--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 17:19:10 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/4res/ML0370/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1167.65 -1170.95 2 -1167.61 -1170.80 -------------------------------------- TOTAL -1167.63 -1170.88 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899955 0.090754 0.379139 1.532987 0.859462 1314.91 1342.78 1.000 r(A<->C){all} 0.175971 0.021783 0.000070 0.461744 0.137083 215.11 296.77 1.001 r(A<->G){all} 0.172260 0.021551 0.000032 0.469017 0.129672 110.33 119.06 1.000 r(A<->T){all} 0.164051 0.018649 0.000091 0.444509 0.128633 219.27 312.50 1.000 r(C<->G){all} 0.161184 0.019642 0.000171 0.439103 0.123554 245.33 278.74 1.000 r(C<->T){all} 0.163311 0.020204 0.000159 0.458815 0.124742 142.67 169.67 1.000 r(G<->T){all} 0.163223 0.018964 0.000071 0.426802 0.126476 247.69 248.71 1.006 pi(A){all} 0.166333 0.000160 0.141820 0.190354 0.165696 1122.02 1311.51 1.000 pi(C){all} 0.326052 0.000254 0.296385 0.358033 0.326009 1043.87 1206.46 1.000 pi(G){all} 0.314931 0.000238 0.283321 0.343901 0.314981 1276.25 1388.62 1.000 pi(T){all} 0.192684 0.000180 0.167199 0.218646 0.192189 1332.92 1346.82 1.000 alpha{1,2} 0.431898 0.225550 0.000126 1.361259 0.265020 1177.87 1276.18 1.000 alpha{3} 0.454786 0.229382 0.000169 1.377253 0.308068 1152.54 1170.48 1.001 pinvar{all} 0.998261 0.000005 0.994368 0.999999 0.998918 1396.68 1415.07 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1139.658748 Model 2: PositiveSelection -1139.658735 Model 0: one-ratio -1139.658738 Model 7: beta -1139.658755 Model 8: beta&w>1 -1139.658755 Model 0 vs 1 1.9999999949504854E-5 Model 2 vs 1 2.6000000161729986E-5 Model 8 vs 7 0.0
>C1 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >C2 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >C3 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >C4 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >C5 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >C6 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=289 C1 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG C2 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG C3 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG C4 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG C5 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG C6 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG ************************************************** C1 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS C2 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS C3 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS C4 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS C5 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS C6 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ************************************************** C1 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK C2 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK C3 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK C4 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK C5 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK C6 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK ************************************************** C1 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD C2 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD C3 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD C4 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD C5 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD C6 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ************************************************** C1 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG C2 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG C3 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG C4 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG C5 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG C6 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG ************************************************** C1 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK C2 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK C3 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK C4 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK C5 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK C6 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK *************************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 289 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 289 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8670] Library Relaxation: Multi_proc [96] Relaxation Summary: [8670]--->[8670] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.504 Mb, Max= 30.849 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG C2 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG C3 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG C4 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG C5 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG C6 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG ************************************************** C1 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS C2 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS C3 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS C4 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS C5 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS C6 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ************************************************** C1 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK C2 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK C3 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK C4 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK C5 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK C6 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK ************************************************** C1 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD C2 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD C3 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD C4 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD C5 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD C6 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ************************************************** C1 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG C2 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG C3 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG C4 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG C5 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG C6 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG ************************************************** C1 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK C2 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK C3 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK C4 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK C5 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK C6 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK *************************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT C2 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT C3 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT C4 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT C5 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT C6 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT ************************************************** C1 CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG C2 CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG C3 CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG C4 CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG C5 CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG C6 CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG ************************************************** C1 GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC C2 GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC C3 GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC C4 GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC C5 GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC C6 GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC ************************************************** C1 GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT C2 GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT C3 GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT C4 GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT C5 GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT C6 GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT ************************************************** C1 GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC C2 GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC C3 GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC C4 GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC C5 GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC C6 GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC ************************************************** C1 AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG C2 AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG C3 AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG C4 AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG C5 AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG C6 AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG ************************************************** C1 GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT C2 GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT C3 GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT C4 GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT C5 GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT C6 GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT ************************************************** C1 GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG C2 GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG C3 GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG C4 GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG C5 GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG C6 GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG ************************************************** C1 CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA C2 CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA C3 CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA C4 CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA C5 CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA C6 CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA ************************************************** C1 TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC C2 TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC C3 TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC C4 TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC C5 TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC C6 TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC ************************************************** C1 GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC C2 GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC C3 GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC C4 GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC C5 GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC C6 GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC ************************************************** C1 CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT C2 CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT C3 CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT C4 CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT C5 CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT C6 CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT ************************************************** C1 GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG C2 GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG C3 GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG C4 GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG C5 GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG C6 GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG ************************************************** C1 GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC C2 GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC C3 GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC C4 GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC C5 GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC C6 GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC ************************************************** C1 AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC C2 AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC C3 AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC C4 AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC C5 AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC C6 AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC ************************************************** C1 GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA C2 GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA C3 GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA C4 GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA C5 GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA C6 GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA ************************************************** C1 TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA C2 TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA C3 TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA C4 TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA C5 TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA C6 TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA ************************************************** C1 TCGTCACGCTGCTGAAG C2 TCGTCACGCTGCTGAAG C3 TCGTCACGCTGCTGAAG C4 TCGTCACGCTGCTGAAG C5 TCGTCACGCTGCTGAAG C6 TCGTCACGCTGCTGAAG ***************** >C1 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG >C2 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG >C3 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG >C4 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG >C5 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG >C6 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG >C1 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >C2 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >C3 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >C4 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >C5 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >C6 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 867 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579799870 Setting output file names to "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 889636499 