0:00:16

      Average standard deviation of split frequencies: 0.005277

      720500 -- (-347.155) [-348.279] (-347.324) (-347.301) * (-354.546) (-350.206) [-346.491] (-348.372) -- 0:00:16
      721000 -- (-350.328) (-346.500) (-345.231) [-348.664] * (-345.135) (-346.498) [-347.088] (-347.690) -- 0:00:16
      721500 -- (-347.627) [-345.242] (-347.065) (-347.710) * (-347.298) (-346.792) (-348.215) [-345.662] -- 0:00:16
      722000 -- (-347.543) (-346.661) (-347.845) [-347.498] * (-345.296) (-346.171) [-345.806] (-346.591) -- 0:00:16
      722500 -- [-345.970] (-348.013) (-347.522) (-347.050) * (-345.559) (-345.211) (-348.208) [-344.866] -- 0:00:16
      723000 -- (-346.256) (-347.161) (-349.702) [-349.622] * (-348.992) [-345.541] (-347.578) (-345.826) -- 0:00:16
      723500 -- (-346.433) (-352.965) (-346.711) [-345.059] * (-349.563) [-346.626] (-347.737) (-344.995) -- 0:00:16
      724000 -- (-349.660) (-348.838) (-345.934) [-344.783] * (-346.425) (-346.439) [-348.278] (-346.671) -- 0:00:16
      724500 -- (-346.294) (-349.294) (-346.806) [-344.892] * (-350.713) [-348.048] (-348.666) (-351.556) -- 0:00:16
      725000 -- (-349.760) (-347.169) (-347.109) [-344.676] * (-347.724) (-350.274) (-349.007) [-345.884] -- 0:00:16

      Average standard deviation of split frequencies: 0.005729

      725500 -- (-347.053) (-350.811) [-349.301] (-345.481) * (-345.858) [-346.758] (-351.625) (-346.155) -- 0:00:16
      726000 -- [-347.112] (-346.787) (-345.451) (-346.622) * [-346.796] (-345.336) (-349.491) (-348.395) -- 0:00:16
      726500 -- (-347.849) (-349.199) (-346.877) [-349.926] * (-350.007) (-345.537) (-346.130) [-346.826] -- 0:00:16
      727000 -- (-347.599) (-345.644) [-345.380] (-347.939) * (-348.321) (-346.546) [-349.091] (-350.768) -- 0:00:16
      727500 -- (-349.765) [-346.740] (-346.017) (-348.358) * (-345.860) [-349.855] (-349.111) (-347.789) -- 0:00:16
      728000 -- (-345.476) [-348.479] (-345.933) (-346.423) * (-345.068) (-345.368) (-350.548) [-348.745] -- 0:00:16
      728500 -- (-345.516) (-346.823) [-347.277] (-345.686) * (-347.643) (-346.831) [-349.785] (-347.065) -- 0:00:16
      729000 -- (-346.690) [-350.386] (-348.688) (-345.264) * (-346.977) (-350.772) (-350.056) [-349.608] -- 0:00:16
      729500 -- (-345.129) [-348.862] (-349.670) (-345.608) * (-349.234) [-347.765] (-347.670) (-346.168) -- 0:00:16
      730000 -- (-346.333) [-350.573] (-350.884) (-347.122) * (-347.238) (-347.867) (-348.679) [-347.617] -- 0:00:16

      Average standard deviation of split frequencies: 0.005769

      730500 -- (-351.555) (-351.648) (-347.371) [-345.118] * [-346.022] (-347.977) (-345.100) (-347.595) -- 0:00:16
      731000 -- (-348.953) [-349.911] (-345.537) (-346.069) * (-346.812) (-345.696) (-347.216) [-347.323] -- 0:00:16
      731500 -- (-347.686) [-345.295] (-345.375) (-347.490) * (-347.484) (-347.595) [-347.165] (-348.188) -- 0:00:16
      732000 -- (-348.867) (-347.016) [-347.677] (-355.316) * (-346.101) (-346.277) (-347.208) [-346.030] -- 0:00:16
      732500 -- (-346.771) (-345.164) [-345.663] (-348.493) * [-345.580] (-345.885) (-346.097) (-347.301) -- 0:00:16
      733000 -- (-350.726) (-345.361) (-352.386) [-348.760] * (-345.560) (-345.277) (-346.460) [-349.087] -- 0:00:16
      733500 -- (-347.669) [-345.158] (-346.904) (-347.919) * (-348.526) [-344.907] (-345.324) (-347.639) -- 0:00:15
      734000 -- (-348.087) [-347.262] (-345.583) (-347.946) * (-348.545) [-345.487] (-346.826) (-346.262) -- 0:00:15
      734500 -- (-347.526) (-348.520) [-346.612] (-347.188) * (-347.366) (-344.958) [-345.796] (-345.840) -- 0:00:15
      735000 -- [-348.050] (-352.979) (-347.244) (-347.555) * (-346.579) [-344.686] (-344.894) (-346.914) -- 0:00:15