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0677405464 Seed = 1469614394 Swapseed = 1579799870 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1940.387565 -- -24.965149 Chain 2 -- -1940.387565 -- -24.965149 Chain 3 -- -1940.387565 -- -24.965149 Chain 4 -- -1940.387565 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1940.387565 -- -24.965149 Chain 2 -- -1940.387565 -- -24.965149 Chain 3 -- -1940.387565 -- -24.965149 Chain 4 -- -1940.387565 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1940.388] (-1940.388) (-1940.388) (-1940.388) * [-1940.388] (-1940.388) (-1940.388) (-1940.388) 500 -- (-1179.537) [-1180.081] (-1185.141) (-1177.766) * [-1183.257] (-1200.329) (-1174.250) (-1201.701) -- 0:00:00 1000 -- (-1178.100) [-1179.503] (-1183.402) (-1176.888) * (-1178.112) (-1177.849) [-1169.288] (-1181.923) -- 0:00:00 1500 -- (-1176.345) [-1175.018] (-1189.190) (-1179.965) * (-1173.912) (-1186.942) (-1184.438) [-1170.996] -- 0:00:00 2000 -- (-1177.722) [-1175.524] (-1181.873) (-1177.676) * (-1178.409) (-1180.891) (-1177.793) [-1178.848] -- 0:00:00 2500 -- (-1178.137) (-1175.827) (-1172.543) [-1173.120] * (-1171.655) (-1181.200) [-1176.279] (-1190.752) -- 0:00:00 3000 -- (-1175.143) [-1172.260] (-1180.326) (-1173.734) * (-1174.834) (-1185.999) (-1178.217) [-1177.025] -- 0:00:00 3500 -- (-1186.642) (-1177.665) [-1174.187] (-1180.908) * (-1181.716) (-1183.094) [-1178.646] (-1169.381) -- 0:00:00 4000 -- [-1178.810] (-1176.504) (-1178.229) (-1180.489) * (-1173.564) (-1180.744) (-1177.332) [-1168.577] -- 0:00:00 4500 -- (-1180.348) (-1181.876) (-1175.368) [-1172.708] * (-1177.208) [-1180.060] (-1181.419) (-1169.093) -- 0:00:00 5000 -- [-1177.315] (-1183.812) (-1175.126) (-1181.594) * (-1173.657) (-1172.985) [-1175.207] (-1169.922) -- 0:03:19 Average standard deviation of split frequencies: 0.104757 5500 -- (-1178.372) (-1182.509) (-1176.122) [-1182.772] * (-1182.623) (-1180.507) [-1172.630] (-1171.209) -- 0:03:00 6000 -- [-1176.510] (-1176.015) (-1176.303) (-1184.626) * [-1177.157] (-1175.220) (-1181.355) (-1171.237) -- 0:02:45 6500 -- [-1175.058] (-1186.401) (-1175.122) (-1181.955) * (-1172.817) [-1177.293] (-1177.309) (-1167.991) -- 0:02:32 7000 -- (-1178.382) [-1180.032] (-1186.348) (-1177.433) * [-1171.535] (-1180.073) (-1177.336) (-1167.810) -- 0:02:21 7500 -- (-1180.686) [-1181.520] (-1175.186) (-1178.979) * (-1180.629) (-1176.554) [-1178.633] (-1167.141) -- 0:02:12 8000 -- [-1173.217] (-1181.386) (-1181.064) (-1183.484) * (-1171.440) (-1179.573) [-1180.778] (-1172.013) -- 0:02:04 8500 -- (-1173.114) (-1178.810) (-1172.584) [-1176.982] * (-1172.925) (-1183.642) (-1177.231) [-1166.626] -- 0:01:56 9000 -- (-1177.487) (-1184.699) [-1173.807] (-1176.931) * (-1176.016) (-1175.842) (-1175.443) [-1171.279] -- 0:01:50 9500 -- (-1182.340) (-1179.257) [-1173.754] (-1174.644) * [-1174.047] (-1173.863) (-1183.919) (-1168.697) -- 0:01:44 10000 -- (-1178.254) (-1185.359) [-1171.950] (-1167.446) * [-1169.724] (-1180.877) (-1185.882) (-1167.079) -- 0:01:39 Average standard deviation of split frequencies: 0.086062 10500 -- [-1175.021] (-1173.277) (-1177.250) (-1167.814) * (-1172.891) (-1173.786) [-1178.644] (-1169.807) -- 0:01:34 11000 -- (-1179.397) (-1172.833) (-1182.193) [-1168.569] * [-1175.341] (-1173.509) (-1179.626) (-1167.979) -- 0:01:29 11500 -- (-1178.421) (-1180.553) [-1182.857] (-1171.001) * [-1174.808] (-1178.418) (-1180.719) (-1168.267) -- 0:01:25 12000 -- (-1174.841) (-1179.691) [-1180.624] (-1170.341) * (-1182.554) (-1180.555) (-1184.132) [-1168.258] -- 0:01:22 12500 -- (-1173.079) (-1182.968) [-1182.531] (-1172.349) * (-1176.543) (-1183.040) [-1179.881] (-1166.665) -- 0:01:19 13000 -- [-1176.649] (-1178.545) (-1172.350) (-1166.313) * (-1174.421) [-1176.305] (-1172.647) (-1170.530) -- 0:01:15 13500 -- [-1175.805] (-1178.550) (-1172.222) (-1166.989) * (-1174.587) [-1172.740] (-1182.954) (-1171.866) -- 0:01:13 14000 -- (-1171.010) (-1177.689) [-1170.977] (-1167.907) * (-1180.963) (-1170.776) [-1177.673] (-1166.960) -- 0:01:10 14500 -- [-1172.078] (-1179.026) (-1172.268) (-1168.609) * [-1178.377] (-1179.217) (-1180.573) (-1167.627) -- 0:01:07 15000 -- (-1174.835) (-1175.513) (-1172.138) [-1170.372] * [-1171.801] (-1180.125) (-1175.537) (-1167.120) -- 0:01:05 Average standard deviation of split frequencies: 0.063578 15500 -- [-1175.205] (-1174.997) (-1173.172) (-1170.299) * (-1186.099) (-1179.694) (-1178.016) [-1169.432] -- 0:01:03 16000 -- (-1175.369) (-1178.827) (-1170.648) [-1169.437] * (-1178.728) (-1177.202) [-1183.510] (-1170.779) -- 0:01:01 16500 -- [-1176.181] (-1176.389) (-1169.776) (-1168.851) * [-1177.290] (-1179.826) (-1179.008) (-1168.384) -- 0:00:59 17000 -- (-1175.441) (-1177.024) [-1167.025] (-1169.266) * (-1182.967) (-1179.495) (-1171.840) [-1166.649] -- 0:00:57 17500 -- (-1173.687) (-1173.308) (-1167.032) [-1168.064] * (-1190.810) (-1177.972) (-1168.515) [-1166.574] -- 0:00:56 18000 -- (-1174.182) (-1176.212) (-1167.749) [-1169.073] * (-1183.879) (-1179.553) (-1168.105) [-1167.447] -- 0:00:54 18500 -- (-1174.532) (-1180.879) [-1168.531] (-1167.947) * (-1166.986) (-1189.989) (-1168.233) [-1169.025] -- 0:00:53 19000 -- (-1174.995) (-1176.419) [-1168.392] (-1170.039) * (-1168.223) [-1180.694] (-1168.862) (-1168.359) -- 0:00:51 19500 -- (-1175.791) [-1175.024] (-1170.683) (-1168.793) * (-1169.879) (-1185.806) [-1169.506] (-1169.142) -- 0:00:50 20000 -- (-1179.158) (-1172.066) (-1171.557) [-1166.495] * (-1173.101) (-1176.901) (-1169.242) [-1167.196] -- 0:01:38 Average standard deviation of split frequencies: 0.058826 20500 -- (-1178.200) [-1175.129] (-1170.791) (-1169.186) * (-1167.569) (-1180.186) (-1166.889) [-1167.494] -- 0:01:35 21000 -- (-1184.896) [-1173.603] (-1170.042) (-1171.267) * (-1167.684) (-1175.617) [-1167.178] (-1166.700) -- 0:01:33 21500 -- (-1179.640) [-1174.745] (-1168.281) (-1170.158) * [-1166.566] (-1177.353) (-1167.425) (-1166.811) -- 0:01:31 22000 -- (-1181.048) [-1175.221] (-1168.451) (-1169.005) * [-1168.117] (-1179.511) (-1170.479) (-1167.014) -- 0:01:28 22500 -- (-1180.457) (-1185.100) (-1168.906) [-1169.157] * (-1168.463) (-1172.792) (-1167.104) [-1169.082] -- 0:01:26 23000 -- [-1188.612] (-1177.066) (-1169.709) (-1169.751) * (-1167.784) (-1171.729) (-1167.152) [-1169.391] -- 0:01:24 23500 -- [-1175.112] (-1178.145) (-1169.453) (-1172.545) * (-1169.513) (-1173.420) [-1167.548] (-1167.858) -- 0:01:23 24000 -- [-1180.321] (-1182.542) (-1170.290) (-1172.953) * (-1171.720) (-1169.093) [-1167.835] (-1170.565) -- 0:01:21 24500 -- [-1170.598] (-1180.767) (-1172.811) (-1176.580) * (-1170.328) (-1170.901) (-1167.234) [-1167.494] -- 0:01:19 25000 -- [-1175.621] (-1181.733) (-1168.441) (-1171.220) * (-1168.445) (-1170.782) [-1167.724] (-1169.046) -- 0:01:18 Average standard deviation of split frequencies: 0.041442 25500 -- (-1170.604) (-1188.228) [-1166.962] (-1172.074) * (-1169.093) (-1169.414) (-1168.452) [-1168.079] -- 0:01:16 26000 -- [-1176.746] (-1174.318) (-1168.117) (-1167.722) * (-1168.513) (-1166.920) (-1167.941) [-1167.572] -- 0:01:14 26500 -- [-1176.795] (-1182.014) (-1169.420) (-1168.232) * (-1168.384) [-1168.097] (-1170.290) (-1167.671) -- 0:01:13 27000 -- (-1177.682) (-1174.513) (-1169.431) [-1169.425] * (-1169.123) (-1167.399) [-1170.137] (-1167.975) -- 0:01:12 27500 -- (-1174.240) [-1179.512] (-1168.811) (-1168.051) * (-1167.077) [-1168.316] (-1170.947) (-1171.832) -- 0:01:10 28000 -- (-1186.494) (-1174.537) [-1167.889] (-1168.807) * [-1167.884] (-1169.778) (-1170.280) (-1170.325) -- 0:01:09 28500 -- (-1176.947) (-1182.739) (-1169.716) [-1166.534] * (-1167.458) [-1168.136] (-1169.224) (-1171.619) -- 0:01:08 29000 -- [-1173.015] (-1176.570) (-1166.176) (-1166.269) * [-1169.073] (-1169.870) (-1168.573) (-1169.875) -- 0:01:06 29500 -- (-1183.485) [-1177.514] (-1166.502) (-1169.091) * (-1167.510) [-1169.360] (-1168.962) (-1168.649) -- 0:01:05 30000 -- (-1183.627) (-1172.146) [-1166.136] (-1166.674) * (-1167.020) (-1170.567) (-1167.862) [-1166.843] -- 0:01:04 Average standard deviation of split frequencies: 0.047734 30500 -- (-1182.412) (-1183.193) (-1166.729) [-1167.887] * (-1166.795) (-1167.537) [-1169.012] (-1165.978) -- 0:01:03 31000 -- (-1182.507) [-1171.369] (-1168.624) (-1174.040) * (-1169.517) (-1167.054) (-1172.407) [-1167.083] -- 0:01:02 31500 -- [-1172.814] (-1175.375) (-1169.479) (-1177.160) * (-1167.771) (-1166.796) [-1169.383] (-1172.088) -- 0:01:01 32000 -- (-1181.324) [-1178.946] (-1166.926) (-1170.532) * (-1168.833) (-1167.017) (-1169.913) [-1168.182] -- 0:01:00 32500 -- (-1175.966) (-1173.380) [-1168.257] (-1167.928) * (-1168.607) [-1167.763] (-1168.146) (-1167.993) -- 0:00:59 33000 -- (-1176.336) (-1176.605) (-1167.769) [-1166.810] * (-1171.789) (-1166.623) (-1167.396) [-1169.565] -- 0:00:58 33500 -- [-1182.715] (-1175.673) (-1168.706) (-1166.082) * (-1167.518) (-1167.065) [-1166.474] (-1172.429) -- 0:00:57 34000 -- (-1177.030) (-1187.612) [-1169.345] (-1167.648) * (-1167.210) (-1167.631) [-1171.239] (-1167.595) -- 0:00:56 34500 -- (-1176.439) (-1184.937) (-1169.737) [-1168.968] * [-1166.486] (-1171.562) (-1166.568) (-1172.946) -- 0:00:55 35000 -- (-1182.077) (-1175.485) [-1172.014] (-1168.601) * [-1166.464] (-1167.661) (-1170.570) (-1170.924) -- 0:00:55 Average standard deviation of split frequencies: 0.043419 35500 -- (-1180.934) (-1174.806) (-1170.955) [-1168.356] * (-1168.617) (-1166.937) [-1168.359] (-1169.798) -- 0:00:54 36000 -- [-1176.276] (-1177.135) (-1168.597) (-1167.920) * [-1168.221] (-1169.017) (-1168.357) (-1171.637) -- 0:01:20 36500 -- (-1181.292) (-1178.575) (-1168.896) [-1167.849] * [-1167.550] (-1170.365) (-1170.831) (-1170.590) -- 0:01:19 37000 -- (-1179.567) (-1178.494) [-1173.734] (-1172.171) * (-1167.806) (-1172.212) [-1168.946] (-1169.281) -- 0:01:18 37500 -- (-1177.503) (-1174.950) (-1169.503) [-1168.042] * (-1169.430) (-1171.670) (-1167.499) [-1167.678] -- 0:01:17 38000 -- [-1182.380] (-1182.470) (-1166.801) (-1166.499) * (-1169.430) (-1172.905) [-1166.054] (-1169.440) -- 0:01:15 38500 -- [-1182.933] (-1174.403) (-1167.786) (-1170.102) * (-1167.848) (-1167.889) [-1168.845] (-1166.753) -- 0:01:14 39000 -- [-1177.861] (-1175.393) (-1167.150) (-1167.597) * (-1168.248) (-1169.946) [-1169.123] (-1166.754) -- 0:01:13 39500 -- (-1173.858) (-1179.644) (-1171.688) [-1172.193] * (-1168.699) (-1174.070) [-1167.121] (-1170.246) -- 0:01:12 40000 -- (-1178.379) (-1173.997) [-1167.195] (-1169.258) * (-1169.629) (-1173.232) [-1166.688] (-1169.442) -- 0:01:12 Average standard deviation of split frequencies: 0.040572 40500 -- [-1175.472] (-1178.314) (-1166.798) (-1167.270) * (-1168.687) (-1168.290) (-1170.121) [-1168.424] -- 0:01:11 41000 -- (-1180.245) (-1175.659) (-1166.979) [-1168.893] * (-1168.114) (-1166.806) [-1170.180] (-1167.978) -- 0:01:10 41500 -- [-1173.169] (-1174.632) (-1168.402) (-1169.137) * (-1167.984) (-1166.663) (-1169.945) [-1168.090] -- 0:01:09 42000 -- (-1174.105) (-1176.386) [-1167.087] (-1168.046) * (-1168.236) [-1167.866] (-1172.460) (-1169.235) -- 0:01:08 42500 -- [-1171.273] (-1176.448) (-1170.169) (-1169.173) * [-1168.878] (-1167.927) (-1167.377) (-1169.239) -- 0:01:07 43000 -- (-1177.612) (-1177.171) [-1166.503] (-1170.263) * (-1167.339) (-1167.294) [-1166.761] (-1171.319) -- 0:01:06 43500 -- (-1183.143) (-1178.193) (-1170.449) [-1170.274] * (-1166.913) [-1166.274] (-1168.620) (-1166.395) -- 0:01:05 44000 -- (-1173.721) [-1173.268] (-1167.793) (-1168.671) * [-1168.126] (-1166.930) (-1167.854) (-1166.168) -- 0:01:05 44500 -- (-1185.037) (-1174.976) (-1170.439) [-1169.657] * (-1166.995) (-1168.369) [-1171.895] (-1167.983) -- 0:01:04 45000 -- (-1177.988) (-1175.446) [-1170.437] (-1169.079) * (-1168.063) [-1167.620] (-1166.796) (-1169.052) -- 0:01:03 Average standard deviation of split frequencies: 0.032281 45500 -- (-1179.983) (-1174.553) (-1167.441) [-1167.576] * (-1166.598) [-1168.211] (-1168.538) (-1168.302) -- 0:01:02 46000 -- (-1178.453) (-1185.851) [-1170.028] (-1168.814) * (-1167.007) [-1166.212] (-1169.255) (-1167.682) -- 0:01:02 46500 -- [-1176.899] (-1177.673) (-1171.162) (-1169.800) * (-1167.402) (-1169.478) (-1169.396) [-1166.729] -- 0:01:01 47000 -- (-1174.368) (-1183.850) [-1167.664] (-1170.458) * (-1167.230) (-1170.662) (-1168.870) [-1166.478] -- 0:01:00 47500 -- [-1179.326] (-1188.442) (-1168.060) (-1170.508) * (-1168.343) (-1174.583) [-1171.630] (-1166.477) -- 0:01:00 48000 -- (-1184.474) (-1175.780) [-1169.395] (-1168.939) * [-1167.784] (-1168.906) (-1168.765) (-1166.208) -- 0:00:59 48500 -- (-1177.999) (-1181.973) [-1166.821] (-1172.077) * (-1170.982) (-1171.954) [-1166.617] (-1167.093) -- 0:00:58 49000 -- (-1176.271) [-1176.864] (-1168.324) (-1168.519) * (-1171.119) [-1171.443] (-1166.599) (-1167.071) -- 0:00:58 49500 -- (-1179.963) (-1180.001) (-1167.281) [-1167.471] * (-1170.408) (-1168.823) (-1169.626) [-1171.859] -- 0:00:57 50000 -- (-1188.148) (-1178.855) [-1167.274] (-1168.399) * (-1169.325) (-1167.263) (-1167.950) [-1166.635] -- 0:00:57 Average standard deviation of split frequencies: 0.028843 50500 -- (-1174.945) (-1180.595) [-1167.691] (-1173.053) * (-1171.908) [-1167.288] (-1168.420) (-1166.658) -- 0:00:56 51000 -- [-1175.207] (-1172.889) (-1168.136) (-1171.444) * [-1168.572] (-1166.717) (-1168.998) (-1169.055) -- 0:00:55 51500 -- [-1173.897] (-1173.563) (-1170.920) (-1168.207) * (-1169.163) [-1166.623] (-1176.293) (-1171.652) -- 0:00:55 52000 -- (-1171.213) [-1175.593] (-1169.133) (-1167.501) * (-1169.090) [-1168.888] (-1172.885) (-1170.133) -- 0:01:12 52500 -- (-1172.923) (-1177.816) [-1170.479] (-1169.147) * (-1169.372) (-1168.014) [-1167.801] (-1167.287) -- 0:01:12 53000 -- [-1173.076] (-1182.483) (-1169.969) (-1167.991) * (-1170.524) [-1168.927] (-1167.517) (-1169.388) -- 0:01:11 53500 -- [-1177.110] (-1184.730) (-1169.882) (-1172.453) * [-1169.800] (-1167.345) (-1170.106) (-1166.285) -- 0:01:10 54000 -- [-1171.172] (-1177.818) (-1168.985) (-1166.339) * (-1167.176) (-1167.585) [-1168.016] (-1166.467) -- 0:01:10 54500 -- (-1177.213) (-1177.954) (-1171.026) [-1169.408] * (-1171.911) (-1168.095) (-1167.604) [-1166.554] -- 0:01:09 55000 -- (-1170.895) (-1173.359) (-1169.041) [-1172.536] * (-1166.709) (-1168.817) [-1167.132] (-1166.492) -- 0:01:08 Average standard deviation of split frequencies: 0.021045 55500 -- [-1167.833] (-1175.697) (-1174.026) (-1170.056) * [-1168.594] (-1168.770) (-1168.364) (-1167.853) -- 0:01:08 56000 -- (-1169.467) (-1179.261) [-1167.312] (-1170.277) * [-1168.575] (-1169.668) (-1169.648) (-1166.858) -- 0:01:07 56500 -- (-1170.642) (-1188.903) (-1172.222) [-1168.856] * (-1168.177) (-1168.343) (-1167.609) [-1166.894] -- 0:01:06 57000 -- (-1170.795) (-1175.164) [-1168.674] (-1173.319) * (-1168.562) (-1167.469) (-1167.607) [-1169.678] -- 0:01:06 57500 -- (-1167.003) [-1173.895] (-1168.154) (-1169.164) * [-1168.939] (-1168.904) (-1173.061) (-1172.370) -- 0:01:05 58000 -- [-1166.511] (-1186.695) (-1170.100) (-1169.563) * (-1170.021) (-1167.672) (-1167.597) [-1167.677] -- 0:01:04 58500 -- [-1169.828] (-1175.426) (-1167.565) (-1167.245) * (-1166.970) (-1169.590) (-1166.987) [-1168.942] -- 