      Average standard deviation of split frequencies: 0.006156

      735500 -- (-348.523) (-346.736) (-347.513) [-346.164] * (-350.829) [-347.474] (-345.905) (-348.532) -- 0:00:15
      736000 -- (-344.837) [-347.317] (-345.124) (-346.761) * (-347.924) (-346.775) (-346.038) [-347.215] -- 0:00:15
      736500 -- [-346.078] (-345.151) (-346.917) (-346.961) * [-346.169] (-345.359) (-345.423) (-348.834) -- 0:00:15
      737000 -- (-346.207) [-348.542] (-348.409) (-348.487) * [-345.261] (-344.913) (-351.799) (-346.427) -- 0:00:15
      737500 -- [-346.019] (-347.053) (-350.028) (-349.152) * (-346.669) (-345.532) (-349.584) [-346.509] -- 0:00:15
      738000 -- (-346.086) (-346.327) [-346.606] (-345.619) * (-345.429) (-346.938) [-346.794] (-345.544) -- 0:00:15
      738500 -- (-347.659) [-346.075] (-352.100) (-345.249) * [-345.242] (-348.735) (-345.843) (-346.844) -- 0:00:15
      739000 -- [-346.271] (-347.409) (-350.751) (-346.887) * [-346.027] (-353.056) (-345.082) (-347.288) -- 0:00:15
      739500 -- (-345.495) (-350.295) [-349.126] (-346.582) * (-346.873) (-345.911) [-346.973] (-345.368) -- 0:00:15
      740000 -- [-347.195] (-349.393) (-348.905) (-346.124) * (-346.964) [-347.832] (-346.817) (-347.025) -- 0:00:15

      Average standard deviation of split frequencies: 0.005251

      740500 -- (-346.154) (-350.074) [-346.524] (-346.883) * [-346.056] (-345.156) (-347.899) (-352.718) -- 0:00:15
      741000 -- (-347.508) (-348.267) [-345.355] (-347.069) * (-346.954) (-346.138) [-345.116] (-352.550) -- 0:00:15
      741500 -- [-346.209] (-346.158) (-348.318) (-347.105) * [-346.013] (-349.473) (-348.672) (-347.717) -- 0:00:15
      742000 -- (-345.141) [-346.164] (-346.036) (-347.076) * [-349.215] (-345.066) (-345.169) (-346.906) -- 0:00:15
      742500 -- (-348.595) (-350.061) (-350.049) [-348.303] * (-346.065) [-347.842] (-345.537) (-346.006) -- 0:00:15
      743000 -- (-348.621) (-349.287) (-348.080) [-346.301] * (-345.606) (-345.609) [-345.554] (-347.177) -- 0:00:15
      743500 -- (-345.434) (-353.000) [-348.754] (-347.147) * (-349.365) (-348.493) [-346.395] (-345.178) -- 0:00:15
      744000 -- (-350.282) [-345.812] (-345.695) (-351.051) * (-346.259) (-348.941) [-346.009] (-345.851) -- 0:00:15
      744500 -- (-346.509) (-347.733) [-345.764] (-347.216) * (-345.723) [-346.869] (-345.568) (-348.190) -- 0:00:15
      745000 -- (-349.848) (-349.449) (-346.292) [-347.410] * [-346.487] (-348.797) (-347.095) (-345.997) -- 0:00:15