0:01:04 59000 -- (-1169.693) [-1173.429] (-1169.696) (-1167.205) * (-1167.138) [-1170.031] (-1166.837) (-1169.196) -- 0:01:03 59500 -- (-1169.270) (-1185.006) (-1169.614) [-1170.757] * [-1167.611] (-1168.781) (-1166.439) (-1167.286) -- 0:01:03 60000 -- (-1166.870) (-1175.055) (-1168.137) [-1170.414] * (-1170.043) (-1168.946) [-1166.436] (-1168.336) -- 0:01:02 Average standard deviation of split frequencies: 0.016768 60500 -- [-1166.864] (-1176.040) (-1168.009) (-1168.770) * [-1168.992] (-1168.841) (-1168.591) (-1168.594) -- 0:01:02 61000 -- [-1169.138] (-1173.063) (-1167.956) (-1169.803) * (-1169.177) [-1168.527] (-1166.834) (-1169.130) -- 0:01:01 61500 -- (-1169.594) [-1181.977] (-1167.955) (-1167.280) * (-1168.360) (-1168.599) [-1166.608] (-1175.132) -- 0:01:01 62000 -- (-1170.142) [-1177.894] (-1167.409) (-1167.649) * (-1167.156) (-1169.166) [-1166.203] (-1167.937) -- 0:01:00 62500 -- (-1168.674) [-1175.285] (-1168.671) (-1167.545) * (-1167.095) (-1170.086) (-1172.400) [-1167.321] -- 0:01:00 63000 -- (-1168.479) [-1172.730] (-1168.633) (-1170.628) * (-1174.140) [-1171.963] (-1169.567) (-1168.766) -- 0:00:59 63500 -- [-1167.805] (-1183.662) (-1173.334) (-1170.447) * [-1169.290] (-1168.625) (-1169.913) (-1169.215) -- 0:00:58 64000 -- (-1170.996) (-1178.135) (-1172.122) [-1166.087] * (-1169.077) (-1168.551) (-1167.392) [-1166.943] -- 0:00:58 64500 -- [-1170.660] (-1178.411) (-1171.069) (-1168.864) * (-1171.199) (-1172.350) [-1166.760] (-1166.382) -- 0:00:58 65000 -- (-1171.316) [-1172.949] (-1170.550) (-1169.896) * [-1167.278] (-1171.011) (-1167.836) (-1169.903) -- 0:00:57 Average standard deviation of split frequencies: 0.018213 65500 -- (-1168.615) (-1175.977) [-1169.182] (-1169.364) * (-1166.986) (-1169.521) [-1166.302] (-1169.800) -- 0:00:57 66000 -- [-1170.764] (-1175.854) (-1170.630) (-1170.551) * (-1170.345) [-1170.812] (-1166.388) (-1168.672) -- 0:00:56 66500 -- [-1168.644] (-1181.285) (-1171.168) (-1168.803) * (-1169.740) (-1167.862) [-1166.321] (-1167.274) -- 0:00:56 67000 -- (-1171.297) (-1170.020) [-1167.372] (-1169.928) * (-1168.204) (-1169.314) (-1166.832) [-1173.171] -- 0:00:55 67500 -- (-1167.654) (-1172.445) (-1167.466) [-1168.733] * [-1170.795] (-1171.809) (-1169.551) (-1170.090) -- 0:00:55 68000 -- (-1169.200) [-1171.492] (-1167.429) (-1169.528) * (-1171.142) [-1170.976] (-1170.438) (-1168.741) -- 0:01:08 68500 -- [-1168.328] (-1171.140) (-1167.823) (-1166.479) * (-1168.437) (-1170.173) (-1167.726) [-1168.472] -- 0:01:07 69000 -- [-1168.343] (-1166.763) (-1168.475) (-1170.743) * (-1169.234) (-1169.989) (-1169.134) [-1168.845] -- 0:01:07 69500 -- (-1171.157) (-1168.372) (-1168.475) [-1173.094] * [-1168.327] (-1166.984) (-1169.605) (-1166.692) -- 0:01:06 70000 -- [-1169.038] (-1168.642) (-1166.256) (-1166.715) * (-1167.744) (-1166.807) [-1168.803] (-1167.464) -- 0:01:06 Average standard deviation of split frequencies: 0.015799 70500 -- [-1168.650] (-1167.451) (-1167.148) (-1167.532) * (-1169.096) (-1166.989) (-1170.914) [-1168.082] -- 0:01:05 71000 -- (-1167.503) (-1168.472) [-1166.876] (-1168.958) * [-1174.133] (-1167.144) (-1172.216) (-1170.652) -- 0:01:05 71500 -- (-1166.310) [-1167.846] (-1168.281) (-1167.688) * (-1170.761) (-1169.246) (-1167.303) [-1171.183] -- 0:01:04 72000 -- (-1169.628) (-1172.102) [-1169.023] (-1167.683) * [-1170.505] (-1167.769) (-1168.150) (-1171.525) -- 0:01:04 72500 -- (-1169.170) (-1167.336) (-1170.412) [-1167.724] * (-1168.257) (-1169.027) (-1166.610) [-1168.305] -- 0:01:03 73000 -- (-1169.203) (-1167.419) [-1168.852] (-1168.664) * [-1169.487] (-1168.859) (-1169.142) (-1168.363) -- 0:01:03 73500 -- (-1169.409) (-1166.276) [-1166.315] (-1168.553) * [-1170.472] (-1167.677) (-1167.094) (-1167.957) -- 0:01:03 74000 -- (-1167.929) (-1166.288) [-1166.373] (-1170.135) * [-1171.606] (-1169.376) (-1168.038) (-1169.914) -- 0:01:02 74500 -- (-1168.114) (-1168.462) (-1167.989) [-1168.588] * [-1168.025] (-1167.436) (-1167.894) (-1167.892) -- 0:01:02 75000 -- [-1169.314] (-1170.246) (-1167.059) (-1167.202) * (-1173.367) (-1168.521) [-1169.905] (-1167.557) -- 0:01:01 Average standard deviation of split frequencies: 0.018608 75500 -- (-1169.639) (-1168.624) (-1167.605) [-1166.866] * (-1167.808) (-1171.891) [-1170.090] (-1167.122) -- 0:01:01 76000 -- (-1168.664) (-1167.321) (-1167.674) [-1167.957] * (-1167.452) (-1171.701) (-1167.557) [-1166.540] -- 0:01:00 76500 -- (-1170.903) (-1169.049) [-1167.951] (-1166.039) * [-1171.057] (-1174.072) (-1168.993) (-1168.211) -- 0:01:00 77000 -- (-1170.904) (-1168.612) (-1169.624) [-1168.255] * [-1172.700] (-1172.432) (-1167.880) (-1168.142) -- 0:00:59 77500 -- (-1172.674) [-1170.423] (-1168.217) (-1168.288) * (-1168.344) (-1171.234) (-1167.875) [-1168.093] -- 0:00:59 78000 -- (-1167.811) [-1167.735] (-1168.590) (-1166.573) * (-1166.547) (-1170.064) [-1167.692] (-1166.376) -- 0:00:59 78500 -- (-1167.523) (-1169.279) [-1169.278] (-1168.931) * (-1166.995) (-1166.777) (-1171.422) [-1167.118] -- 0:00:58 79000 -- (-1167.522) [-1172.202] (-1168.153) (-1168.581) * (-1166.520) (-1166.403) (-1174.966) [-1166.943] -- 0:00:58 79500 -- [-1167.342] (-1171.333) (-1170.031) (-1167.199) * (-1168.344) (-1167.291) (-1167.291) [-1168.048] -- 0:00:57 80000 -- [-1167.129] (-1167.135) (-1171.682) (-1167.969) * (-1170.147) (-1166.644) [-1167.558] (-1168.692) -- 0:00:57 Average standard deviation of split frequencies: 0.016947 80500 -- (-1168.953) (-1167.134) (-1166.722) [-1166.157] * [-1170.869] (-1169.986) (-1167.353) (-1167.735) -- 0:00:57 81000 -- (-1171.307) (-1169.455) (-1167.133) [-1166.273] * (-1168.945) [-1166.725] (-1166.868) (-1168.205) -- 0:00:56 81500 -- (-1174.780) [-1166.637] (-1168.521) (-1166.797) * (-1166.316) (-1170.347) (-1166.909) [-1169.843] -- 0:00:56 82000 -- [-1168.172] (-1166.944) (-1167.143) (-1168.676) * (-1166.682) [-1169.528] (-1169.027) (-1166.702) -- 0:00:55 82500 -- (-1170.691) (-1169.667) (-1173.848) [-1168.079] * (-1167.816) (-1174.108) (-1168.457) [-1165.970] -- 0:00:55 83000 -- (-1168.594) (-1168.598) [-1168.083] (-1168.079) * (-1171.639) (-1175.740) (-1168.275) [-1166.635] -- 0:00:55 83500 -- (-1169.478) (-1168.739) (-1170.250) [-1167.151] * (-1169.150) (-1166.566) [-1169.078] (-1171.515) -- 0:00:54 84000 -- (-1168.419) [-1167.052] (-1168.187) (-1168.698) * (-1168.461) [-1168.616] (-1167.495) (-1167.232) -- 0:00:54 84500 -- (-1167.933) (-1170.392) (-1167.038) [-1168.698] * [-1167.116] (-1171.993) (-1170.898) (-1167.478) -- 0:01:05 85000 -- [-1170.132] (-1168.146) (-1168.021) (-1175.217) * (-1167.335) [-1169.729] (-1168.634) (-1170.660) -- 0:01:04 Average standard deviation of split frequencies: 0.016705 85500 -- (-1170.097) [-1166.261] (-1166.605) (-1173.115) * (-1172.517) (-1167.681) (-1170.270) [-1169.672] -- 0:01:04 86000 -- (-1172.220) (-1168.971) [-1166.290] (-1168.999) * (-1169.501) [-1168.139] (-1168.238) (-1169.942) -- 0:01:03 86500 -- (-1174.752) [-1167.233] (-1168.018) (-1168.214) * (-1168.576) [-1170.562] (-1168.840) (-1173.001) -- 0:01:03 87000 -- (-1178.793) (-1166.382) [-1168.446] (-1171.167) * (-1169.768) [-1168.805] (-1168.155) (-1167.287) -- 0:01:02 87500 -- (-1173.141) [-1166.346] (-1167.580) (-1171.462) * (-1170.291) (-1167.119) [-1169.962] (-1168.010) -- 0:01:02 88000 -- [-1169.897] (-1166.346) (-1169.200) (-1170.120) * (-1168.969) [-1167.529] (-1169.703) (-1169.869) -- 0:01:02 88500 -- [-1169.609] (-1169.143) (-1168.097) (-1170.584) * (-1167.908) [-1170.820] (-1172.923) (-1166.798) -- 0:01:01 89000 -- (-1170.072) (-1171.761) (-1168.604) [-1170.197] * (-1167.915) (-1170.777) [-1170.340] (-1169.145) -- 0:01:01 89500 -- (-1171.456) [-1169.697] (-1169.857) (-1167.414) * [-1168.768] (-1169.491) (-1170.316) (-1168.265) -- 0:01:01 90000 -- [-1172.268] (-1169.478) (-1166.611) (-1168.577) * (-1168.151) (-1168.091) [-1168.754] (-1168.737) -- 0:01:00 Average standard deviation of split frequencies: 0.014038 90500 -- (-1168.956) [-1167.534] (-1167.763) (-1168.774) * [-1167.630] (-1170.710) (-1167.824) (-1167.039) -- 0:01:00 91000 -- (-1166.791) (-1167.521) (-1168.427) [-1171.367] * (-1170.248) (-1172.051) [-1167.690] (-1168.249) -- 0:00:59 91500 -- (-1166.702) (-1167.282) [-1170.192] (-1167.570) * (-1169.845) (-1174.907) [-1166.571] (-1169.029) -- 0:00:59 92000 -- (-1167.536) [-1167.926] (-1167.518) (-1170.486) * [-1169.270] (-1169.619) (-1167.533) (-1166.786) -- 0:00:59 92500 -- (-1168.237) (-1169.960) [-1168.233] (-1169.121) * (-1168.756) (-1168.779) [-1169.150] (-1166.536) -- 0:00:58 93000 -- (-1168.773) (-1170.315) [-1167.502] (-1173.058) * (-1167.062) (-1167.042) (-1166.788) [-1166.218] -- 0:00:58 93500 -- (-1168.302) (-1166.567) [-1167.779] (-1174.636) * [-1168.619] (-1169.226) (-1168.069) (-1167.297) -- 0:00:58 94000 -- [-1167.978] (-1169.616) (-1169.203) (-1172.525) * [-1170.157] (-1170.331) (-1169.167) (-1166.819) -- 0:00:57 94500 -- [-1168.509] (-1166.197) (-1171.982) (-1168.929) * (-1169.874) (-1170.280) [-1170.129] (-1166.140) -- 0:00:57 95000 -- (-1168.512) (-1166.756) (-1168.922) [-1167.080] * [-1169.074] (-1169.001) (-1172.815) (-1167.903) -- 0:00:57 Average standard deviation of split frequencies: 0.014731 95500 -- [-1169.740] (-1167.682) (-1172.430) (-1169.178) * [-1168.219] (-1168.078) (-1172.678) (-1168.533) -- 0:00:56 96000 -- [-1168.771] (-1167.418) (-1170.763) (-1169.298) * (-1170.030) (-1166.931) (-1170.048) [-1166.853] -- 0:00:56 96500 -- (-1174.856) [-1166.324] (-1168.857) (-1168.228) * (-1169.443) [-1168.499] (-1171.655) (-1171.229) -- 0:00:56 97000 -- (-1173.175) [-1166.973] (-1167.974) (-1166.987) * (-1169.682) (-1168.483) (-1170.644) [-1166.193] -- 0:00:55 97500 -- [-1169.575] (-1172.601) (-1170.274) (-1167.017) * (-1169.057) (-1166.043) (-1167.971) [-1167.250] -- 0:00:55 98000 -- (-1169.935) [-1170.096] (-1171.846) (-1170.544) * (-1170.301) (-1166.076) (-1166.512) [-1168.080] -- 0:00:55 98500 -- (-1169.391) (-1169.054) (-1168.266) [-1168.761] * (-1169.214) (-1168.021) (-1167.439) [-1171.202] -- 0:00:54 99000 -- [-1167.463] (-1167.775) (-1168.016) (-1170.457) * (-1168.223) (-1170.352) (-1169.276) [-1166.340] -- 0:00:54 99500 -- (-1166.493) (-1168.048) [-1170.013] (-1171.549) * [-1167.720] (-1167.033) (-1170.268) (-1166.150) -- 0:00:54 100000 -- (-1169.952) [-1169.656] (-1168.222) (-1172.467) * [-1166.783] (-1166.853) (-1171.620) (-1166.554) -- 0:00:54 Average standard deviation of split frequencies: 0.014541 100500 -- (-1167.095) (-1169.870) [-1166.850] (-1166.630) * (-1166.509) (-1167.409) (-1170.449) [-1167.314] -- 0:01:02 101000 -- [-1167.045] (-1167.350) (-1172.905) (-1166.537) * [-1166.506] (-1166.973) (-1168.392) (-1167.361) -- 0:01:02 101500 -- [-1167.183] (-1172.530) (-1170.664) (-1166.235) * (-1166.683) [-1167.214] (-1167.696) (-1167.177) -- 0:01:01 102000 -- (-1166.659) (-1179.486) [-1167.783] (-1166.188) * (-1166.167) (-1167.767) [-1168.798] (-1168.076) -- 0:01:01 102500 -- [-1166.640] (-1168.059) (-1168.560) (-1172.561) * (-1167.463) [-1168.879] (-1168.901) (-1167.302) -- 0:01:01 103000 -- (-1167.383) (-1166.720) [-1166.601] (-1168.398) * [-1168.976] (-1172.296) (-1168.291) (-1170.274) -- 0:01:00 103500 -- (-1166.761) [-1168.540] (-1168.194) (-1167.215) * (-1166.267) [-1168.614] (-1171.187) (-1169.229) -- 0:01:00 104000 -- (-1170.984) (-1167.915) [-1168.458] (-1167.363) * (-1166.207) [-1169.863] (-1170.251) (-1167.925) -- 0:01:00 104500 -- (-1170.724) (-1168.190) [-1168.041] (-1166.616) * (-1167.518) (-1168.794) (-1167.809) [-1168.589] -- 0:00:59 105000 -- (-1173.421) [-1171.427] (-1168.213) (-1171.369) * (-1168.036) (-1170.151) [-1167.806] (-1166.487) -- 0:00:59 Average standard deviation of split frequencies: 0.016899 105500 -- [-1167.551] (-1168.256) (-1166.638) (-1172.417) * (-1170.723) (-1169.631) (-1172.068) [-1166.195] -- 0:00:59 106000 -- (-1167.233) [-1167.671] (-1168.383) (-1169.382) * (-1166.191) [-1167.522] (-1169.578) (-1167.093) -- 0:00:59 106500 -- [-1167.782] (-1166.080) (-1168.847) (-1167.201) * (-1167.385) [-1166.613] (-1169.347) (-1169.306) -- 0:00:58 107000 -- (-1168.939) [-1167.498] (-1170.634) (-1167.461) * (-1168.722) (-1172.655) [-1168.891] (-1169.502) -- 0:00:58 107500 -- (-1169.714) [-1167.962] (-1169.150) (-1169.667) * (-1166.808) (-1169.593) [-1167.688] (-1169.063) -- 0:00:58 108000 -- (-1169.125) (-1167.356) [-1169.894] (-1166.112) * [-1166.659] (-1167.584) (-1169.436) (-1168.398) -- 0:00:57 108500 -- (-1170.624) (-1166.882) (-1169.731) [-1174.645] * (-1168.478) [-1166.537] (-1168.397) (-1168.876) -- 0:00:57 109000 -- (-1171.322) (-1167.551) [-1166.661] (-1168.161) * (-1169.029) [-1166.314] (-1166.824) (-1168.429) -- 0:00:57 109500 -- [-1173.374] (-1168.107) (-1166.989) (-1169.061) * (-1173.873) (-1166.890) (-1166.615) [-1170.070] -- 0:00:56 110000 -- (-1172.672) (-1169.575) [-1167.080] (-1169.718) * (-1170.477) [-1166.979] (-1167.219) (-1167.324) -- 0:00:56 Average standard deviation of split frequencies: 0.018160 110500 -- (-1169.373) (-1170.203) (-1166.595) [-1170.639] * (-1170.882) (-1166.495) [-1167.422] (-1172.623) -- 0:00:56 111000 -- (-1169.228) (-1169.974) [-1167.408] (-1174.614) * (-1169.337) [-1171.104] (-1168.904) (-1173.888) -- 0:00:56 111500 -- (-1168.801) (-1167.987) [-1168.236] (-1176.548) * (-1173.189) (-1168.210) (-1170.170) [-1168.610] -- 0:00:55 112000 -- (-1169.161) (-1170.579) (-1169.174) [-1170.370] * [-1169.909] (-1167.695) (-1170.147) (-1169.456) -- 0:00:55 112500 -- (-1168.954) (-1168.308) (-1167.415) [-1167.599] * [-1169.999] (-1167.730) (-1170.146) (-1172.885) -- 0:00:55 113000 -- (-1167.972) (-1169.834) (-1169.025) [-1168.817] * (-1170.127) (-1168.115) (-1169.707) [-1168.986] -- 0:00:54 113500 -- [-1166.997] (-1168.952) (-1172.619) (-1168.310) * (-1168.701) (-1166.977) (-1170.226) [-1168.235] -- 0:00:54 114000 -- (-1168.461) [-1167.880] (-1169.733) (-1168.420) * [-1167.035] (-1167.779) (-1170.613) (-1167.014) -- 0:00:54 114500 -- (-1166.927) (-1166.410) [-1170.590] (-1168.152) * [-1166.617] (-1170.904) (-1167.393) (-1168.640) -- 0:00:54 115000 -- (-1170.169) (-1168.825) [-1167.434] (-1166.761) * (-1173.411) (-1169.991) [-1166.757] (-1171.555) -- 0:00:53 Average standard deviation of split frequencies: 0.018394 115500 -- (-1167.702) (-1170.081) (-1169.536) [-1167.899] * (-1170.060) (-1167.225) (-1168.802) [-1169.143] -- 0:00:53 116000 -- (-1169.069) (-1168.658) (-1171.048) [-1166.955] * [-1167.836] (-1166.533) (-1168.176) (-1170.553) -- 0:00:53 116500 -- (-1168.231) [-1170.217] (-1170.101) (-1166.857) * [-1167.412] (-1167.690) (-1167.614) (-1171.020) -- 0:01:00 117000 -- (-1170.246) (-1169.585) [-1167.584] (-1166.458) * (-1166.603) (-1167.103) [-1168.856] (-1172.563) -- 0:01:00 117500 -- (-1168.688) (-1168.962) (-1167.043) [-1171.786] * (-1168.181) [-1167.291] (-1168.648) (-1172.999) -- 0:01:00 118000 -- (-1170.668) (-1171.343) [-1167.859] (-1169.255) * (-1169.417) [-1167.290] (-1167.600) (-1172.269) -- 0:00:59 118500 -- (-1169.062) (-1170.495) (-1168.315) [-1169.526] * [-1166.807] (-1167.901) (-1168.654) (-1168.023) -- 0:00:59 119000 -- (-1167.395) (-1170.356) [-1169.381] (-1166.909) * (-1167.168) [-1173.037] (-1167.678) (-1169.767) -- 0:00:59 119500 -- [-1168.002] (-1170.216) (-1169.285) (-1167.422) * [-1168.689] (-1166.491) (-1167.374) (-1176.888) -- 0:00:58 120000 -- (-1167.053) [-1173.450] (-1166.515) (-1166.933) * (-1166.295) (-1166.877) (-1167.105) [-1167.885] -- 0:00:58 Average standard deviation of split frequencies: 0.018916 120500 -- [-1167.000] (-1175.401) (-1166.589) (-1167.351) * (-1166.498) (-1167.756) [-1166.784] (-1167.157) -- 0:00:58 121000 -- (-1168.547) [-1170.858] (-1170.270) (-1169.207) * (-1167.027) (-1171.241) (-1167.257) [-1166.441] -- 0:00:58 121500 -- (-1169.722) (-1168.447) (-1166.426) [-1171.852] * [-1169.147] (-1169.886) (-1169.510) (-1171.286) -- 0:00:57 122000 -- (-1166.830) (-1169.626) [-1167.064] (-1169.144) * [-1167.746] (-1168.177) (-1168.421) (-1169.084) -- 0:00:57 122500 -- (-1169.463) (-1172.424) (-1167.693) [-1166.629] * (-1167.367) (-1168.831) (-1167.995) [-1169.481] -- 0:00:57 123000 -- [-1167.181] (-1168.308) (-1168.172) (-1168.565) * [-1166.099] (-1168.519) (-1167.992) (-1167.837) -- 0:00:57 123500 -- [-1167.795] (-1167.129) (-1169.454) (-1170.177) * (-1168.753) [-1166.220] (-1167.317) (-1170.764) -- 0:00:56 124000 -- (-1173.482) (-1167.427) (-1167.228) [-1167.248] * (-1170.148) (-1168.252) (-1167.516) [-1169.063] -- 0:00:56 124500 -- (-1169.298) (-1166.894) [-1169.466] (-1167.619) * (-1174.554) (-1167.617) (-1166.597) [-1169.526] -- 0:00:56 125000 -- [-1168.947] (-1170.132) (-1169.153) (-1168.058) * (-1168.432) [-1166.805] (-1168.513) (-1168.770) -- 0:00:56 Average standard deviation of split frequencies: 0.019691 125500 -- (-1168.159) (-1170.662) [-1169.667] (-1168.735) * [-1168.384] (-1167.325) (-1167.830) (-1169.170) -- 0:00:55 126000 -- (-1166.315) [-1167.460] (-1171.032) (-1170.665) * (-1171.112) (-1167.497) [-1168.301] (-1168.033) -- 0:00:55 126500 -- (-1167.412) (-1169.451) [-1170.004] (-1168.267) * (-1168.362) [-1167.495] (-1168.820) (-1166.365) -- 0:00:55 127000 -- (-1167.785) [-1168.653] (-1171.824) (-1166.399) * [-1167.261] (-1168.818) (-1169.384) (-1166.346) -- 0:00:54 127500 -- (-1168.488) (-1168.104) (-1169.424) [-1169.225] * (-1167.889) [-1168.196] (-1169.636) (-1167.250) -- 0:00:54 128000 -- (-1169.625) (-1169.609) [-1166.563] (-1170.351) * (-1168.294) (-1169.732) (-1170.127) [-1167.148] -- 0:00:54 128500 -- (-1169.284) (-1168.581) [-1167.325] (-1167.704) * [-1167.608] (-1169.583) (-1171.948) (-1168.733) -- 0:00:54 129000 -- (-1169.221) (-1169.329) (-1166.893) [-1166.317] * [-1172.253] (-1169.794) (-1172.628) (-1170.026) -- 0:00:54 129500 -- [-1175.444] (-1168.683) (-1169.412) (-1168.650) * (-1166.906) (-1169.197) [-1172.123] (-1168.069) -- 0:00:53 130000 -- (-1168.676) [-1170.446] (-1169.982) (-1167.076) * [-1167.251] (-1168.650) (-1172.305) (-1170.030) -- 0:00:53 Average standard deviation of split frequencies: 0.021009 130500 -- (-1167.455) (-1172.139) [-1171.891] (-1167.239) * (-1167.472) (-1167.889) (-1171.900) [-1166.486] -- 0:00:53 131000 -- (-1168.907) (-1173.101) (-1175.447) [-1169.356] * (-1166.677) [-1168.849] (-1169.023) (-1169.222) -- 0:00:53 131500 -- [-1169.012] (-1169.129) (-1177.864) (-1169.635) * [-1166.780] (-1168.134) (-1168.241) (-1167.702) -- 0:00:59 132000 -- [-1169.441] (-1170.043) (-1171.576) (-1167.953) * (-1166.610) [-1166.913] (-1166.985) (-1167.949) -- 0:00:59 132500 -- (-1167.067) (-1167.946) [-1172.200] (-1167.746) * [-1167.401] (-1172.027) (-1171.419) (-1169.987) -- 0:00:58 133000 -- (-1167.149) (-1166.969) (-1169.555) [-1167.940] * (-1170.777) [-1169.942] (-1171.365) (-1168.775) -- 0:00:58 133500 -- (-1166.283) (-1170.329) (-1168.693) [-1168.084] * [-1170.540] (-1171.437) (-1169.726) (-1167.159) -- 0:00:58 134000 -- (-1167.242) (-1166.550) (-1170.933) [-1173.374] * (-1169.431) (-1169.627) [-1167.621] (-1166.873) -- 0:00:58 134500 -- [-1167.242] (-1168.445) (-1168.448) (-1168.850) * [-1168.652] (-1166.907) (-1167.372) (-1166.997) -- 0:00:57 135000 -- (-1167.916) (-1166.942) (-1168.392) [-1167.141] * (-1169.664) (-1167.570) (-1167.317) [-1170.138] -- 0:00:57 Average standard deviation of split frequencies: 0.019166 135500 -- [-1167.978] (-1168.647) (-1168.008) (-1167.471) * (-1167.681) (-1166.769) (-1169.478) [-1169.920] -- 0:00:57 136000 -- (-1169.383) (-1169.416) [-1169.421] (-1167.163) * (-1168.153) (-1166.916) [-1169.550] (-1169.080) -- 0:00:57 136500 -- (-1171.275) [-1169.109] (-1170.369) (-1170.259) * (-1167.229) (-1167.261) [-1167.772] (-1169.658) -- 0:00:56 137000 -- (-1170.391) (-1168.940) [-1167.403] (-1169.641) * [-1168.337] (-1166.499) (-1169.528) (-1169.087) -- 0:00:56 137500 -- [-1168.971] (-1174.968) (-1167.780) (-1166.694) * (-1169.507) [-1166.168] (-1167.308) (-1175.354) -- 0:00:56 138000 -- (-1171.330) (-1167.589) [-1168.452] (-1167.673) * (-1168.996) (-1170.682) [-1168.366] (-1171.445) -- 0:00:56 138500 -- (-1170.069) [-1167.544] (-1168.071) (-1167.887) * (-1171.359) [-1166.687] (-1167.334) (-1173.340) -- 0:00:55 139000 -- (-1169.224) (-1170.135) [-1168.397] (-1170.660) * (-1176.666) (-1167.356) (-1169.629) [-1170.949] -- 0:00:55 139500 -- [-1168.846] (-1172.421) (-1168.498) (-1166.458) * (-1173.982) [-1167.518] (-1169.908) (-1170.860) -- 0:00:55 140000 -- (-1168.269) (-1168.171) [-1171.261] (-1168.258) * (-1170.100) [-1167.380] (-1168.574) (-1169.473) -- 0:00:55 Average standard deviation of split frequencies: 0.022473 140500 -- [-1170.387] (-1168.322) (-1167.017) (-1169.223) * (-1170.363) [-1169.719] (-1168.935) (-1166.060) -- 0:00:55 141000 -- [-1169.801] (-1166.872) (-1167.986) (-1173.192) * (-1167.526) (-1168.793) (-1168.192) [-1169.869] -- 0:00:54 141500 -- (-1171.155) [-1168.047] (-1168.917) (-1171.362) * (-1169.949) (-1170.166) [-1168.246] (-1168.534) -- 0:00:54 142000 -- (-1168.219) (-1167.826) [-1168.886] (-1170.943) * [-1167.773] (-1176.636) (-1166.983) (-1170.210) -- 0:00:54 142500 -- (-1170.267) [-1168.101] (-1170.204) (-1169.605) * [-1167.214] (-1169.038) (-1167.003) (-1167.535) -- 0:00:54 143000 -- [-1167.308] (-1167.147) (-1168.103) (-1167.142) * (-1166.830) (-1168.488) [-1166.943] (-1168.813) -- 0:00:53 143500 -- (-1169.566) (-1168.764) [-1170.204] (-1167.666) * (-1173.175) [-1167.904] (-1167.026) (-1168.021) -- 0:00:53 144000 -- [-1167.290] (-1169.153) (-1169.149) (-1168.973) * (-1172.185) (-1168.598) (-1169.033) [-1168.091] -- 0:00:53 144500 -- [-1167.474] (-1168.657) (-1173.903) (-1167.360) * (-1170.912) [-1168.219] (-1169.317) (-1167.962) -- 0:00:53 145000 -- (-1167.588) [-1169.372] (-1173.708) (-1167.899) * (-1166.993) (-1167.631) [-1166.217] (-1167.370) -- 0:00:53 Average standard deviation of split frequencies: 0.020562 145500 -- (-1168.581) (-1173.124) [-1166.589] (-1168.099) * (-1167.889) (-1177.737) (-1166.322) [-1166.425] -- 0:00:52 146000 -- (-1166.763) (-1171.868) [-1168.884] (-1167.922) * (-1173.310) (-1168.671) [-1168.424] (-1166.523) -- 0:00:52 146500 -- (-1173.066) [-1172.353] (-1168.348) (-1168.963) * (-1169.949) (-1168.194) [-1167.470] (-1173.332) -- 0:00:52 147000 -- (-1172.354) [-1168.489] (-1168.669) (-1167.909) * (-1168.160) (-1170.764) [-1167.646] (-1168.180) -- 0:00:58 147500 -- (-1169.343) (-1173.268) [-1167.448] (-1169.134) * [-1166.789] (-1170.946) (-1166.775) (-1168.127) -- 0:00:57 148000 -- [-1168.262] (-1169.949) (-1168.793) (-1168.545) * (-1167.678) (-1171.009) (-1168.724) [-1168.389] -- 0:00:57 148500 -- (-1168.347) [-1167.555] (-1168.869) (-1165.952) * (-1172.942) (-1170.032) (-1166.780) [-1167.581] -- 0:00:57 149000 -- (-1174.319) [-1170.215] (-1168.638) (-1166.034) * (-1172.827) (-1167.729) (-1167.049) [-1170.195] -- 0:00:57 149500 -- (-1169.568) (-1168.941) (-1171.930) [-1166.033] * (-1168.433) (-1168.078) [-1166.646] (-1167.797) -- 0:00:56 150000 -- (-1169.410) (-1167.463) (-1173.105) [-1166.830] * (-1168.528) [-1168.065] (-1166.448) (-1169.282) -- 0:00:56 Average standard deviation of split frequencies: 0.022396 150500 -- (-1169.171) (-1166.534) [-1172.866] (-1167.333) * (-1168.617) (-1168.172) (-1167.532) [-1166.296] -- 0:00:56 151000 -- (-1168.853) [-1170.054] (-1168.078) (-1167.734) * [-1166.382] (-1169.950) (-1169.493) (-1168.967) -- 0:00:56 151500 -- (-1168.801) [-1166.152] (-1170.205) (-1168.556) * (-1173.871) (-1169.284) (-1167.592) [-1170.698] -- 0:00:56 152000 -- (-1169.180) [-1167.290] (-1169.505) (-1167.327) * (-1171.672) (-1169.657) (-1169.081) [-1169.384] -- 0:00:55 152500 -- (-1169.346) (-1170.215) (-1173.790) [-1167.100] * (-1170.663) (-1170.037) [-1168.323] (-1168.074) -- 0:00:55 153000 -- (-1172.352) [-1173.315] (-1167.386) (-1167.800) * (-1170.679) (-1173.479) [-1169.291] (-1166.641) -- 0:00:55 153500 -- [-1169.152] (-1168.421) (-1168.141) (-1167.048) * (-1171.456) (-1170.800) [-1167.931] (-1166.848) -- 0:00:55 154000 -- [-1167.669] (-1168.246) (-1168.008) (-1166.816) * (-1168.141) (-1169.373) [-1166.182] (-1167.141) -- 0:00:54 154500 -- [-1169.662] (-1169.187) (-1167.224) (-1167.027) * (-1172.067) [-1169.365] (-1166.525) (-1168.820) -- 0:00:54 155000 -- (-1175.908) (-1170.518) (-1167.915) [-1167.923] * [-1166.992] (-1169.858) (-1167.555) (-1172.083) -- 0:00:54 Average standard deviation of split frequencies: 0.021153 155500 -- (-1171.682) (-1171.849) (-1167.362) [-1172.346] * (-1170.158) (-1168.913) [-1166.813] (-1169.476) -- 0:00:54 156000 -- (-1170.335) (-1172.378) [-1168.795] (-1174.990) * [-1169.320] (-1168.645) (-1170.277) (-1171.097) -- 0:00:54 156500 -- (-1166.612) (-1167.774) [-1167.204] (-1168.729) * (-1168.109) (-1175.644) [-1172.124] (-1170.973) -- 0:00:53 157000 -- (-1167.080) [-1167.346] (-1167.664) (-1168.850) * (-1168.139) (-1169.332) (-1168.747) [-1168.270] -- 0:00:53 157500 -- (-1166.835) (-1168.229) (-1168.110) [-1167.496] * [-1168.200] (-1168.967) (-1168.993) (-1167.348) -- 0:00:53 158000 -- (-1166.379) [-1167.766] (-1168.035) (-1168.510) * (-1167.407) (-1169.716) (-1170.998) [-1168.664] -- 0:00:53 158500 -- (-1166.544) [-1167.315] (-1169.632) (-1170.329) * [-1166.678] (-1168.918) (-1170.195) (-1170.245) -- 0:00:53 159000 -- (-1168.234) [-1169.177] (-1168.810) (-1170.134) * (-1167.995) [-1172.365] (-1166.530) (-1166.517) -- 0:00:52 159500 -- (-1167.509) (-1169.587) (-1169.119) [-1166.450] * (-1173.899) [-1173.335] (-1167.229) (-1167.985) -- 0:00:52 160000 -- (-1166.530) (-1168.054) (-1172.918) [-1166.478] * [-1171.612] (-1173.751) (-1169.421) (-1167.569) -- 0:00:52 Average standard deviation of split frequencies: 0.019988 160500 -- (-1167.231) (-1170.893) [-1167.726] (-1166.883) * (-1171.840) (-1173.170) (-1167.679) [-1166.710] -- 0:00:52 161000 -- (-1169.875) [-1166.499] (-1169.903) (-1166.758) * (-1175.616) (-1172.026) [-1167.195] (-1167.028) -- 0:00:52 161500 -- (-1171.206) (-1167.743) (-1180.954) [-1168.539] * [-1170.382] (-1168.419) (-1167.976) (-1169.005) -- 0:00:51 162000 -- (-1171.234) (-1173.606) [-1167.343] (-1166.928) * (-1167.074) [-1168.606] (-1167.509) (-1168.607) -- 0:00:51 162500 -- (-1168.217) [-1167.133] (-1168.338) (-1167.969) * [-1167.074] (-1166.063) (-1167.292) (-1170.253) -- 0:00:51 163000 -- (-1168.344) [-1167.577] (-1166.812) (-1170.883) * (-1168.322) [-1167.309] (-1168.969) (-1167.931) -- 0:00:56 163500 -- (-1166.866) (-1167.405) [-1167.742] (-1172.264) * [-1167.463] (-1169.814) (-1171.847) (-1168.724) -- 0:00:56 164000 -- (-1166.864) [-1169.151] (-1168.229) (-1168.481) * (-1167.186) (-1170.193) (-1168.798) [-1167.017] -- 0:00:56 164500 -- [-1166.874] (-1168.861) (-1168.424) (-1167.719) * (-1171.102) (-1169.031) [-1168.405] (-1167.915) -- 0:00:55 165000 -- (-1172.341) (-1172.018) (-1168.550) [-1167.083] * (-1168.934) (-1170.597) (-1168.277) [-1169.769] -- 0:00:55 Average standard deviation of split frequencies: 0.018982 165500 -- (-1168.548) [-1170.888] (-1166.804) (-1166.741) * (-1171.941) (-1170.901) [-1166.431] (-1167.078) -- 0:00:55 166000 -- (-1170.037) (-1170.266) [-1167.729] (-1169.100) * (-1167.566) (-1168.908) [-1166.952] (-1171.993) -- 0:00:55 166500 -- [-1168.145] (-1167.531) (-1169.382) (-1167.063) * (-1168.097) (-1167.466) [-1166.378] (-1171.481) -- 0:00:55 167000 -- (-1167.966) [-1167.950] (-1167.412) (-1167.146) * (-1169.085) (-1168.442) [-1166.386] (-1168.308) -- 0:00:54 167500 -- (-1168.452) (-1167.170) (-1168.720) [-1166.963] * (-1168.398) (-1166.407) [-1166.696] (-1166.598) -- 0:00:54 168000 -- (-1170.052) (-1167.159) [-1169.420] (-1167.399) * (-1167.705) (-1166.427) [-1166.074] (-1166.441) -- 0:00:54 168500 -- (-1167.953) (-1169.704) (-1175.183) [-1168.298] * (-1168.845) (-1167.008) (-1166.495) [-1169.049] -- 0:00:54 169000 -- (-1167.733) [-1167.903] (-1171.173) (-1171.292) * (-1170.926) (-1168.144) (-1167.132) [-1167.776] -- 0:00:54 169500 -- (-1168.092) (-1166.827) (-1166.877) [-1168.601] * [-1169.723] (-1170.301) (-1167.721) (-1169.337) -- 0:00:53 170000 -- (-1167.524) [-1167.456] (-1166.774) (-1169.380) * (-1168.188) (-1171.597) (-1170.007) [-1167.129] -- 0:00:53 Average standard deviation of split frequencies: 0.019190 170500 -- (-1166.518) (-1166.326) [-1167.413] (-1169.360) * [-1167.939] (-1173.151) (-1170.462) (-1168.339) -- 0:00:53 171000 -- (-1166.518) (-1168.729) [-1168.103] (-1168.612) * (-1168.435) (-1168.856) [-1168.385] (-1168.129) -- 0:00:53 171500 -- [-1166.737] (-1169.710) (-1168.286) (-1169.865) * (-1167.247) (-1167.310) [-1167.193] (-1166.900) -- 0:00:53 172000 -- [-1166.515] (-1167.303) (-1168.148) (-1168.855) * (-1167.370) (-1170.728) (-1168.886) [-1167.294] -- 0:00:52 172500 -- [-1167.241] (-1167.061) (-1168.416) (-1167.184) * (-1171.915) (-1167.836) (-1169.674) [-1167.211] -- 0:00:52 173000 -- [-1169.738] (-1166.720) (-1169.465) (-1168.220) * (-1171.961) (-1169.367) (-1167.860) [-1168.789] -- 0:00:52 173500 -- (-1169.003) [-1167.607] (-1169.021) (-1168.347) * [-1171.892] (-1167.876) (-1166.922) (-1172.818) -- 0:00:52 174000 -- (-1168.975) (-1172.524) (-1169.169) [-1167.826] * (-1176.605) [-1167.502] (-1171.002) (-1166.865) -- 0:00:52 174500 -- [-1174.712] (-1170.896) (-1166.934) (-1170.891) * (-1169.150) (-1167.326) (-1168.825) [-1169.074] -- 0:00:52 175000 -- [-1166.803] (-1169.484) (-1167.394) (-1171.319) * (-1167.252) (-1167.238) (-1171.508) [-1166.805] -- 0:00:51 Average standard deviation of split frequencies: 0.019313 175500 -- (-1166.189) (-1170.631) (-1167.750) [-1169.003] * (-1171.634) [-1171.953] (-1166.426) (-1168.660) -- 0:00:51 176000 -- (-1168.928) (-1173.182) [-1167.539] (-1169.346) * (-1172.008) [-1169.161] (-1166.592) (-1168.156) -- 0:00:51 176500 -- (-1168.662) (-1175.546) [-1167.028] (-1169.808) * (-1175.653) (-1167.936) (-1169.010) [-1168.470] -- 0:00:51 177000 -- [-1166.826] (-1169.042) (-1168.163) (-1168.680) * [-1169.625] (-1167.333) (-1168.052) (-1167.770) -- 0:00:51 177500 -- (-1173.831) [-1168.091] (-1168.070) (-1170.622) * (-1168.219) [-1169.318] (-1168.390) (-1168.844) -- 0:00:50 178000 -- [-1167.348] (-1169.725) (-1167.539) (-1173.066) * [-1166.724] (-1168.663) (-1170.001) (-1169.352) -- 0:00:50 178500 -- (-1166.903) (-1167.884) (-1167.582) [-1168.823] * [-1166.758] (-1167.611) (-1166.532) (-1168.711) -- 0:00:50 179000 -- (-1167.165) (-1169.799) [-1171.054] (-1172.005) * (-1167.155) (-1169.148) (-1166.587) [-1167.704] -- 0:00:55 179500 -- [-1167.299] (-1167.626) (-1170.485) (-1167.816) * (-1167.390) [-1168.016] (-1168.199) (-1167.480) -- 0:00:54 180000 -- (-1172.018) (-1167.251) (-1169.195) [-1166.911] * (-1169.470) [-1169.338] (-1168.729) (-1168.837) -- 0:00:54 Average standard deviation of split frequencies: 0.019913 180500 -- (-1169.566) (-1169.031) (-1169.018) [-1167.337] * (-1167.223) (-1169.567) [-1167.293] (-1168.626) -- 0:00:54 181000 -- (-1170.593) (-1166.834) [-1172.235] (-1168.620) * [-1167.671] (-1171.928) (-1168.176) (-1167.526) -- 0:00:54 181500 -- (-1168.632) [-1166.667] (-1169.020) (-1171.491) * (-1167.770) [-1173.047] (-1168.175) (-1168.516) -- 0:00:54 182000 -- (-1169.613) (-1167.211) (-1167.870) [-1166.331] * (-1167.444) (-1171.345) [-1170.006] (-1170.125) -- 0:00:53 182500 -- (-1168.954) [-1166.788] (-1172.535) (-1167.013) * (-1167.321) (-1170.923) (-1169.944) [-1172.037] -- 0:00:53 183000 -- (-1167.027) [-1166.402] (-1169.260) (-1168.271) * [-1167.947] (-1169.142) (-1167.889) (-1169.534) -- 0:00:53 183500 -- (-1167.962) [-1166.376] (-1174.304) (-1167.204) * (-1169.783) (-1168.281) [-1167.275] (-1170.064) -- 0:00:53 184000 -- (-1166.940) (-1170.139) [-1167.982] (-1166.943) * (-1170.744) (-1166.476) [-1166.978] (-1167.294) -- 0:00:53 184500 -- [-1169.345] (-1172.123) (-1167.612) (-1167.887) * (-1166.627) (-1170.646) [-1167.643] (-1169.886) -- 0:00:53 185000 -- (-1171.002) (-1170.625) (-1168.682) [-1168.120] * (-1168.262) [-1168.121] (-1167.422) (-1168.410) -- 0:00:52 Average standard deviation of split frequencies: 0.018141 185500 -- (-1168.082) (-1170.198) (-1168.082) [-1168.331] * [-1168.503] (-1169.580) (-1170.741) (-1168.821) -- 0:00:52 186000 -- (-1171.182) (-1168.448) [-1167.355] (-1168.318) * (-1168.833) (-1170.180) (-1168.303) [-1168.160] -- 0:00:52 186500 -- (-1169.366) (-1167.022) (-1167.201) [-1168.145] * (-1166.403) [-1168.854] (-1169.873) (-1173.440) -- 0:00:52 187000 -- (-1169.450) (-1168.895) (-1168.197) [-1169.607] * (-1166.454) (-1170.540) (-1169.377) [-1171.916] -- 0:00:52 187500 -- (-1169.074) [-1167.868] (-1171.059) (-1169.067) * (-1167.806) [-1167.678] (-1169.027) (-1168.337) -- 0:00:52 188000 -- (-1169.283) [-1167.185] (-1167.794) (-1169.350) * (-1167.250) (-1167.459) (-1169.229) [-1170.891] -- 0:00:51 188500 -- (-1169.807) (-1167.577) (-1167.096) [-1169.547] * (-1167.080) (-1167.207) (-1173.622) [-1167.151] -- 0:00:51 189000 -- [-1167.356] (-1168.922) (-1166.859) (-1167.574) * (-1166.943) (-1166.300) (-1170.052) [-1168.839] -- 0:00:51 189500 -- (-1167.509) (-1172.291) [-1166.704] (-1167.877) * (-1167.292) (-1168.532) (-1167.506) [-1168.346] -- 0:00:51 190000 -- (-1168.480) [-1167.633] (-1172.370) (-1168.177) * (-1167.163) (-1168.552) [-1167.722] (-1167.340) -- 0:00:51 Average standard deviation of split frequencies: 0.017719 190500 -- [-1167.712] (-1167.275) (-1170.371) (-1170.320) * (-1174.202) [-1167.408] (-1166.410) (-1167.549) -- 0:00:50 191000 -- (-1167.608) [-1168.115] (-1170.410) (-1168.150) * [-1168.334] (-1167.994) (-1169.592) (-1168.361) -- 0:00:50 191500 -- (-1167.211) [-1169.016] (-1166.496) (-1168.901) * [-1169.150] (-1169.676) (-1168.942) (-1167.653) -- 0:00:50 192000 -- (-1167.679) [-1168.307] (-1167.513) (-1175.301) * [-1167.970] (-1167.665) (-1171.068) (-1167.823) -- 0:00:50 192500 -- [-1167.367] (-1167.365) (-1168.693) (-1171.049) * (-1168.931) (-1167.620) [-1169.382] (-1169.109) -- 0:00:50 193000 -- [-1172.142] (-1170.553) (-1167.771) (-1170.909) * [-1167.902] (-1167.620) (-1170.951) (-1167.361) -- 0:00:50 193500 -- [-1171.153] (-1173.384) (-1168.853) (-1167.727) * (-1167.470) (-1168.449) [-1167.371] (-1168.475) -- 0:00:50 194000 -- (-1172.485) (-1173.289) (-1168.398) [-1172.824] * (-1169.259) [-1168.018] (-1168.357) (-1169.424) -- 0:00:49 194500 -- (-1171.024) (-1166.643) (-1168.456) [-1169.231] * (-1169.934) (-1168.236) (-1168.853) [-1167.873] -- 0:00:49 195000 -- [-1166.861] (-1166.346) (-1167.738) (-1168.588) * (-1169.277) (-1175.176) (-1169.741) [-1169.634] -- 0:00:53 Average standard deviation of split frequencies: 0.015563 195500 -- [-1168.496] (-1169.969) (-1174.050) (-1173.348) * (-1167.692) (-1172.413) [-1168.755] (-1175.167) -- 0:00:53 196000 -- [-1167.398] (-1168.833) (-1170.096) (-1173.738) * (-1167.406) [-1170.643] (-1166.891) (-1170.900) -- 0:00:53 196500 -- (-1166.835) (-1170.311) (-1168.653) [-1167.541] * [-1166.696] (-1169.138) (-1174.404) (-1170.710) -- 0:00:53 197000 -- (-1167.867) (-1168.866) [-1170.709] (-1168.663) * (-1167.433) (-1168.236) (-1169.038) [-1169.528] -- 0:00:52 197500 -- (-1169.178) [-1167.917] (-1168.911) (-1167.298) * (-1169.860) (-1171.361) (-1168.506) [-1166.609] -- 0:00:52 198000 -- (-1168.589) (-1168.966) (-1170.561) [-1167.022] * (-1168.106) (-1167.691) (-1167.818) [-1167.836] -- 0:00:52 198500 -- (-1168.901) (-1167.898) (-1168.316) [-1166.934] * (-1171.824) (-1178.276) (-1166.547) [-1166.253] -- 0:00:52 199000 -- (-1166.866) [-1167.575] (-1167.971) (-1166.567) * (-1168.144) [-1166.987] (-1170.156) (-1166.034) -- 0:00:52 199500 -- (-1169.592) [-1167.800] (-1168.682) (-1167.346) * [-1167.628] (-1168.162) (-1168.240) (-1167.167) -- 0:00:52 200000 -- (-1169.561) (-1168.018) [-1167.152] (-1168.228) * (-1167.375) [-1168.090] (-1172.352) (-1166.450) -- 0:00:51 Average standard deviation of split frequencies: 0.012660 200500 -- (-1169.478) (-1168.581) [-1168.713] (-1169.419) * (-1167.293) (-1170.407) (-1169.961) [-1169.969] -- 0:00:51 201000 -- (-1167.947) [-1168.030] (-1168.453) (-1169.949) * [-1167.858] (-1173.407) (-1168.499) (-1167.432) -- 0:00:51 201500 -- [-1169.665] (-1168.364) (-1169.367) (-1168.255) * [-1166.824] (-1169.233) (-1167.899) (-1168.050) -- 0:00:51 202000 -- [-1169.935] (-1169.544) (-1170.385) (-1169.759) * (-1166.902) [-1169.350] (-1168.146) (-1169.612) -- 0:00:51 202500 -- [-1169.146] (-1169.877) (-1168.975) (-1170.102) * [-1167.162] (-1167.347) (-1172.511) (-1168.500) -- 0:00:51 203000 -- [-1167.673] (-1172.556) (-1168.871) (-1167.617) * (-1167.748) (-1168.366) (-1171.260) [-1167.979] -- 0:00:51 203500 -- [-1168.409] (-1168.725) (-1167.883) (-1166.571) * [-1167.667] (-1168.646) (-1170.583) (-1167.974) -- 0:00:50 204000 -- (-1167.134) (-1167.974) [-1172.065] (-1168.939) * (-1167.734) (-1172.023) (-1170.101) [-1168.031] -- 0:00:50 204500 -- (-1168.042) (-1168.059) (-1169.235) [-1167.147] * [-1168.129] (-1168.080) (-1171.117) (-1168.026) -- 0:00:50 205000 -- (-1167.771) [-1167.464] (-1170.356) (-1166.930) * (-1168.864) (-1169.244) [-1169.602] (-1170.492) -- 0:00:50 Average standard deviation of split frequencies: 0.012767 205500 -- [-1169.523] (-1168.188) (-1166.768) (-1166.884) * (-1167.865) (-1168.569) (-1168.246) [-1168.534] -- 0:00:50 206000 -- [-1168.477] (-1168.622) (-1167.316) (-1168.554) * (-1169.197) [-1167.564] (-1167.795) (-1167.308) -- 0:00:50 206500 -- (-1170.428) [-1166.898] (-1168.100) (-1166.789) * [-1170.012] (-1167.527) (-1168.093) (-1169.489) -- 0:00:49 207000 -- (-1167.846) (-1167.324) (-1169.556) [-1168.213] * (-1167.546) (-1169.345) [-1169.170] (-1168.950) -- 0:00:49 207500 -- (-1171.014) (-1169.320) [-1170.458] (-1171.060) * (-1168.946) (-1170.896) [-1169.438] (-1169.636) -- 0:00:49 208000 -- (-1167.660) (-1167.638) [-1170.378] (-1168.949) * (-1169.134) (-1169.826) [-1174.110] (-1170.907) -- 0:00:49 208500 -- (-1170.016) (-1167.513) [-1169.052] (-1170.586) * (-1168.111) [-1168.270] (-1171.339) (-1169.097) -- 0:00:49 209000 -- (-1168.161) [-1167.608] (-1170.410) (-1168.170) * [-1169.327] (-1168.314) (-1168.896) (-1169.539) -- 0:00:49 209500 -- (-1167.850) (-1166.844) [-1169.684] (-1167.801) * (-1166.276) [-1166.304] (-1167.004) (-1173.612) -- 0:00:49 210000 -- (-1167.300) (-1169.559) [-1168.053] (-1169.737) * (-1166.259) (-1170.113) [-1167.139] (-1168.606) -- 0:00:48 Average standard deviation of split frequencies: 0.013302 210500 -- (-1168.423) (-1170.084) [-1167.265] (-1170.357) * [-1168.302] (-1167.206) (-1168.680) (-1172.878) -- 0:00:52 211000 -- (-1168.193) (-1172.670) (-1166.965) [-1171.024] * (-1169.152) (-1171.893) (-1170.825) [-1167.931] -- 0:00:52 211500 -- (-1169.714) [-1167.578] (-1167.071) (-1171.103) * (-1169.217) (-1170.394) (-1171.052) [-1169.344] -- 0:00:52 212000 -- (-1169.493) (-1169.194) [-1170.780] (-1170.899) * [-1172.880] (-1169.696) (-1170.737) (-1168.340) -- 0:00:52 212500 -- [-1166.515] (-1170.863) (-1168.490) (-1170.505) * (-1169.089) (-1167.050) (-1168.740) [-1168.134] -- 0:00:51 213000 -- (-1166.497) [-1168.164] (-1169.692) (-1170.340) * (-1167.236) (-1166.627) (-1168.054) [-1168.110] -- 0:00:51 213500 -- [-1167.833] (-1169.918) (-1168.780) (-1170.582) * (-1168.443) [-1168.253] (-1167.388) (-1170.541) -- 0:00:51 214000 -- (-1167.818) [-1171.745] (-1167.475) (-1170.515) * [-1166.340] (-1166.457) (-1169.842) (-1168.378) -- 0:00:51 214500 -- [-1166.464] (-1172.298) (-1168.177) (-1170.292) * (-1166.715) (-1166.501) (-1169.856) [-1166.432] -- 0:00:51 215000 -- [-1167.009] (-1167.813) (-1169.192) (-1169.769) * (-1170.786) (-1170.510) (-1167.625) [-1169.345] -- 0:00:51 Average standard deviation of split frequencies: 0.013736 215500 -- (-1167.021) (-1166.225) [-1169.763] (-1175.972) * (-1167.689) (-1168.162) [-1167.469] (-1167.132) -- 0:00:50 216000 -- (-1167.060) (-1166.958) [-1167.455] (-1175.108) * (-1166.859) [-1168.231] (-1166.962) (-1167.097) -- 0:00:50 216500 -- (-1167.132) (-1166.983) [-1167.411] (-1169.558) * (-1167.459) (-1166.378) (-1173.614) [-1166.890] -- 0:00:50 217000 -- (-1167.786) (-1169.011) (-1167.829) [-1170.044] * [-1167.466] (-1167.527) (-1168.649) (-1167.407) -- 0:00:50 217500 -- (-1168.051) (-1173.081) [-1167.106] (-1168.682) * (-1166.871) [-1169.598] (-1170.660) (-1167.239) -- 0:00:50 218000 -- [-1168.125] (-1171.688) (-1167.969) (-1168.920) * [-1168.030] (-1171.920) (-1167.703) (-1168.036) -- 0:00:50 218500 -- (-1173.135) (-1171.277) (-1167.713) [-1167.592] * (-1170.027) [-1167.778] (-1166.433) (-1169.712) -- 0:00:50 219000 -- (-1169.461) (-1177.352) (-1166.638) [-1167.653] * (-1167.636) [-1167.187] (-1167.049) (-1168.602) -- 0:00:49 219500 -- [-1168.746] (-1170.057) (-1167.567) (-1166.458) * (-1167.477) [-1170.060] (-1174.850) (-1169.691) -- 0:00:49 220000 -- (-1172.545) (-1168.470) (-1166.569) [-1166.507] * (-1169.350) (-1169.043) (-1172.397) [-1168.132] -- 0:00:49 Average standard deviation of split frequencies: 0.013697 220500 -- (-1172.636) (-1176.685) (-1168.118) [-1166.446] * (-1168.256) (-1166.979) (-1171.141) [-1169.485] -- 0:00:49 221000 -- (-1173.611) (-1176.126) [-1168.161] (-1166.369) * (-1169.671) [-1168.566] (-1171.142) (-1168.083) -- 0:00:49 221500 -- (-1166.915) [-1172.051] (-1168.613) (-1166.965) * [-1168.755] (-1171.016) (-1168.062) (-1166.691) -- 0:00:49 222000 -- (-1167.726) [-1167.616] (-1169.165) (-1167.774) * (-1167.131) (-1171.279) (-1167.619) [-1169.738] -- 0:00:49 222500 -- (-1167.004) (-1171.664) (-1167.384) [-1171.968] * (-1167.367) (-1170.975) [-1166.848] (-1169.088) -- 0:00:48 223000 -- (-1166.994) (-1170.479) [-1168.181] (-1169.341) * (-1167.169) (-1172.510) (-1169.821) [-1167.891] -- 0:00:48 223500 -- [-1166.276] (-1166.359) (-1168.571) (-1171.389) * [-1167.684] (-1171.285) (-1169.698) (-1166.500) -- 0:00:48 224000 -- (-1171.282) (-1168.252) [-1167.623] (-1169.822) * (-1168.248) [-1170.437] (-1170.304) (-1166.494) -- 0:00:48 224500 -- [-1169.097] (-1166.623) (-1168.392) (-1168.825) * [-1167.390] (-1168.515) (-1169.127) (-1168.238) -- 0:00:48 225000 -- (-1166.739) (-1168.679) (-1167.153) [-1168.704] * (-1170.077) (-1167.370) [-1167.177] (-1168.849) -- 0:00:48 Average standard deviation of split frequencies: 0.013833 225500 -- [-1167.095] (-1168.689) (-1167.153) (-1171.672) * [-1169.367] (-1167.854) (-1173.323) (-1169.786) -- 0:00:48 226000 -- (-1171.662) (-1167.176) [-1167.165] (-1175.790) * (-1168.303) [-1170.290] (-1169.497) (-1169.207) -- 0:00:47 226500 -- (-1167.856) (-1168.510) (-1170.535) [-1168.639] * (-1169.160) (-1168.481) (-1167.151) [-1167.605] -- 0:00:51 227000 -- (-1168.268) [-1169.218] (-1169.750) (-1167.625) * (-1169.186) (-1168.182) [-1169.358] (-1168.298) -- 0:00:51 227500 -- [-1167.553] (-1168.265) (-1169.906) (-1168.936) * (-1169.516) (-1168.399) (-1168.918) [-1167.615] -- 0:00:50 228000 -- (-1168.553) [-1167.046] (-1166.831) (-1167.229) * (-1169.225) (-1168.276) [-1167.241] (-1171.368) -- 0:00:50 228500 -- (-1168.240) (-1168.864) (-1174.134) [-1167.421] * (-1167.946) (-1167.783) [-1167.111] (-1168.417) -- 0:00:50 229000 -- [-1170.791] (-1169.261) (-1166.491) (-1168.394) * [-1167.137] (-1167.083) (-1166.986) (-1168.957) -- 0:00:50 229500 -- (-1171.565) (-1169.498) [-1167.703] (-1170.147) * [-1167.621] (-1166.750) (-1172.215) (-1168.568) -- 0:00:50 230000 -- (-1169.704) (-1172.629) (-1169.233) [-1171.863] * [-1167.679] (-1168.522) (-1173.408) (-1170.031) -- 0:00:50 Average standard deviation of split frequencies: 0.014760 230500 -- [-1171.776] (-1169.604) (-1166.747) (-1168.208) * (-1168.640) [-1168.865] (-1167.924) (-1167.549) -- 0:00:50 231000 -- (-1170.468) [-1167.615] (-1166.738) (-1170.483) * (-1166.344) (-1170.927) (-1168.309) [-1167.298] -- 0:00:49 231500 -- (-1168.626) (-1168.216) (-1170.102) [-1169.344] * (-1166.855) (-1173.294) [-1169.363] (-1166.827) -- 0:00:49 232000 -- (-1169.067) (-1167.850) (-1168.962) [-1168.665] * (-1171.420) [-1168.713] (-1167.239) (-1172.715) -- 0:00:49 232500 -- (-1167.083) (-1168.346) (-1167.056) [-1166.791] * [-1166.635] (-1170.602) (-1167.422) (-1168.872) -- 0:00:49 233000 -- (-1168.139) (-1167.439) (-1167.441) [-1170.146] * (-1168.386) (-1169.252) (-1167.132) [-1168.007] -- 0:00:49 233500 -- (-1168.899) (-1169.527) [-1167.901] (-1170.269) * (-1168.875) (-1169.434) [-1167.132] (-1167.639) -- 0:00:49 234000 -- (-1168.037) (-1168.300) (-1167.833) [-1167.304] * [-1168.636] (-1168.542) (-1168.118) (-1167.797) -- 0:00:49 234500 -- (-1171.828) (-1169.397) [-1167.037] (-1168.639) * (-1171.044) [-1169.232] (-1176.117) (-1167.469) -- 0:00:48 235000 -- (-1167.400) [-1169.416] (-1168.077) (-1169.962) * (-1171.173) (-1170.343) [-1169.326] (-1168.564) -- 0:00:48 Average standard deviation of split frequencies: 0.013630 235500 -- (-1167.535) (-1170.264) (-1167.351) [-1167.845] * [-1170.854] (-1167.155) (-1167.672) (-1168.005) -- 0:00:48 236000 -- (-1168.074) (-1170.266) [-1168.181] (-1170.300) * (-1168.795) (-1167.585) [-1168.774] (-1166.928) -- 0:00:48 236500 -- (-1167.388) (-1168.111) (-1167.273) [-1167.445] * [-1166.107] (-1167.362) (-1169.495) (-1168.000) -- 0:00:48 237000 -- [-1167.623] (-1169.309) (-1170.457) (-1168.289) * (-1166.507) [-1166.865] (-1168.925) (-1170.387) -- 0:00:48 237500 -- [-1167.116] (-1167.970) (-1169.199) (-1169.091) * (-1168.409) [-1166.666] (-1167.469) (-1166.970) -- 0:00:48 238000 -- (-1169.686) [-1168.662] (-1171.121) (-1166.428) * (-1168.882) [-1166.432] (-1166.621) (-1166.951) -- 0:00:48 238500 -- (-1170.961) [-1169.913] (-1172.365) (-1167.988) * (-1169.804) (-1167.779) (-1166.631) [-1166.951] -- 0:00:47 239000 -- (-1171.650) (-1168.774) [-1169.705] (-1167.820) * (-1166.975) (-1167.884) [-1167.639] (-1169.100) -- 