      Average standard deviation of split frequencies: 0.005292

      745500 -- (-347.474) (-349.972) [-347.901] (-348.598) * (-348.127) (-347.234) [-345.421] (-345.964) -- 0:00:15
      746000 -- (-345.822) (-349.069) (-349.047) [-347.044] * [-347.090] (-347.110) (-346.957) (-351.573) -- 0:00:15
      746500 -- (-349.313) [-346.209] (-347.429) (-346.085) * [-347.806] (-348.621) (-347.735) (-346.238) -- 0:00:15
      747000 -- (-350.336) [-346.365] (-350.933) (-349.825) * (-346.487) (-345.574) [-346.891] (-349.074) -- 0:00:15
      747500 -- (-347.254) [-351.283] (-348.017) (-345.460) * (-345.939) (-346.041) (-348.382) [-346.577] -- 0:00:15
      748000 -- (-345.507) [-348.389] (-348.606) (-348.174) * [-348.266] (-345.955) (-354.969) (-348.306) -- 0:00:15
      748500 -- (-345.843) (-348.126) [-347.696] (-356.842) * (-349.571) [-346.190] (-348.590) (-345.649) -- 0:00:15
      749000 -- (-345.624) (-346.196) (-347.533) [-350.720] * (-350.063) (-346.493) (-348.891) [-351.094] -- 0:00:15
      749500 -- [-348.175] (-345.051) (-346.893) (-352.259) * (-347.747) [-348.262] (-348.361) (-347.879) -- 0:00:15
      750000 -- (-350.128) (-346.516) [-347.295] (-347.636) * (-350.431) (-346.683) (-347.911) [-346.035] -- 0:00:15

      Average standard deviation of split frequencies: 0.005259

      750500 -- (-346.859) (-345.883) (-347.055) [-349.102] * [-349.477] (-347.962) (-346.757) (-346.631) -- 0:00:14
      751000 -- (-345.598) [-346.444] (-348.215) (-346.331) * [-348.954] (-346.580) (-348.536) (-349.989) -- 0:00:14
      751500 -- (-345.661) (-345.570) (-346.962) [-348.638] * (-346.334) (-349.387) [-347.178] (-346.706) -- 0:00:14
      752000 -- (-347.005) (-348.889) [-346.112] (-348.771) * [-345.023] (-346.106) (-346.657) (-346.485) -- 0:00:14
      752500 -- (-347.340) (-345.772) [-349.989] (-347.999) * (-348.720) (-349.236) (-350.760) [-345.045] -- 0:00:14
      753000 -- (-347.484) [-350.454] (-346.425) (-348.155) * (-345.058) [-348.331] (-352.659) (-349.213) -- 0:00:14
      753500 -- [-345.786] (-347.071) (-346.204) (-350.046) * (-346.812) [-346.570] (-352.363) (-347.383) -- 0:00:14
      754000 -- [-345.621] (-345.462) (-347.262) (-347.241) * (-347.729) (-346.799) (-347.005) [-345.692] -- 0:00:14
      754500 -- (-347.106) [-345.382] (-346.201) (-352.212) * [-348.511] (-347.076) (-349.589) (-345.852) -- 0:00:14
      755000 -- (-348.682) [-345.430] (-346.906) (-353.752) * [-350.947] (-347.567) (-350.029) (-346.478) -- 0:00:14

      Average standard deviation of split frequencies: 0.005905

      755500 -- (-346.218) [-345.450] (-347.083) (-353.336) * (-347.033) (-345.312) [-349.512] (-347.249) -- 0:00:14
      756000 -- (-345.821) (-346.999) [-345.637] (-351.653) * (-345.450) [-344.921] (-345.576) (-349.125) -- 0:00:14
      756500 -- [-346.631] (-350.025) (-345.093) (-353.334) * [-347.211] (-347.127) (-348.106) (-345.825) -- 0:00:14
      757000 -- [-346.044] (-348.103) (-346.124) (-347.092) * [-345.909] (-347.020) (-347.019) (-349.636) -- 0:00:14
      757500 -- (-350.256) (-345.439) [-346.588] (-348.961) * [-346.582] (-346.664) (-349.739) (-345.984) -- 0:00:14
      758000 -- (-345.065) (-346.954) [-346.719] (-345.699) * (-348.137) (-345.889) [-350.559] (-352.718) -- 0:00:14
      758500 -- (-348.711) (-349.910) (-345.481) [-346.106] * (-350.494) (-346.089) (-348.424) [-350.814] -- 0:00:14
      759000 -- (-349.911) [-346.785] (-346.317) (-347.663) * [-345.952] (-346.441) (-352.432) (-348.509) -- 0:00:14
      759500 -- (-346.725) (-345.854) (-345.711) [-347.307] * (-347.659) (-345.488) (-348.941) [-346.701] -- 0:00:14
      760000 -- (-346.178) (-346.224) [-346.040] (-346.280) * (-346.782) (-347.691) (-348.135) [-347.505] -- 0:00:14