0:00:47 239500 -- [-1168.463] (-1170.218) (-1166.055) (-1167.910) * (-1169.640) (-1167.120) [-1168.262] (-1171.330) -- 0:00:47 240000 -- (-1167.732) [-1171.659] (-1166.534) (-1173.159) * (-1178.545) [-1168.264] (-1167.794) (-1171.387) -- 0:00:47 Average standard deviation of split frequencies: 0.014691 240500 -- (-1168.180) [-1169.062] (-1166.426) (-1169.048) * (-1167.226) (-1168.788) [-1168.001] (-1166.713) -- 0:00:47 241000 -- (-1167.897) (-1166.936) [-1167.668] (-1171.596) * (-1168.877) (-1167.954) [-1166.947] (-1166.264) -- 0:00:47 241500 -- (-1166.703) [-1167.127] (-1167.699) (-1166.836) * (-1167.668) [-1167.024] (-1166.947) (-1167.579) -- 0:00:47 242000 -- (-1168.012) (-1167.326) (-1166.474) [-1168.528] * (-1167.393) (-1167.035) (-1167.912) [-1169.214] -- 0:00:46 242500 -- (-1167.710) [-1166.687] (-1167.562) (-1172.133) * (-1168.609) [-1166.549] (-1168.541) (-1167.670) -- 0:00:49 243000 -- (-1167.465) (-1168.115) (-1168.269) [-1166.588] * (-1169.181) (-1166.615) (-1166.743) [-1168.116] -- 0:00:49 243500 -- (-1170.193) [-1166.555] (-1167.904) (-1166.829) * (-1168.456) [-1166.842] (-1169.848) (-1168.892) -- 0:00:49 244000 -- (-1170.600) [-1166.979] (-1166.533) (-1166.734) * (-1169.743) (-1167.346) (-1168.704) [-1167.547] -- 0:00:49 244500 -- (-1170.525) (-1166.465) (-1166.898) [-1166.806] * (-1167.616) (-1168.403) [-1169.180] (-1167.325) -- 0:00:49 245000 -- (-1168.117) (-1166.551) (-1168.414) [-1167.114] * [-1168.542] (-1168.401) (-1167.624) (-1167.164) -- 0:00:49 Average standard deviation of split frequencies: 0.013515 245500 -- (-1166.770) (-1169.571) [-1166.825] (-1167.132) * (-1166.628) (-1166.879) [-1167.333] (-1166.270) -- 0:00:49 246000 -- (-1168.697) [-1166.975] (-1168.281) (-1169.276) * (-1166.940) [-1168.064] (-1168.297) (-1168.333) -- 0:00:49 246500 -- (-1170.338) (-1170.679) [-1167.283] (-1168.625) * [-1167.000] (-1166.688) (-1169.774) (-1168.754) -- 0:00:48 247000 -- [-1169.658] (-1170.127) (-1168.588) (-1166.917) * [-1166.505] (-1170.225) (-1168.023) (-1167.416) -- 0:00:48 247500 -- [-1169.300] (-1169.487) (-1167.167) (-1167.259) * (-1166.355) (-1170.896) (-1166.448) [-1170.324] -- 0:00:48 248000 -- (-1172.283) [-1169.200] (-1169.880) (-1169.037) * (-1168.622) (-1167.297) (-1168.344) [-1166.991] -- 0:00:48 248500 -- (-1168.745) (-1166.532) [-1167.544] (-1167.118) * (-1170.739) [-1173.700] (-1169.408) (-1170.552) -- 0:00:48 249000 -- (-1166.486) (-1170.466) (-1168.286) [-1167.554] * [-1167.225] (-1168.960) (-1169.750) (-1167.521) -- 0:00:48 249500 -- (-1166.247) [-1167.014] (-1168.281) (-1167.507) * (-1167.570) (-1168.302) [-1168.404] (-1169.738) -- 0:00:48 250000 -- (-1167.044) [-1167.020] (-1166.899) (-1167.150) * [-1167.236] (-1168.010) (-1167.709) (-1169.935) -- 0:00:48 Average standard deviation of split frequencies: 0.013461 250500 -- (-1167.131) [-1167.660] (-1166.767) (-1170.121) * (-1167.001) [-1168.580] (-1166.294) (-1169.004) -- 0:00:47 251000 -- (-1172.535) [-1167.378] (-1168.036) (-1170.765) * (-1171.488) (-1168.384) (-1168.919) [-1167.018] -- 0:00:47 251500 -- [-1168.612] (-1167.378) (-1168.523) (-1171.326) * (-1171.861) (-1168.004) [-1166.793] (-1167.199) -- 0:00:47 252000 -- (-1170.860) (-1167.836) [-1168.601] (-1171.425) * (-1168.836) (-1167.359) [-1167.189] (-1166.911) -- 0:00:47 252500 -- [-1167.062] (-1169.693) (-1169.493) (-1169.402) * (-1173.280) (-1169.599) [-1171.043] (-1168.537) -- 0:00:47 253000 -- (-1168.084) (-1169.782) (-1168.108) [-1170.968] * (-1171.441) (-1168.646) (-1167.715) [-1173.070] -- 0:00:47 253500 -- (-1167.728) (-1166.899) [-1170.778] (-1170.774) * [-1167.402] (-1167.728) (-1167.291) (-1169.893) -- 0:00:47 254000 -- [-1166.638] (-1167.020) (-1168.311) (-1168.988) * (-1167.173) [-1167.743] (-1166.550) (-1166.951) -- 0:00:46 254500 -- (-1169.986) [-1168.228] (-1167.617) (-1167.611) * (-1167.614) (-1169.912) [-1167.234] (-1169.943) -- 0:00:46 255000 -- [-1167.783] (-1167.999) (-1167.015) (-1170.458) * (-1168.426) (-1167.902) [-1168.568] (-1167.660) -- 0:00:46 Average standard deviation of split frequencies: 0.013762 255500 -- (-1170.635) [-1169.599] (-1167.077) (-1168.493) * (-1167.752) (-1169.322) [-1170.777] (-1166.349) -- 0:00:46 256000 -- (-1170.929) [-1167.277] (-1167.921) (-1169.399) * [-1169.024] (-1171.309) (-1167.823) (-1168.931) -- 0:00:46 256500 -- (-1170.493) [-1167.039] (-1168.817) (-1167.893) * (-1170.638) [-1169.268] (-1168.365) (-1169.523) -- 0:00:46 257000 -- (-1167.902) (-1168.556) [-1168.702] (-1167.138) * [-1167.170] (-1170.009) (-1168.426) (-1168.854) -- 0:00:46 257500 -- [-1169.294] (-1167.379) (-1167.175) (-1169.207) * (-1168.333) (-1170.883) (-1167.977) [-1169.064] -- 0:00:46 258000 -- (-1167.717) (-1168.855) [-1167.619] (-1168.897) * (-1168.875) (-1167.179) [-1167.379] (-1170.207) -- 0:00:46 258500 -- [-1167.034] (-1168.549) (-1167.274) (-1167.313) * (-1168.158) (-1167.714) [-1168.717] (-1171.824) -- 0:00:45 259000 -- (-1175.536) (-1168.150) (-1167.909) [-1167.942] * (-1168.843) (-1167.098) [-1167.719] (-1169.162) -- 0:00:48 259500 -- (-1174.243) (-1167.318) (-1169.352) [-1167.569] * (-1166.535) [-1167.436] (-1173.853) (-1174.634) -- 0:00:48 260000 -- [-1167.956] (-1167.135) (-1168.871) (-1167.988) * [-1169.633] (-1169.840) (-1172.625) (-1170.784) -- 0:00:48 Average standard deviation of split frequencies: 0.013965 260500 -- (-1171.861) (-1167.596) (-1166.569) [-1170.045] * (-1169.352) (-1171.449) [-1167.515] (-1168.578) -- 0:00:48 261000 -- (-1170.901) [-1169.217] (-1167.037) (-1166.514) * (-1169.610) (-1168.054) (-1172.942) [-1166.596] -- 0:00:48 261500 -- (-1168.805) (-1167.165) [-1168.547] (-1166.613) * (-1168.707) [-1171.184] (-1167.785) (-1168.436) -- 0:00:48 262000 -- (-1169.097) [-1167.382] (-1170.606) (-1174.058) * (-1169.186) (-1169.112) (-1169.962) [-1167.809] -- 0:00:47 262500 -- (-1169.181) [-1168.407] (-1166.685) (-1169.912) * (-1167.586) (-1167.803) (-1168.212) [-1168.519] -- 0:00:47 263000 -- [-1168.205] (-1169.361) (-1169.875) (-1168.227) * (-1167.299) (-1172.059) [-1167.466] (-1167.816) -- 0:00:47 263500 -- (-1168.173) [-1170.234] (-1172.292) (-1171.145) * (-1168.266) (-1171.944) [-1166.465] (-1167.222) -- 0:00:47 264000 -- (-1167.366) (-1169.805) (-1166.812) [-1167.180] * (-1169.058) (-1167.136) (-1166.431) [-1167.532] -- 0:00:47 264500 -- (-1168.773) (-1166.759) (-1167.842) [-1169.738] * [-1169.705] (-1170.063) (-1166.610) (-1170.008) -- 0:00:47 265000 -- (-1169.418) [-1168.572] (-1166.341) (-1169.997) * [-1168.797] (-1170.322) (-1166.813) (-1170.791) -- 0:00:47 Average standard deviation of split frequencies: 0.013418 265500 -- (-1167.884) (-1166.798) [-1168.108] (-1169.281) * (-1171.288) (-1166.510) [-1168.739] (-1170.326) -- 0:00:47 266000 -- (-1167.587) [-1169.233] (-1168.427) (-1169.743) * (-1169.197) [-1166.612] (-1168.168) (-1170.102) -- 0:00:46 266500 -- [-1167.150] (-1167.925) (-1166.456) (-1166.724) * [-1167.859] (-1168.043) (-1169.843) (-1169.943) -- 0:00:46 267000 -- (-1167.467) [-1172.620] (-1168.738) (-1174.411) * (-1167.356) (-1168.618) (-1168.154) [-1169.014] -- 0:00:46 267500 -- (-1171.880) [-1166.609] (-1167.827) (-1169.701) * (-1169.137) (-1171.981) (-1167.512) [-1167.769] -- 0:00:46 268000 -- (-1166.688) (-1167.481) (-1168.414) [-1170.481] * [-1168.798] (-1168.183) (-1166.205) (-1167.749) -- 0:00:46 268500 -- (-1168.355) (-1169.828) [-1168.558] (-1169.942) * (-1168.003) (-1169.214) (-1169.256) [-1171.987] -- 0:00:46 269000 -- (-1169.460) (-1168.283) (-1168.340) [-1168.991] * (-1170.122) (-1166.810) (-1167.609) [-1171.488] -- 0:00:46 269500 -- (-1170.885) (-1171.255) [-1169.683] (-1169.979) * [-1167.131] (-1167.959) (-1166.162) (-1167.859) -- 0:00:46 270000 -- (-1168.578) (-1169.577) [-1168.774] (-1173.853) * (-1169.365) [-1167.234] (-1170.880) (-1168.468) -- 0:00:45 Average standard deviation of split frequencies: 0.013475 270500 -- [-1168.069] (-1168.885) (-1171.580) (-1168.349) * (-1168.533) [-1168.088] (-1169.375) (-1170.810) -- 0:00:45 271000 -- (-1169.906) [-1167.770] (-1173.423) (-1170.583) * (-1167.258) [-1166.471] (-1166.277) (-1170.446) -- 0:00:45 271500 -- [-1167.157] (-1168.824) (-1173.427) (-1171.097) * (-1167.512) (-1170.182) (-1166.199) [-1166.137] -- 0:00:45 272000 -- (-1168.028) (-1168.185) [-1168.750] (-1167.866) * (-1170.314) (-1167.015) [-1166.235] (-1166.140) -- 0:00:45 272500 -- [-1167.866] (-1170.110) (-1172.923) (-1171.598) * (-1171.719) [-1168.337] (-1169.432) (-1167.710) -- 0:00:45 273000 -- [-1167.649] (-1168.295) (-1168.692) (-1166.789) * [-1169.980] (-1168.295) (-1166.255) (-1167.110) -- 0:00:45 273500 -- (-1169.045) (-1166.273) (-1169.530) [-1166.900] * [-1167.693] (-1166.868) (-1170.241) (-1168.206) -- 0:00:45 274000 -- (-1166.938) (-1166.360) (-1170.857) [-1169.292] * (-1167.249) [-1166.897] (-1168.271) (-1169.983) -- 0:00:45 274500 -- (-1169.499) (-1168.331) (-1174.205) [-1168.283] * (-1170.467) [-1169.012] (-1169.868) (-1166.258) -- 0:00:44 275000 -- [-1170.232] (-1167.198) (-1169.815) (-1167.014) * (-1167.334) [-1169.289] (-1173.645) (-1170.227) -- 0:00:47 Average standard deviation of split frequencies: 0.013745 275500 -- (-1170.328) (-1167.260) [-1167.594] (-1170.022) * (-1167.714) [-1167.882] (-1168.417) (-1169.237) -- 0:00:47 276000 -- (-1168.419) [-1167.873] (-1169.542) (-1173.696) * (-1167.953) (-1169.085) (-1167.184) [-1166.451] -- 0:00:47 276500 -- [-1167.308] (-1167.526) (-1171.543) (-1171.032) * (-1169.256) (-1173.864) [-1167.493] (-1170.140) -- 0:00:47 277000 -- (-1170.428) (-1167.991) [-1170.069] (-1168.032) * (-1168.273) [-1167.919] (-1168.395) (-1166.653) -- 0:00:46 277500 -- (-1168.832) (-1167.194) (-1169.122) [-1167.268] * (-1168.297) (-1170.262) [-1166.744] (-1166.829) -- 0:00:46 278000 -- (-1169.148) (-1166.648) [-1167.090] (-1167.513) * (-1169.036) (-1167.470) (-1167.207) [-1168.548] -- 0:00:46 278500 -- [-1168.098] (-1167.387) (-1169.668) (-1167.852) * (-1168.359) (-1173.767) [-1167.537] (-1167.876) -- 0:00:46 279000 -- [-1168.580] (-1166.911) (-1168.909) (-1167.346) * (-1170.553) (-1170.149) [-1167.369] (-1167.321) -- 0:00:46 279500 -- (-1168.725) (-1167.147) (-1168.992) [-1166.613] * (-1173.530) (-1168.337) [-1172.123] (-1169.485) -- 0:00:46 280000 -- [-1167.347] (-1172.504) (-1168.569) (-1168.126) * (-1168.904) [-1169.874] (-1167.185) (-1170.571) -- 0:00:46 Average standard deviation of split frequencies: 0.012906 280500 -- [-1167.705] (-1168.868) (-1168.539) (-1168.358) * (-1168.399) (-1172.409) (-1166.817) [-1168.943] -- 0:00:46 281000 -- (-1168.820) [-1167.848] (-1170.086) (-1170.193) * (-1172.350) [-1171.799] (-1172.246) (-1166.844) -- 0:00:46 281500 -- (-1169.533) [-1167.248] (-1171.187) (-1168.408) * (-1174.098) (-1169.394) [-1167.150] (-1168.216) -- 0:00:45 282000 -- [-1171.479] (-1166.738) (-1168.521) (-1168.933) * (-1170.924) (-1167.849) (-1168.552) [-1168.315] -- 0:00:45 282500 -- [-1166.611] (-1166.884) (-1168.872) (-1169.108) * (-1175.087) (-1174.031) [-1167.505] (-1171.062) -- 0:00:45 283000 -- (-1168.970) (-1169.469) [-1167.983] (-1167.546) * (-1166.577) (-1167.059) [-1171.109] (-1170.474) -- 0:00:45 283500 -- (-1167.192) [-1166.987] (-1167.106) (-1168.136) * (-1170.511) (-1169.064) [-1170.304] (-1167.622) -- 0:00:45 284000 -- (-1168.213) [-1167.193] (-1166.061) (-1168.745) * [-1168.578] (-1173.841) (-1170.643) (-1169.527) -- 0:00:45 284500 -- (-1170.962) (-1170.805) (-1166.012) [-1167.696] * (-1170.300) (-1173.781) [-1166.939] (-1166.832) -- 0:00:45 285000 -- (-1167.832) (-1170.394) (-1166.327) [-1166.742] * (-1167.838) (-1170.035) [-1167.397] (-1166.833) -- 0:00:45 Average standard deviation of split frequencies: 0.013516 285500 -- [-1169.682] (-1169.122) (-1169.000) (-1166.683) * [-1166.715] (-1168.407) (-1168.228) (-1167.550) -- 0:00:45 286000 -- (-1171.499) (-1169.829) [-1171.513] (-1167.284) * (-1168.256) (-1167.712) [-1168.338] (-1168.471) -- 0:00:44 286500 -- (-1168.976) (-1168.008) (-1178.689) [-1168.383] * (-1167.076) [-1167.331] (-1168.206) (-1168.311) -- 0:00:44 287000 -- (-1167.008) (-1167.023) [-1170.108] (-1168.489) * (-1168.804) (-1168.240) [-1168.017] (-1167.830) -- 0:00:44 287500 -- [-1170.831] (-1166.811) (-1168.411) (-1167.368) * [-1173.638] (-1169.114) (-1166.856) (-1167.332) -- 0:00:44 288000 -- (-1168.089) (-1167.383) [-1168.579] (-1166.964) * (-1173.963) (-1169.404) [-1166.575] (-1169.271) -- 0:00:44 288500 -- (-1167.559) [-1168.315] (-1168.693) (-1167.246) * [-1166.769] (-1167.966) (-1171.278) (-1171.160) -- 0:00:44 289000 -- (-1167.428) (-1168.687) [-1167.437] (-1170.430) * (-1171.318) (-1166.996) (-1169.246) [-1171.791] -- 0:00:44 289500 -- (-1168.380) [-1169.487] (-1167.281) (-1171.623) * (-1166.468) (-1167.994) [-1167.130] (-1171.219) -- 0:00:44 290000 -- [-1166.492] (-1170.477) (-1168.693) (-1167.397) * (-1166.481) [-1167.809] (-1167.623) (-1167.605) -- 0:00:44 Average standard deviation of split frequencies: 0.013928 290500 -- (-1167.566) (-1170.156) [-1170.836] (-1168.256) * [-1166.720] (-1171.424) (-1168.278) (-1167.419) -- 0:00:43 291000 -- [-1168.155] (-1174.180) (-1172.854) (-1166.853) * [-1167.287] (-1168.075) (-1168.227) (-1170.036) -- 0:00:46 291500 -- (-1170.542) (-1171.278) (-1176.732) [-1166.493] * (-1168.067) (-1168.460) [-1168.691] (-1174.280) -- 0:00:46 292000 -- [-1169.880] (-1168.332) (-1172.150) (-1166.668) * [-1168.950] (-1168.069) (-1170.716) (-1168.233) -- 0:00:46 292500 -- (-1170.395) (-1167.568) [-1167.724] (-1166.829) * [-1168.138] (-1174.951) (-1168.675) (-1170.261) -- 0:00:45 293000 -- (-1169.032) [-1167.355] (-1167.227) (-1168.181) * [-1170.185] (-1170.019) (-1167.645) (-1169.926) -- 0:00:45 293500 -- (-1167.812) (-1169.649) (-1169.515) [-1168.452] * (-1167.001) [-1168.031] (-1166.957) (-1171.112) -- 0:00:45 294000 -- [-1168.124] (-1168.903) (-1173.120) (-1168.078) * (-1167.869) [-1169.526] (-1168.044) (-1168.583) -- 0:00:45 294500 -- (-1167.383) [-1167.121] (-1168.683) (-1166.679) * (-1169.409) [-1168.806] (-1169.328) (-1167.790) -- 0:00:45 295000 -- (-1166.579) (-1167.776) [-1169.578] (-1169.064) * [-1167.481] (-1167.421) (-1167.186) (-1170.047) -- 0:00:45 Average standard deviation of split frequencies: 0.013802 295500 -- (-1167.486) [-1168.814] (-1171.833) (-1168.153) * (-1167.547) [-1167.526] (-1167.250) (-1170.168) -- 0:00:45 296000 -- (-1172.156) (-1168.160) (-1173.119) [-1166.311] * (-1167.905) (-1166.274) [-1168.513] (-1166.356) -- 0:00:45 296500 -- (-1168.939) [-1167.930] (-1167.166) (-1168.605) * (-1177.785) (-1173.896) [-1166.654] (-1166.990) -- 0:00:45 297000 -- (-1171.529) (-1168.296) (-1168.102) [-1168.174] * (-1167.956) [-1170.891] (-1166.789) (-1167.405) -- 0:00:44 297500 -- (-1170.523) (-1168.485) (-1168.244) [-1166.628] * [-1167.920] (-1168.345) (-1166.934) (-1171.623) -- 0:00:44 298000 -- (-1169.660) (-1168.432) [-1168.248] (-1166.763) * (-1166.919) [-1167.800] (-1167.759) (-1168.883) -- 0:00:44 298500 -- (-1169.536) (-1167.915) [-1166.772] (-1166.932) * [-1169.403] (-1167.832) (-1167.265) (-1168.035) -- 0:00:44 299000 -- (-1171.700) [-1166.754] (-1166.883) (-1166.714) * (-1170.047) (-1168.024) [-1169.016] (-1168.680) -- 