      Average standard deviation of split frequencies: 0.005743

      760500 -- (-345.240) (-347.335) [-345.770] (-349.776) * (-347.244) (-345.153) [-346.525] (-346.656) -- 0:00:14
      761000 -- (-344.819) [-347.652] (-348.914) (-346.456) * (-345.547) [-345.682] (-348.787) (-346.292) -- 0:00:14
      761500 -- [-347.463] (-347.629) (-346.464) (-345.758) * (-346.563) [-346.706] (-345.468) (-347.953) -- 0:00:14
      762000 -- (-347.208) [-346.459] (-345.722) (-346.429) * (-347.653) [-347.978] (-345.193) (-353.458) -- 0:00:14
      762500 -- (-347.992) [-346.500] (-346.447) (-351.263) * [-345.689] (-346.533) (-346.788) (-347.499) -- 0:00:14
      763000 -- [-346.037] (-348.860) (-352.185) (-349.314) * (-346.748) (-346.639) (-346.210) [-347.741] -- 0:00:13
      763500 -- (-345.965) [-348.091] (-346.945) (-347.567) * (-346.380) (-352.410) (-347.224) [-348.510] -- 0:00:14
      764000 -- (-345.965) (-346.915) [-347.220] (-347.688) * [-346.839] (-350.482) (-349.703) (-348.372) -- 0:00:14
      764500 -- (-344.886) (-350.487) (-353.917) [-346.069] * (-346.327) (-349.368) (-347.483) [-348.775] -- 0:00:14
      765000 -- (-346.619) [-348.306] (-351.290) (-348.565) * (-348.430) (-350.101) (-348.697) [-345.832] -- 0:00:14

      Average standard deviation of split frequencies: 0.006116

      765500 -- (-346.928) (-347.782) (-347.193) [-348.024] * [-345.823] (-346.814) (-348.780) (-348.649) -- 0:00:14
      766000 -- (-345.719) [-346.519] (-347.208) (-348.076) * [-345.876] (-348.112) (-349.806) (-348.551) -- 0:00:14
      766500 -- (-350.207) (-345.629) [-347.313] (-353.066) * (-348.827) (-345.004) [-348.077] (-347.681) -- 0:00:14
      767000 -- [-349.657] (-347.976) (-350.375) (-351.165) * (-346.214) (-345.994) (-348.295) [-347.447] -- 0:00:13
      767500 -- [-347.335] (-346.218) (-346.805) (-348.233) * (-350.452) (-346.593) (-351.719) [-348.633] -- 0:00:13
      768000 -- (-349.151) (-350.887) (-346.330) [-346.604] * [-347.324] (-345.741) (-348.580) (-349.537) -- 0:00:13
      768500 -- (-351.164) (-347.173) (-345.152) [-348.121] * (-347.657) (-346.134) [-347.853] (-349.351) -- 0:00:13
      769000 -- (-345.870) (-346.666) (-346.647) [-347.133] * (-346.380) [-345.448] (-346.271) (-346.565) -- 0:00:13
      769500 -- (-346.998) (-346.496) [-348.831] (-346.239) * (-345.582) [-346.789] (-346.138) (-345.780) -- 0:00:13
      770000 -- (-346.550) (-347.685) (-347.553) [-350.618] * (-349.109) [-346.350] (-347.290) (-345.648) -- 0:00:13

      Average standard deviation of split frequencies: 0.006576

      770500 -- (-346.772) (-345.310) [-347.669] (-348.111) * (-345.941) (-346.227) (-346.225) [-345.979] -- 0:00:13
      771000 -- (-348.163) (-348.314) (-347.709) [-346.669] * [-347.897] (-346.950) (-348.668) (-348.458) -- 0:00:13
      771500 -- (-349.079) (-348.271) (-345.308) [-345.541] * [-346.160] (-346.906) (-347.071) (-347.394) -- 0:00:13
      772000 -- (-353.022) (-347.405) (-350.631) [-346.094] * [-345.581] (-347.136) (-350.923) (-347.759) -- 0:00:13
      772500 -- (-356.421) (-345.889) [-345.559] (-345.467) * (-351.210) [-344.991] (-346.984) (-347.174) -- 0:00:13
      773000 -- (-347.894) (-346.667) (-347.782) [-349.029] * [-349.043] (-346.068) (-346.679) (-349.465) -- 0:00:13
      773500 -- (-346.175) [-346.058] (-345.552) (-346.788) * (-346.887) [-347.354] (-345.240) (-348.563) -- 0:00:13
      774000 -- (-349.796) (-348.359) (-346.236) [-345.754] * (-347.963) (-345.918) [-348.146] (-346.507) -- 0:00:13
      774500 -- (-347.865) (-347.149) [-346.021] (-345.944) * (-347.019) (-348.538) (-346.535) [-345.155] -- 0:00:13
      775000 -- (-344.881) (-346.928) [-348.470] (-346.157) * (-346.681) (-351.661) (-347.728) [-346.917] -- 0:00:13

      Average standard deviation of split frequencies: 0.006303

      775500 -- (-348.751) (-346.910) [-345.753] (-347.317) * [-347.565] (-347.415) (-347.382) (-345.429) -- 0:00:13
      776000 -- (-345.874) (-350.659) [-345.467] (-354.311) * (-347.031) (-346.430) [-346.323] (-345.878) -- 0:00:13
      776500 -- [-347.542] (-349.351) (-345.705) (-351.983) * (-347.307) (-346.593) [-348.219] (-347.189) -- 0:00:13
      777000 -- [-346.473] (-347.062) (-349.350) (-347.978) * [-345.294] (-348.362) (-347.478) (-348.368) -- 0:00:13
      777500 -- [-346.908] (-345.714) (-345.972) (-348.493) * (-345.766) [-346.458] (-349.974) (-347.575) -- 0:00:13
      778000 -- (-345.760) [-345.632] (-347.408) (-347.086) * (-346.893) (-349.932) [-346.203] (-346.834) -- 0:00:13
      778500 -- (-345.526) (-349.348) [-345.250] (-348.777) * (-346.288) (-348.276) [-348.416] (-346.309) -- 0:00:13
      779000 -- (-346.407) (-346.471) (-348.796) [-347.034] * [-348.463] (-346.114) (-349.200) (-346.036) -- 0:00:13
      779500 -- (-351.431) [-347.078] (-347.967) (-347.085) * [-352.854] (-346.625) (-347.683) (-346.020) -- 0:00:13
      780000 -- (-346.397) (-347.164) [-345.424] (-350.708) * (-353.846) [-345.539] (-345.734) (-345.748) -- 0:00:12

      Average standard deviation of split frequencies: 0.007057

      780500 -- [-347.577] (-348.879) (-345.422) (-347.143) * (-351.336) (-345.612) (-346.089) [-347.516] -- 0:00:13
      781000 -- (-352.245) (-347.319) [-347.414] (-350.611) * (-347.944) (-347.765) [-346.130] (-347.719) -- 0:00:13
      781500 -- (-347.713) (-346.413) [-345.520] (-350.621) * (-346.037) [-346.207] (-347.818) (-351.639) -- 0:00:13
      782000 -- (-345.983) (-349.143) (-346.969) [-351.391] * (-345.163) (-345.441) (-348.113) [-349.207] -- 0:00:13
      782500 -- (-346.892) (-345.061) [-347.403] (-347.765) * [-345.610] (-347.551) (-347.809) (-348.113) -- 0:00:13
      783000 -- (-351.242) (-347.629) [-346.281] (-345.841) * [-345.480] (-347.771) (-352.894) (-346.758) -- 0:00:13
      783500 -- (-346.397) (-346.684) [-346.396] (-346.287) * [-348.626] (-350.229) (-350.259) (-345.449) -- 0:00:12
      784000 -- (-348.770) (-346.236) [-346.279] (-346.872) * (-350.304) (-346.917) (-350.163) [-345.798] -- 0:00:12
      784500 -- (-347.392) (-355.133) [-346.844] (-347.511) * (-345.934) (-349.623) [-349.011] (-346.166) -- 0:00:12
      785000 -- [-352.332] (-346.015) (-345.166) (-347.507) * (-346.048) (-351.316) [-346.902] (-345.539) -- 0:00:12