0:00:44 299500 -- (-1180.229) [-1168.886] (-1167.078) (-1166.970) * (-1167.222) [-1166.467] (-1167.305) (-1169.900) -- 0:00:44 300000 -- (-1173.627) [-1167.879] (-1168.104) (-1170.744) * (-1169.069) [-1167.984] (-1167.347) (-1169.226) -- 0:00:44 Average standard deviation of split frequencies: 0.014808 300500 -- (-1166.963) (-1171.160) [-1167.100] (-1167.412) * (-1168.855) (-1171.576) (-1168.201) [-1171.773] -- 0:00:44 301000 -- (-1168.424) (-1170.734) (-1166.636) [-1168.073] * [-1169.961] (-1166.447) (-1166.794) (-1168.921) -- 0:00:44 301500 -- (-1166.579) (-1167.995) (-1170.325) [-1168.139] * (-1171.494) (-1168.919) [-1168.264] (-1172.639) -- 0:00:44 302000 -- (-1166.235) (-1166.277) (-1166.633) [-1167.245] * (-1170.301) (-1168.231) (-1168.630) [-1168.980] -- 0:00:43 302500 -- [-1166.939] (-1166.720) (-1167.930) (-1166.687) * (-1166.916) (-1169.742) [-1167.541] (-1167.977) -- 0:00:43 303000 -- [-1166.199] (-1171.066) (-1168.003) (-1166.691) * (-1167.145) [-1167.695] (-1168.168) (-1169.865) -- 0:00:43 303500 -- [-1168.632] (-1170.268) (-1166.366) (-1170.466) * (-1167.279) [-1166.586] (-1168.481) (-1166.968) -- 0:00:43 304000 -- (-1169.417) (-1167.880) (-1166.960) [-1168.799] * (-1167.104) (-1168.706) (-1168.620) [-1167.083] -- 0:00:43 304500 -- (-1167.691) (-1167.448) [-1166.819] (-1166.756) * (-1167.341) [-1168.485] (-1167.226) (-1167.549) -- 0:00:43 305000 -- (-1167.494) [-1166.765] (-1166.378) (-1167.148) * (-1171.790) (-1169.560) [-1169.531] (-1167.518) -- 0:00:43 Average standard deviation of split frequencies: 0.014757 305500 -- (-1169.377) [-1168.323] (-1168.445) (-1167.346) * (-1167.617) (-1169.479) (-1167.892) [-1170.359] -- 0:00:43 306000 -- (-1167.817) (-1167.779) (-1169.128) [-1167.643] * (-1167.202) [-1168.569] (-1167.264) (-1166.681) -- 0:00:43 306500 -- (-1167.856) (-1167.773) (-1168.045) [-1168.941] * [-1167.023] (-1168.575) (-1170.286) (-1166.943) -- 0:00:42 307000 -- (-1169.040) (-1171.569) (-1168.155) [-1168.472] * (-1168.978) (-1167.520) [-1168.767] (-1166.841) -- 0:00:42 307500 -- (-1167.768) (-1167.829) [-1166.812] (-1171.499) * (-1168.580) (-1167.086) [-1168.007] (-1166.852) -- 0:00:45 308000 -- (-1167.197) [-1170.590] (-1167.857) (-1168.306) * (-1167.821) (-1168.031) (-1169.840) [-1168.748] -- 0:00:44 308500 -- (-1168.197) (-1168.772) (-1168.552) [-1166.277] * (-1166.717) (-1169.503) (-1169.014) [-1170.067] -- 0:00:44 309000 -- (-1168.976) (-1167.148) [-1166.830] (-1168.044) * [-1169.007] (-1170.160) (-1167.120) (-1169.056) -- 0:00:44 309500 -- (-1167.112) [-1167.240] (-1166.676) (-1168.977) * (-1167.107) (-1168.244) (-1166.989) [-1169.474] -- 0:00:44 310000 -- (-1166.296) (-1166.958) [-1167.046] (-1170.283) * (-1168.286) [-1168.180] (-1167.565) (-1169.767) -- 0:00:44 Average standard deviation of split frequencies: 0.014500 310500 -- [-1166.317] (-1166.996) (-1167.213) (-1169.273) * (-1171.892) (-1170.000) [-1168.702] (-1169.397) -- 0:00:44 311000 -- (-1166.301) (-1170.850) [-1166.821] (-1172.766) * [-1167.520] (-1169.190) (-1167.847) (-1167.785) -- 0:00:44 311500 -- (-1168.803) (-1168.433) [-1168.833] (-1170.221) * (-1168.524) (-1167.850) [-1167.577] (-1169.238) -- 0:00:44 312000 -- (-1169.155) (-1168.631) [-1171.672] (-1168.151) * (-1167.786) (-1169.176) [-1166.722] (-1170.694) -- 0:00:44 312500 -- (-1166.583) [-1168.647] (-1170.794) (-1168.861) * [-1171.000] (-1168.454) (-1169.616) (-1168.324) -- 0:00:44 313000 -- (-1170.250) (-1169.523) [-1169.554] (-1167.480) * (-1172.812) [-1167.418] (-1167.353) (-1169.139) -- 0:00:43 313500 -- (-1170.756) (-1167.406) [-1166.726] (-1167.299) * (-1174.503) [-1168.263] (-1170.190) (-1167.763) -- 0:00:43 314000 -- (-1166.035) (-1168.187) (-1173.236) [-1166.476] * (-1172.815) (-1167.560) [-1169.710] (-1168.087) -- 0:00:43 314500 -- (-1166.035) (-1168.841) [-1166.803] (-1166.856) * [-1173.907] (-1166.571) (-1167.508) (-1168.123) -- 0:00:43 315000 -- (-1166.035) (-1169.237) [-1171.924] (-1172.423) * (-1171.142) (-1167.203) (-1169.546) [-1167.801] -- 0:00:43 Average standard deviation of split frequencies: 0.013260 315500 -- (-1167.289) [-1169.009] (-1168.254) (-1169.438) * (-1168.297) (-1167.399) (-1167.451) [-1168.486] -- 0:00:43 316000 -- [-1167.063] (-1169.400) (-1169.051) (-1166.809) * (-1168.495) (-1166.692) [-1167.167] (-1169.024) -- 0:00:43 316500 -- [-1167.144] (-1168.236) (-1169.546) (-1167.378) * (-1169.544) [-1169.306] (-1166.760) (-1167.998) -- 0:00:43 317000 -- (-1168.222) (-1167.758) [-1170.001] (-1166.843) * (-1168.123) (-1169.373) (-1168.079) [-1169.232] -- 0:00:43 317500 -- (-1168.158) (-1167.775) (-1169.414) [-1167.432] * (-1167.170) (-1168.213) (-1167.210) [-1173.900] -- 0:00:42 318000 -- (-1168.938) (-1169.261) (-1170.152) [-1169.219] * (-1168.731) [-1167.447] (-1168.213) (-1168.155) -- 0:00:42 318500 -- (-1170.849) (-1168.664) [-1169.880] (-1168.677) * (-1168.521) [-1167.966] (-1174.073) (-1169.700) -- 0:00:42 319000 -- [-1167.710] (-1169.468) (-1168.834) (-1169.682) * (-1168.243) (-1170.906) (-1175.683) [-1167.646] -- 0:00:42 319500 -- (-1168.194) [-1171.777] (-1168.298) (-1167.520) * (-1169.138) [-1170.411] (-1171.216) (-1167.885) -- 0:00:42 320000 -- [-1167.740] (-1172.936) (-1170.455) (-1167.584) * (-1173.510) (-1170.017) (-1167.269) [-1167.938] -- 0:00:42 Average standard deviation of split frequencies: 0.014441 320500 -- (-1169.249) (-1170.483) (-1168.987) [-1168.091] * [-1168.382] (-1167.186) (-1166.562) (-1169.000) -- 0:00:42 321000 -- (-1170.697) (-1168.980) [-1168.029] (-1167.133) * (-1167.881) (-1167.232) (-1168.270) [-1168.474] -- 0:00:42 321500 -- (-1168.378) [-1168.779] (-1166.632) (-1166.102) * (-1170.517) (-1167.388) (-1169.527) [-1167.113] -- 0:00:42 322000 -- [-1171.227] (-1168.559) (-1169.011) (-1166.700) * (-1168.477) (-1167.379) [-1168.331] (-1171.548) -- 0:00:42 322500 -- (-1168.047) (-1168.283) (-1172.547) [-1170.250] * [-1167.993] (-1167.428) (-1171.078) (-1168.120) -- 0:00:42 323000 -- (-1168.209) [-1169.230] (-1167.561) (-1169.276) * (-1169.069) (-1168.818) (-1169.437) [-1172.055] -- 0:00:41 323500 -- (-1167.584) (-1166.633) (-1167.418) [-1167.066] * [-1168.346] (-1168.475) (-1169.415) (-1169.502) -- 0:00:43 324000 -- [-1169.289] (-1167.657) (-1168.513) (-1166.918) * [-1167.210] (-1168.731) (-1168.117) (-1167.042) -- 0:00:43 324500 -- (-1167.278) (-1167.485) (-1174.396) [-1166.905] * (-1168.232) (-1168.507) (-1169.278) [-1167.293] -- 0:00:43 325000 -- (-1167.621) (-1167.988) [-1170.192] (-1166.314) * [-1166.884] (-1167.772) (-1170.179) (-1168.050) -- 0:00:43 Average standard deviation of split frequencies: 0.013525 325500 -- (-1168.627) (-1167.756) [-1167.976] (-1166.929) * (-1166.947) (-1168.596) (-1169.183) [-1167.315] -- 0:00:43 326000 -- (-1167.772) [-1169.537] (-1166.808) (-1169.385) * [-1167.041] (-1169.597) (-1173.907) (-1169.866) -- 0:00:43 326500 -- (-1171.348) [-1168.793] (-1167.620) (-1169.735) * (-1168.356) (-1170.165) [-1168.793] (-1168.452) -- 0:00:43 327000 -- (-1167.954) [-1167.307] (-1169.648) (-1171.356) * (-1170.259) (-1172.559) [-1171.516] (-1168.651) -- 0:00:43 327500 -- (-1167.849) [-1166.264] (-1168.724) (-1169.563) * [-1173.460] (-1171.570) (-1168.640) (-1171.280) -- 0:00:43 328000 -- (-1172.417) (-1166.295) [-1168.383] (-1168.195) * (-1167.854) (-1171.334) [-1170.549] (-1168.232) -- 0:00:43 328500 -- (-1171.356) (-1167.612) (-1168.890) [-1169.281] * (-1169.480) (-1167.495) [-1166.701] (-1168.430) -- 0:00:42 329000 -- (-1167.356) [-1167.643] (-1167.508) (-1169.790) * (-1169.964) [-1166.682] (-1170.716) (-1166.798) -- 0:00:42 329500 -- [-1167.006] (-1168.340) (-1168.904) (-1173.334) * (-1168.074) (-1166.890) [-1170.773] (-1167.647) -- 0:00:42 330000 -- [-1167.057] (-1170.307) (-1170.913) (-1175.818) * (-1167.611) (-1170.655) [-1169.691] (-1170.949) -- 0:00:42 Average standard deviation of split frequencies: 0.012579 330500 -- [-1168.834] (-1170.338) (-1167.095) (-1171.995) * [-1168.166] (-1168.797) (-1170.243) (-1167.733) -- 0:00:42 331000 -- (-1167.557) [-1168.910] (-1168.499) (-1168.479) * (-1169.876) (-1168.940) [-1168.334] (-1168.352) -- 0:00:42 331500 -- (-1167.439) (-1169.287) (-1168.461) [-1166.894] * (-1168.289) (-1166.683) (-1166.337) [-1169.557] -- 0:00:42 332000 -- (-1170.784) (-1168.180) [-1170.289] (-1170.666) * (-1168.589) [-1167.815] (-1169.199) (-1175.622) -- 0:00:42 332500 -- (-1168.558) [-1167.466] (-1166.774) (-1169.198) * [-1167.749] (-1167.863) (-1168.540) (-1168.101) -- 0:00:42 333000 -- (-1169.665) [-1168.837] (-1168.219) (-1167.178) * (-1168.204) (-1174.581) (-1167.884) [-1168.329] -- 0:00:42 333500 -- (-1170.496) [-1168.679] (-1167.084) (-1170.283) * (-1167.451) (-1166.730) [-1168.805] (-1168.664) -- 0:00:41 334000 -- (-1169.882) (-1167.749) (-1170.843) [-1169.308] * (-1170.136) [-1166.891] (-1168.280) (-1166.651) -- 0:00:41 334500 -- (-1168.211) (-1169.966) (-1169.364) [-1167.614] * (-1171.081) (-1171.945) (-1173.264) [-1166.449] -- 0:00:41 335000 -- [-1168.919] (-1169.172) (-1171.850) (-1166.728) * (-1171.021) [-1167.043] (-1169.348) (-1166.988) -- 0:00:41 Average standard deviation of split frequencies: 0.012462 335500 -- [-1168.939] (-1168.242) (-1169.630) (-1168.451) * [-1171.728] (-1168.161) (-1167.504) (-1166.741) -- 0:00:41 336000 -- (-1171.119) (-1167.247) (-1168.892) [-1167.616] * (-1168.706) (-1167.256) (-1166.909) [-1166.798] -- 0:00:41 336500 -- (-1169.993) (-1167.425) [-1167.895] (-1167.616) * (-1167.309) [-1167.123] (-1168.600) (-1167.082) -- 0:00:41 337000 -- (-1169.500) [-1167.264] (-1168.173) (-1168.330) * (-1166.638) (-1169.451) [-1168.360] (-1166.777) -- 0:00:41 337500 -- (-1167.977) (-1168.064) [-1168.325] (-1170.505) * (-1167.175) (-1166.594) (-1167.540) [-1166.624] -- 0:00:41 338000 -- (-1168.873) [-1166.732] (-1169.518) (-1168.663) * (-1169.538) (-1168.466) (-1168.528) [-1167.277] -- 0:00:41 338500 -- (-1170.135) [-1166.268] (-1170.240) (-1169.505) * [-1169.714] (-1172.426) (-1168.235) (-1166.805) -- 0:00:41 339000 -- (-1171.843) [-1166.165] (-1168.169) (-1168.926) * (-1172.102) (-1168.809) [-1168.141] (-1166.414) -- 0:00:40 339500 -- (-1173.117) (-1167.274) [-1174.512] (-1178.161) * (-1169.760) (-1177.318) (-1166.838) [-1166.847] -- 0:00:40 340000 -- (-1167.406) (-1167.734) [-1170.162] (-1174.038) * (-1175.718) (-1170.873) (-1169.310) [-1167.080] -- 0:00:42 Average standard deviation of split frequencies: 0.012108 340500 -- (-1168.668) (-1169.029) [-1168.506] (-1169.490) * (-1170.710) (-1171.493) (-1170.981) [-1166.475] -- 0:00:42 341000 -- [-1167.417] (-1168.004) (-1168.238) (-1169.508) * (-1170.531) (-1167.024) [-1170.123] (-1167.738) -- 0:00:42 341500 -- (-1168.333) (-1167.378) [-1166.831] (-1169.673) * [-1168.914] (-1169.462) (-1167.672) (-1166.823) -- 0:00:42 342000 -- (-1167.823) [-1171.023] (-1166.831) (-1172.210) * [-1169.554] (-1167.484) (-1168.048) (-1170.090) -- 0:00:42 342500 -- (-1169.130) (-1170.660) [-1167.306] (-1170.215) * (-1168.521) (-1170.395) (-1173.872) [-1166.771] -- 0:00:42 343000 -- (-1168.046) [-1169.085] (-1167.321) (-1174.104) * (-1168.744) [-1166.769] (-1171.641) (-1167.093) -- 0:00:42 343500 -- [-1169.030] (-1168.828) (-1167.364) (-1168.533) * (-1167.449) (-1167.131) (-1169.216) [-1166.962] -- 0:00:42 344000 -- (-1171.718) (-1168.574) [-1168.397] (-1172.601) * (-1166.934) (-1168.742) [-1168.577] (-1171.904) -- 0:00:41 344500 -- (-1171.540) (-1170.108) [-1167.103] (-1172.800) * (-1169.626) (-1170.605) [-1169.527] (-1168.707) -- 0:00:41 345000 -- [-1167.464] (-1168.577) (-1167.265) (-1169.962) * (-1167.368) [-1169.504] (-1168.477) (-1169.163) -- 0:00:41 Average standard deviation of split frequencies: 0.011505 345500 -- (-1168.837) (-1166.861) (-1171.493) [-1167.080] * [-1167.054] (-1168.920) (-1168.118) (-1168.643) -- 0:00:41 346000 -- (-1169.257) [-1167.680] (-1169.239) (-1167.205) * (-1172.747) (-1167.506) [-1169.586] (-1169.365) -- 0:00:41 346500 -- [-1167.186] (-1169.347) (-1171.103) (-1167.423) * (-1169.357) (-1168.427) [-1169.908] (-1174.188) -- 0:00:41 347000 -- (-1167.061) [-1167.348] (-1170.441) (-1167.883) * (-1170.677) (-1172.126) (-1169.106) [-1168.940] -- 0:00:41 347500 -- (-1166.214) (-1169.321) (-1169.289) [-1168.735] * (-1172.609) (-1172.645) [-1168.982] (-1168.025) -- 0:00:41 348000 -- [-1169.881] (-1170.922) (-1167.213) (-1174.252) * (-1169.178) (-1170.561) (-1167.367) [-1167.607] -- 0:00:41 348500 -- (-1170.066) [-1168.336] (-1167.224) (-1171.790) * (-1168.236) (-1166.616) (-1167.061) [-1176.396] -- 0:00:41 349000 -- (-1168.661) (-1169.469) (-1167.183) [-1169.253] * (-1167.353) [-1167.786] (-1167.481) (-1167.797) -- 0:00:41 349500 -- (-1167.597) (-1167.674) [-1168.830] (-1172.358) * (-1168.176) [-1167.328] (-1167.375) (-1168.575) -- 0:00:40 350000 -- (-1167.746) [-1168.037] (-1168.314) (-1167.419) * (-1167.569) (-1166.900) [-1169.546] (-1168.394) -- 0:00:40 Average standard deviation of split frequencies: 0.011466 350500 -- (-1166.771) [-1169.526] (-1168.756) (-1168.445) * [-1168.941] (-1168.040) (-1169.765) (-1168.347) -- 0:00:40 351000 -- [-1168.730] (-1168.068) (-1173.226) (-1166.500) * [-1170.525] (-1166.942) (-1172.901) (-1166.569) -- 0:00:40 351500 -- (-1166.768) (-1166.931) (-1170.901) [-1166.509] * (-1168.368) [-1166.518] (-1171.335) (-1169.631) -- 0:00:40 352000 -- (-1167.191) (-1166.878) (-1171.573) [-1166.667] * (-1169.687) (-1166.337) (-1169.291) [-1167.814] -- 0:00:40 352500 -- [-1166.748] (-1168.282) (-1167.769) (-1172.590) * (-1169.403) (-1170.394) [-1167.624] (-1167.010) -- 0:00:40 353000 -- (-1169.003) [-1166.639] (-1167.051) (-1167.975) * (-1174.346) [-1167.697] (-1170.622) (-1168.866) -- 0:00:40 353500 -- (-1168.746) (-1167.570) (-1168.279) [-1172.047] * (-1173.725) (-1166.835) (-1168.431) [-1169.761] -- 0:00:40 354000 -- [-1172.796] (-1167.427) (-1167.770) (-1169.952) * (-1169.351) (-1167.937) (-1167.144) [-1171.823] -- 0:00:40 354500 -- (-1173.769) [-1167.476] (-1166.578) (-1168.958) * (-1168.708) (-1169.564) (-1166.999) [-1171.135] -- 0:00:40 355000 -- (-1171.472) (-1167.326) [-1169.440] (-1168.515) * (-1166.603) (-1170.484) [-1167.575] (-1170.681) -- 0:00:39 Average standard deviation of split frequencies: 0.010676 355500 -- (-1171.579) [-1168.013] (-1171.947) (-1170.271) * (-1169.230) (-1167.156) (-1168.317) [-1168.177] -- 0:00:39 356000 -- [-1170.867] (-1168.275) (-1167.060) (-1172.048) * (-1168.517) (-1167.550) (-1169.989) [-1168.248] -- 0:00:41 356500 -- (-1168.185) (-1170.615) (-1166.503) [-1168.135] * [-1168.038] (-1167.263) (-1166.442) (-1170.034) -- 0:00:41 357000 -- (-1167.172) (-1169.100) [-1167.832] (-1169.157) * (-1168.370) [-1167.362] (-1168.114) (-1171.316) -- 0:00:41 357500 -- [-1166.383] (-1167.130) (-1173.861) (-1168.866) * (-1166.568) (-1168.834) [-1168.159] (-1170.228) -- 0:00:41 358000 -- (-1166.513) (-1167.735) [-1170.510] (-1168.268) * (-1169.047) (-1167.505) (-1168.611) [-1170.376] -- 0:00:41 358500 -- (-1168.258) (-1169.141) [-1169.232] (-1169.796) * (-1169.388) (-1168.359) (-1172.345) [-1166.600] -- 0:00:41 359000 -- (-1167.666) (-1169.164) [-1171.970] (-1171.485) * (-1168.048) (-1167.082) (-1167.808) [-1166.894] -- 