      Average standard deviation of split frequencies: 0.006972

      785500 -- (-351.931) [-347.249] (-345.196) (-346.590) * [-345.170] (-348.694) (-351.261) (-347.827) -- 0:00:12
      786000 -- (-349.671) (-348.049) [-345.506] (-352.498) * (-346.073) (-346.528) [-349.521] (-346.645) -- 0:00:12
      786500 -- [-348.303] (-349.598) (-349.459) (-346.828) * (-344.860) (-346.851) [-347.686] (-346.671) -- 0:00:12
      787000 -- (-345.991) (-346.685) (-349.397) [-347.500] * (-350.281) (-346.844) (-347.185) [-347.121] -- 0:00:12
      787500 -- (-345.235) (-351.753) [-348.190] (-345.804) * (-350.547) (-346.715) [-345.908] (-347.736) -- 0:00:12
      788000 -- (-345.116) [-345.253] (-346.032) (-346.787) * (-349.733) [-345.881] (-344.677) (-346.944) -- 0:00:12
      788500 -- (-346.843) (-345.006) [-346.251] (-347.087) * (-348.009) (-347.697) (-345.950) [-346.943] -- 0:00:12
      789000 -- (-345.442) (-348.357) [-346.244] (-347.628) * (-349.893) (-346.036) [-346.482] (-348.779) -- 0:00:12
      789500 -- [-346.687] (-346.359) (-349.716) (-348.548) * (-350.277) (-347.759) [-347.944] (-345.951) -- 0:00:12
      790000 -- (-346.806) (-347.139) (-347.605) [-347.000] * (-345.792) (-345.621) (-344.897) [-345.048] -- 0:00:12

      Average standard deviation of split frequencies: 0.006148

      790500 -- (-347.442) (-346.681) [-345.394] (-346.918) * (-347.500) [-345.450] (-351.624) (-347.325) -- 0:00:12
      791000 -- (-346.016) (-344.972) [-348.453] (-348.721) * (-347.888) (-347.001) (-351.613) [-347.934] -- 0:00:12
      791500 -- (-346.436) [-346.568] (-347.292) (-345.316) * (-347.374) (-346.658) [-349.587] (-346.880) -- 0:00:12
      792000 -- (-345.657) (-346.358) (-345.894) [-346.210] * (-348.121) (-348.454) (-348.425) [-345.168] -- 0:00:12
      792500 -- [-347.968] (-344.826) (-345.574) (-346.650) * (-349.354) (-346.736) (-346.178) [-346.849] -- 0:00:12
      793000 -- (-344.973) (-345.332) (-348.849) [-346.451] * (-345.831) (-347.147) [-346.786] (-348.107) -- 0:00:12
      793500 -- [-345.021] (-347.166) (-350.238) (-347.401) * (-346.603) (-349.004) (-350.388) [-345.838] -- 0:00:12
      794000 -- (-349.792) (-347.901) [-349.728] (-352.044) * (-347.101) [-346.004] (-345.908) (-347.402) -- 0:00:12
      794500 -- (-344.940) (-348.837) (-351.821) [-346.407] * (-346.012) (-345.250) [-346.542] (-346.104) -- 0:00:12
      795000 -- (-347.271) (-346.107) (-349.401) [-348.317] * (-347.530) (-345.813) [-346.182] (-346.956) -- 0:00:12

      Average standard deviation of split frequencies: 0.005811

      795500 -- [-345.653] (-347.623) (-345.184) (-348.598) * (-348.067) (-348.513) [-345.915] (-347.710) -- 0:00:12
      796000 -- (-347.475) [-348.293] (-347.693) (-347.865) * [-348.636] (-348.679) (-347.723) (-345.111) -- 0:00:12
      796500 -- [-345.970] (-345.913) (-345.454) (-347.306) * [-354.642] (-352.775) (-346.327) (-346.359) -- 0:00:12
      797000 -- (-346.531) [-345.845] (-347.614) (-345.063) * (-349.299) [-347.342] (-347.855) (-347.064) -- 0:00:11
      797500 -- (-344.920) [-348.722] (-348.362) (-348.073) * (-346.930) (-349.383) [-347.994] (-346.866) -- 0:00:11
      798000 -- (-347.315) (-347.807) [-346.668] (-348.911) * (-345.881) (-346.589) (-349.004) [-344.826] -- 0:00:12
      798500 -- (-346.023) [-350.112] (-350.601) (-348.155) * [-347.614] (-347.120) (-350.674) (-345.925) -- 0:00:12
      799000 -- (-348.516) [-350.050] (-349.637) (-347.935) * (-345.768) (-345.932) (-351.157) [-345.295] -- 0:00:12
      799500 -- [-347.402] (-350.022) (-350.013) (-345.570) * (-350.589) [-346.367] (-347.543) (-345.920) -- 0:00:12
      800000 -- (-351.101) (-346.618) [-346.589] (-349.665) * (-350.510) (-345.615) [-348.282] (-346.434) -- 0:00:12

      Average standard deviation of split frequencies: 0.005534

      800500 -- (-350.186) [-346.752] (-348.056) (-349.941) * (-346.780) (-347.739) (-345.487) [-347.030] -- 0:00:11
      801000 -- (-348.125) [-345.758] (-347.021) (-349.847) * (-346.023) (-347.353) [-345.409] (-357.158) -- 0:00:11
      801500 -- (-349.718) [-353.778] (-346.747) (-346.763) * [-347.638] (-346.618) (-346.927) (-346.424) -- 0:00:11
      802000 -- [-347.550] (-350.746) (-347.132) (-346.667) * (-348.696) [-348.595] (-347.169) (-347.984) -- 0:00:11
      802500 -- (-348.531) [-346.976] (-347.949) (-348.010) * [-346.204] (-344.725) (-348.573) (-348.432) -- 0:00:11
      803000 -- (-349.112) (-347.607) [-350.935] (-347.099) * (-349.457) (-345.982) [-346.511] (-348.439) -- 0:00:11
      803500 -- (-345.377) (-348.655) [-347.860] (-346.038) * (-346.290) (-344.834) (-352.498) [-347.626] -- 0:00:11
      804000 -- [-347.423] (-344.959) (-347.756) (-349.703) * (-345.370) (-345.243) (-348.202) [-346.794] -- 0:00:11
      804500 -- (-346.266) [-345.135] (-349.480) (-348.586) * (-348.718) (-345.628) [-345.808] (-346.365) -- 0:00:11
      805000 -- (-346.842) (-345.357) [-345.585] (-351.440) * [-346.688] (-346.291) (-345.888) (-348.056) -- 0:00:11

      Average standard deviation of split frequencies: 0.005300

      805500 -- (-348.681) (-346.723) [-346.478] (-348.557) * (-345.769) [-347.546] (-349.774) (-352.473) -- 0:00:11
      806000 -- (-346.159) [-346.200] (-347.882) (-348.056) * (-346.667) (-346.949) [-350.263] (-348.555) -- 0:00:11
      806500 -- (-345.498) (-350.154) (-350.377) [-347.133] * (-346.928) [-349.607] (-350.847) (-347.984) -- 0:00:11
      807000 -- (-347.732) (-351.251) (-351.281) [-346.724] * (-347.428) (-347.948) [-351.746] (-347.909) -- 0:00:11
      807500 -- (-345.483) (-347.947) (-349.707) [-347.436] * (-347.995) [-347.373] (-347.186) (-351.965) -- 0:00:11
      808000 -- [-345.307] (-347.879) (-352.152) (-346.214) * [-346.087] (-347.687) (-345.853) (-347.992) -- 0:00:11
      808500 -- (-350.036) [-346.040] (-349.334) (-346.872) * (-346.230) (-350.550) (-345.777) [-345.943] -- 0:00:11
      809000 -- (-345.728) [-350.506] (-351.936) (-347.263) * [-346.492] (-348.314) (-350.062) (-346.337) -- 0:00:11
      809500 -- [-349.519] (-350.274) (-347.641) (-347.868) * (-348.484) (-348.139) (-346.740) [-349.187] -- 0:00:11
      810000 -- (-349.946) [-349.664] (-347.432) (-348.496) * (-345.490) (-349.405) (-346.245) [-347.088] -- 0:00:11

      Average standard deviation of split frequencies: 0.004768

      810500 -- (-347.248) [-348.841] (-347.515) (-345.676) * (-345.837) (-347.323) (-352.548) [-348.641] -- 0:00:11
      811000 -- (-347.425) (-346.818) (-348.346) [-346.779] * (-352.984) [-348.145] (-350.741) (-347.306) -- 0:00:11
      811500 -- (-348.068) (-347.551) (-346.436) [-345.192] * (-347.972) (-348.838) (-351.912) [-345.903] -- 0:00:11
      812000 -- (-346.730) (-350.658) (-345.790) [-345.403] * (-346.702) (-350.866) (-348.954) [-345.210] -- 0:00:11
      812500 -- (-345.501) (-351.952) [-346.750] (-345.706) * (-346.483) [-346.803] (-345.496) (-345.220) -- 0:00:11
      813000 -- (-346.111) (-347.099) [-344.850] (-345.110) * (-346.508) [-346.959] (-346.303) (-347.677) -- 0:00:11
      813500 -- (-349.562) (-346.365) (-347.190) [-349.584] * [-344.994] (-349.484) (-345.614) (-349.264) -- 0:00:11
      814000 -- (-350.511) [-347.048] (-346.935) (-350.454) * (-349.468) (-347.371) (-353.792) [-353.118] -- 0:00:10
      814500 -- [-345.401] (-346.687) (-345.377) (-348.091) * [-345.952] (-345.702) (-347.659) (-349.752) -- 0:00:10
      815000 -- [-346.540] (-349.657) (-347.600) (-349.483) * (-349.518) (-346.500) [-345.895] (-346.341) -- 0:00:11

      Average standard deviation of split frequencies: 0.004583

      815500 -- (-347.248) (-346.199) [-345.548] (-348.818) * [-347.265] (-346.200) (-346.252) (-345.099) -- 0:00:11
      816000 -- (-347.230) [-348.158] (-346.789) (-348.118) * (-346.218) [-346.544] (-345.890) (-346.449) -- 0:00:11
      816500 -- [-351.107] (-348.051) (-346.465) (-347.217) * (-348.236) (-345.365) (-349.423) [-346.212] -- 0:00:11
      817000 -- (-347.636) (-347.626) (-345.445) [-347.269] * (-347.135) (-346.782) [-350.952] (-350.853) -- 0:00:10
      817500 -- (-346.128) (-347.471) (-346.484) [-346.788] * (-346.754) (-345.666) (-346.469) [-345.376] -- 0:00:10
      818000 -- [-347.978] (-348.501) (-352.274) (-348.241) * (-347.961) (-345.586) (-345.945) [-345.776] -- 0:00:10
      818500 -- (-348.013) (-345.663) [-347.142] (-349.993) * (-347.940) (-348.017) [-345.525] (-346.729) -- 0:00:10
      819000 -- (-348.511) [-346.003] (-348.987) (-346.972) * (-348.581) [-347.671] (-347.595) (-345.651) -- 0:00:10
      819500 -- (-345.951) [-345.911] (-347.111) (-347.082) * (-346.807) [-346.548] (-345.792) (-345.092) -- 0:00:10
      820000 -- (-346.475) (-348.028) [-345.943] (-345.438) * [-347.287] (-350.590) (-346.083) (-345.798) -- 0:00:10

      Average standard deviation of split frequencies: 0.003983

      820500 -- (-346.388) (-346.604) [-346.038] (-346.363) * (-349.193) (-347.663) (-346.895) [-346.357] -- 0:00:10
      821000 -- (-347.961) [-347.871] (-348.486) (-346.031) * (-349.938) [-348.772] (-346.971) (-346.601) -- 0:00:10
      821500 -- (-347.846) [-346.857