0:00:41 359500 -- (-1168.171) (-1171.052) [-1168.644] (-1168.279) * (-1166.832) (-1167.098) (-1168.262) [-1167.270] -- 0:00:40 360000 -- [-1167.784] (-1168.023) (-1167.128) (-1169.785) * [-1167.240] (-1166.501) (-1169.259) (-1168.779) -- 0:00:40 Average standard deviation of split frequencies: 0.010783 360500 -- (-1168.038) (-1168.559) [-1168.315] (-1166.974) * [-1167.284] (-1168.836) (-1170.756) (-1168.651) -- 0:00:40 361000 -- (-1169.569) (-1169.358) (-1171.163) [-1167.297] * (-1170.556) [-1167.894] (-1166.439) (-1167.280) -- 0:00:40 361500 -- [-1169.383] (-1167.479) (-1167.797) (-1166.705) * (-1166.997) (-1171.967) [-1166.508] (-1170.931) -- 0:00:40 362000 -- (-1172.602) (-1167.380) (-1167.272) [-1167.278] * (-1167.218) (-1169.318) [-1171.058] (-1168.685) -- 0:00:40 362500 -- (-1168.232) (-1166.442) (-1167.289) [-1170.099] * (-1167.616) [-1175.261] (-1169.997) (-1166.719) -- 0:00:40 363000 -- [-1168.262] (-1167.919) (-1167.366) (-1167.640) * [-1169.667] (-1167.448) (-1168.701) (-1166.086) -- 0:00:40 363500 -- [-1167.184] (-1166.750) (-1169.119) (-1169.137) * (-1168.555) (-1166.541) (-1168.908) [-1168.707] -- 0:00:40 364000 -- (-1166.509) (-1172.591) (-1171.457) [-1171.460] * (-1169.163) [-1166.787] (-1169.775) (-1166.889) -- 0:00:40 364500 -- [-1167.949] (-1171.120) (-1168.297) (-1168.641) * (-1168.113) (-1168.971) [-1169.821] (-1167.945) -- 0:00:40 365000 -- (-1168.594) (-1168.298) (-1168.670) [-1169.501] * [-1167.515] (-1169.626) (-1168.469) (-1166.341) -- 0:00:40 Average standard deviation of split frequencies: 0.010380 365500 -- [-1167.147] (-1167.819) (-1166.602) (-1169.496) * (-1166.729) (-1168.530) [-1166.858] (-1167.112) -- 0:00:39 366000 -- (-1172.118) (-1167.461) [-1168.774] (-1168.024) * (-1166.922) (-1169.415) [-1172.810] (-1167.446) -- 0:00:39 366500 -- (-1169.155) (-1170.733) [-1167.620] (-1168.423) * (-1167.366) (-1170.874) (-1171.772) [-1166.798] -- 0:00:39 367000 -- (-1168.142) [-1168.730] (-1168.483) (-1166.830) * (-1168.894) (-1167.240) (-1173.911) [-1167.448] -- 0:00:39 367500 -- [-1169.105] (-1168.454) (-1168.305) (-1167.992) * [-1167.298] (-1166.818) (-1174.350) (-1168.830) -- 0:00:39 368000 -- (-1168.074) [-1171.664] (-1169.864) (-1168.411) * (-1167.781) (-1167.063) (-1173.414) [-1169.513] -- 0:00:39 368500 -- (-1179.622) (-1168.697) [-1168.008] (-1168.916) * (-1168.749) (-1169.020) [-1168.657] (-1169.918) -- 0:00:39 369000 -- (-1175.702) [-1166.983] (-1170.790) (-1169.930) * (-1169.283) [-1169.176] (-1170.853) (-1169.096) -- 0:00:39 369500 -- (-1172.260) [-1168.405] (-1167.914) (-1167.299) * [-1170.755] (-1168.977) (-1171.027) (-1168.037) -- 0:00:39 370000 -- (-1172.309) (-1167.391) (-1167.695) [-1172.027] * [-1170.540] (-1168.661) (-1172.417) (-1170.897) -- 0:00:39 Average standard deviation of split frequencies: 0.010174 370500 -- (-1167.652) (-1167.390) [-1166.707] (-1167.716) * (-1166.969) (-1167.901) (-1169.490) [-1166.921] -- 0:00:39 371000 -- (-1168.502) [-1167.788] (-1167.965) (-1167.048) * (-1168.437) [-1168.767] (-1169.543) (-1167.814) -- 0:00:38 371500 -- (-1172.662) (-1168.287) [-1166.238] (-1168.550) * [-1171.072] (-1168.533) (-1170.423) (-1173.859) -- 0:00:38 372000 -- (-1167.754) (-1167.653) (-1168.335) [-1168.009] * (-1169.796) [-1168.568] (-1169.789) (-1173.314) -- 0:00:38 372500 -- (-1168.217) (-1170.836) [-1171.587] (-1167.141) * [-1170.812] (-1171.484) (-1172.700) (-1168.731) -- 0:00:40 373000 -- (-1169.853) (-1166.563) [-1168.644] (-1167.002) * (-1168.764) [-1170.684] (-1171.439) (-1174.018) -- 0:00:40 373500 -- (-1169.085) (-1168.243) (-1168.012) [-1170.796] * (-1168.176) [-1168.237] (-1168.053) (-1169.347) -- 0:00:40 374000 -- (-1169.085) (-1168.235) (-1168.426) [-1172.251] * (-1169.417) [-1168.081] (-1169.795) (-1171.353) -- 0:00:40 374500 -- [-1168.910] (-1167.580) (-1168.359) (-1168.984) * (-1168.359) (-1173.265) (-1171.568) [-1170.332] -- 0:00:40 375000 -- (-1169.344) (-1173.169) [-1168.208] (-1171.318) * [-1169.132] (-1167.176) (-1169.947) (-1173.569) -- 0:00:40 Average standard deviation of split frequencies: 0.009956 375500 -- (-1167.797) [-1170.412] (-1167.162) (-1172.207) * (-1167.296) (-1167.419) (-1167.185) [-1168.602] -- 0:00:39 376000 -- (-1168.223) (-1174.795) (-1167.327) [-1168.946] * [-1168.638] (-1168.152) (-1168.048) (-1171.349) -- 0:00:39 376500 -- [-1168.713] (-1168.725) (-1166.950) (-1172.785) * [-1168.182] (-1169.769) (-1167.804) (-1173.858) -- 0:00:39 377000 -- (-1166.579) (-1167.103) (-1168.171) [-1169.907] * [-1166.766] (-1172.313) (-1168.391) (-1168.420) -- 0:00:39 377500 -- [-1166.244] (-1167.481) (-1169.817) (-1170.670) * (-1169.265) (-1168.576) [-1168.026] (-1171.564) -- 0:00:39 378000 -- (-1166.245) (-1167.633) [-1167.335] (-1168.828) * (-1168.625) (-1166.963) (-1180.888) [-1169.392] -- 0:00:39 378500 -- (-1170.559) [-1167.707] (-1168.935) (-1169.635) * (-1169.048) (-1168.063) [-1170.562] (-1166.608) -- 0:00:39 379000 -- [-1167.827] (-1167.837) (-1170.416) (-1168.511) * [-1168.157] (-1168.003) (-1175.280) (-1170.667) -- 0:00:39 379500 -- (-1170.930) (-1167.319) [-1170.577] (-1169.191) * (-1168.924) [-1167.604] (-1168.703) (-1170.300) -- 0:00:39 380000 -- (-1168.207) [-1167.468] (-1167.961) (-1167.911) * (-1169.892) (-1166.871) [-1167.211] (-1170.719) -- 0:00:39 Average standard deviation of split frequencies: 0.009761 380500 -- (-1167.808) [-1167.186] (-1171.883) (-1168.016) * (-1168.127) (-1169.050) [-1167.040] (-1168.042) -- 0:00:39 381000 -- (-1169.223) [-1169.217] (-1171.292) (-1167.719) * [-1168.234] (-1170.564) (-1168.049) (-1168.084) -- 0:00:38 381500 -- (-1172.669) (-1171.889) [-1166.949] (-1169.660) * (-1166.450) [-1169.003] (-1171.035) (-1169.406) -- 0:00:38 382000 -- (-1169.919) [-1169.576] (-1169.558) (-1169.355) * (-1169.176) (-1167.634) [-1168.675] (-1167.682) -- 0:00:38 382500 -- (-1167.561) (-1169.344) [-1168.304] (-1170.642) * [-1169.202] (-1167.749) (-1168.637) (-1168.898) -- 0:00:38 383000 -- (-1167.158) (-1167.033) [-1167.276] (-1167.019) * (-1168.468) (-1166.566) [-1169.921] (-1167.944) -- 0:00:38 383500 -- [-1169.022] (-1167.418) (-1168.070) (-1166.922) * [-1166.825] (-1166.737) (-1167.878) (-1168.948) -- 0:00:38 384000 -- (-1168.608) [-1167.394] (-1168.064) (-1171.804) * (-1165.963) [-1166.484] (-1169.372) (-1167.246) -- 0:00:38 384500 -- (-1168.299) (-1169.418) (-1174.345) [-1167.692] * (-1167.246) (-1168.913) [-1168.782] (-1166.717) -- 0:00:38 385000 -- (-1170.572) (-1168.557) (-1169.607) [-1168.967] * (-1172.700) (-1175.399) (-1170.164) [-1168.162] -- 0:00:38 Average standard deviation of split frequencies: 0.009483 385500 -- [-1168.835] (-1169.505) (-1173.130) (-1169.557) * [-1170.084] (-1170.166) (-1170.343) (-1168.156) -- 0:00:38 386000 -- (-1168.461) [-1170.065] (-1169.749) (-1167.444) * (-1169.218) (-1167.960) (-1169.860) [-1168.068] -- 0:00:38 386500 -- (-1172.082) [-1166.918] (-1167.744) (-1168.009) * [-1168.731] (-1169.615) (-1168.223) (-1168.771) -- 0:00:38 387000 -- [-1166.388] (-1168.601) (-1167.200) (-1171.843) * (-1169.629) (-1166.672) [-1167.724] (-1166.557) -- 0:00:38 387500 -- (-1169.140) [-1167.193] (-1171.715) (-1172.840) * [-1167.368] (-1167.746) (-1168.254) (-1167.632) -- 0:00:39 388000 -- (-1170.615) [-1169.086] (-1166.650) (-1173.234) * (-1167.659) (-1167.273) [-1166.529] (-1167.068) -- 0:00:39 388500 -- (-1169.600) [-1169.492] (-1168.691) (-1170.448) * [-1170.132] (-1169.447) (-1167.557) (-1167.663) -- 0:00:39 389000 -- [-1172.066] (-1169.663) (-1171.607) (-1168.146) * (-1166.565) [-1168.125] (-1170.736) (-1167.019) -- 0:00:39 389500 -- (-1169.207) (-1170.663) [-1168.125] (-1170.036) * (-1169.518) (-1168.991) (-1170.356) [-1166.420] -- 0:00:39 390000 -- (-1169.195) (-1169.289) [-1167.753] (-1170.724) * (-1166.947) (-1172.317) [-1166.155] (-1171.111) -- 0:00:39 Average standard deviation of split frequencies: 0.010634 390500 -- (-1169.423) (-1169.052) (-1167.390) [-1168.319] * [-1166.688] (-1168.891) (-1168.150) (-1171.079) -- 0:00:39 391000 -- (-1166.930) [-1168.910] (-1167.209) (-1167.376) * [-1166.758] (-1169.283) (-1170.493) (-1169.428) -- 0:00:38 391500 -- [-1166.930] (-1170.438) (-1167.186) (-1167.498) * [-1171.442] (-1169.424) (-1170.206) (-1169.017) -- 0:00:38 392000 -- (-1166.780) (-1168.935) [-1168.255] (-1167.513) * (-1166.762) [-1167.416] (-1170.593) (-1168.694) -- 0:00:38 392500 -- (-1169.083) (-1168.729) (-1167.936) [-1168.975] * [-1167.132] (-1166.789) (-1168.280) (-1168.090) -- 0:00:38 393000 -- (-1169.834) (-1167.506) (-1168.391) [-1168.645] * (-1166.388) (-1171.631) [-1171.048] (-1168.982) -- 0:00:38 393500 -- (-1168.003) [-1167.965] (-1167.074) (-1169.234) * [-1169.663] (-1170.853) (-1170.430) (-1168.479) -- 0:00:38 394000 -- (-1168.509) [-1171.547] (-1167.314) (-1166.752) * (-1168.145) (-1168.936) (-1169.615) [-1167.569] -- 0:00:38 394500 -- (-1170.271) (-1174.893) [-1167.456] (-1174.097) * (-1170.706) [-1174.444] (-1169.052) (-1170.767) -- 0:00:38 395000 -- [-1166.976] (-1173.986) (-1169.194) (-1174.745) * (-1168.644) [-1170.351] (-1170.047) (-1169.167) -- 0:00:38 Average standard deviation of split frequencies: 0.009747 395500 -- (-1166.890) (-1170.390) [-1169.889] (-1173.346) * (-1168.127) (-1168.919) (-1175.074) [-1167.682] -- 0:00:38 396000 -- [-1166.108] (-1168.518) (-1168.126) (-1173.782) * (-1166.617) [-1170.548] (-1167.768) (-1169.082) -- 0:00:38 396500 -- (-1169.137) (-1166.639) [-1168.279] (-1172.895) * (-1166.933) [-1166.643] (-1168.678) (-1167.404) -- 0:00:38 397000 -- [-1169.635] (-1168.377) (-1168.000) (-1172.293) * (-1167.724) (-1169.454) (-1168.145) [-1168.776] -- 0:00:37 397500 -- (-1169.779) (-1172.497) [-1168.400] (-1168.629) * (-1167.205) (-1172.938) [-1170.813] (-1172.190) -- 0:00:37 398000 -- (-1167.815) (-1170.458) [-1168.115] (-1169.184) * (-1168.542) [-1172.624] (-1170.517) (-1166.747) -- 0:00:37 398500 -- [-1169.354] (-1169.240) (-1167.084) (-1171.106) * (-1168.094) (-1169.750) (-1169.448) [-1166.417] -- 0:00:37 399000 -- (-1166.782) [-1168.799] (-1168.464) (-1166.718) * (-1170.239) (-1169.075) (-1166.423) [-1168.480] -- 0:00:37 399500 -- (-1166.503) [-1169.520] (-1169.946) (-1170.820) * (-1168.853) (-1176.352) [-1166.089] (-1167.765) -- 0:00:37 400000 -- (-1168.701) [-1167.847] (-1169.682) (-1168.480) * (-1166.191) [-1168.754] (-1170.132) (-1167.032) -- 0:00:37 Average standard deviation of split frequencies: 0.010515 400500 -- (-1169.031) (-1166.843) [-1168.282] (-1167.237) * (-1167.668) [-1169.128] (-1170.132) (-1168.877) -- 0:00:37 401000 -- (-1172.247) (-1172.191) (-1168.474) [-1168.031] * (-1168.152) (-1167.545) (-1166.460) [-1169.587] -- 0:00:38 401500 -- (-1171.474) (-1167.232) (-1169.212) [-1167.874] * (-1167.311) [-1167.892] (-1168.215) (-1168.400) -- 0:00:38 402000 -- (-1168.228) (-1169.772) (-1167.587) [-1167.612] * (-1166.360) (-1172.243) (-1172.562) [-1167.936] -- 0:00:38 402500 -- (-1168.167) (-1167.597) [-1168.512] (-1168.949) * (-1166.308) (-1170.536) [-1168.846] (-1170.206) -- 0:00:38 403000 -- [-1167.664] (-1172.231) (-1168.142) (-1167.051) * (-1167.458) (-1168.574) [-1168.646] (-1166.411) -- 0:00:38 403500 -- (-1169.665) (-1168.953) [-1167.479] (-1167.289) * (-1169.602) [-1172.822] (-1167.175) (-1166.665) -- 0:00:38 404000 -- (-1167.586) (-1168.032) (-1167.488) [-1169.720] * [-1167.062] (-1169.992) (-1166.923) (-1167.426) -- 0:00:38 404500 -- [-1170.627] (-1170.057) (-1167.501) (-1176.543) * [-1169.291] (-1166.327) (-1170.434) (-1168.227) -- 0:00:38 405000 -- (-1168.064) (-1169.676) [-1168.087] (-1168.485) * (-1168.400) (-1172.230) [-1169.963] (-1167.137) -- 0:00:38 Average standard deviation of split frequencies: 0.010377 405500 -- (-1166.762) (-1166.380) [-1167.490] (-1168.871) * (-1169.157) [-1166.977] (-1167.561) (-1174.398) -- 0:00:38 406000 -- (-1167.489) (-1168.775) [-1166.554] (-1170.473) * (-1168.803) (-1167.198) [-1170.803] (-1172.243) -- 0:00:38 406500 -- (-1167.126) (-1169.708) [-1167.345] (-1177.363) * (-1172.355) [-1168.095] (-1168.411) (-1170.201) -- 0:00:37 407000 -- (-1166.457) [-1168.486] (-1168.487) (-1175.932) * (-1170.869) (-1168.669) [-1170.152] (-1170.660) -- 0:00:37 407500 -- (-1166.324) [-1167.872] (-1175.845) (-1171.503) * (-1171.414) (-1167.784) [-1168.785] (-1170.137) -- 0:00:37 408000 -- [-1166.299] (-1167.986) (-1170.601) (-1169.206) * (-1172.899) (-1168.688) [-1170.972] (-1167.387) -- 0:00:37 408500 -- (-1167.586) [-1168.289] (-1169.867) (-1167.751) * (-1167.595) [-1168.391] (-1167.551) (-1172.236) -- 0:00:37 409000 -- (-1170.203) (-1168.001) [-1166.563] (-1167.768) * (-1171.451) (-1168.260) [-1168.731] (-1169.374) -- 0:00:37 409500 -- (-1169.316) (-1170.002) [-1166.981] (-1169.154) * (-1168.301) [-1168.782] (-1167.942) (-1166.686) -- 0:00:37 410000 -- [-1167.035] (-1168.420) (-1166.501) (-1171.150) * (-1170.406) (-1166.188) [-1167.459] (-1168.490) -- 0:00:37 Average standard deviation of split frequencies: 0.010618 410500 -- (-1167.639) (-1167.524) (-1167.479) [-1169.935] * (-1166.335) (-1166.618) [-1166.566] (-1167.325) -- 0:00:37 411000 -- (-1169.207) (-1168.374) (-1170.688) [-1167.796] * (-1172.392) (-1172.682) (-1169.170) [-1170.751] -- 0:00:37 411500 -- (-1166.754) (-1168.816) [-1172.836] (-1168.584) * (-1170.059) [-1167.755] (-1167.421) (-1167.474) -- 0:00:37 412000 -- (-1167.163) (-1170.892) (-1171.133) [-1166.636] * (-1168.124) (-1170.449) [-1169.300] (-1167.915) -- 0:00:37 412500 -- (-1168.922) [-1167.289] (-1167.454) (-1167.953) * (-1172.399) (-1167.718) [-1166.191] (-1166.969) -- 0:00:37 413000 -- (-1168.238) [-1168.214] (-1170.786) (-1167.776) * [-1169.541] (-1167.822) (-1167.381) (-1170.066) -- 0:00:36 413500 -- [-1169.836] (-1168.011) (-1168.942) (-1167.887) * (-1169.829) (-1169.599) (-1168.854) [-1168.258] -- 0:00:36 414000 -- [-1167.850] (-1169.122) (-1168.385) (-1167.821) * (-1172.247) [-1167.071] (-1171.254) (-1176.011) -- 0:00:36 414500 -- (-1170.722) (-1169.090) (-1170.974) [-1168.517] * (-1173.046) [-1167.286] (-1170.110) (-1175.392) -- 0:00:38 415000 -- (-1170.573) (-1169.402) (-1171.121) [-1168.055] * (-1174.195) [-1169.038] (-1170.431) (-1172.036) -- 0:00:38 Average standard deviation of split frequencies: 0.010482 415500 -- (-1170.155) (-1168.688) (-1170.196) [-1169.166] * (-1166.841) (-1169.780) (-1168.778) [-1170.395] -- 0:00:37 416000 -- (-1170.645) [-1166.956] (-1168.536) (-1169.127) * (-1168.095) (-1167.984) (-1168.402) [-1167.647] -- 0:00:37 416500 -- (-1170.550) (-1172.000) [-1172.626] (-1168.525) * [-1169.104] (-1170.214) (-1169.730) (-1168.484) -- 0:00:37 417000 -- (-1168.430) [-1170.585] (-1169.906) (-1169.696) * (-1168.136) [-1166.218] (-1169.183) (-1167.482) -- 0:00:37 417500 -- (-1169.364) (-1171.243) [-1168.866] (-1167.804) * (-1170.471) [-1167.273] (-1172.242) (-1167.647) -- 0:00:37 418000 -- (-1167.527) [-1168.850] (-1167.534) (-1167.599) * (-1170.446) [-1166.410] (-1173.149) (-1170.703) -- 0:00:37 418500 -- (-1168.515) [-1168.048] (-1167.234) (-1166.494) * (-1168.659) (-1169.091) [-1169.234] (-1169.676) -- 0:00:37 419000 -- (-1167.500) (-1167.018) (-1169.116) [-1166.852] * (-1166.327) (-1168.030) (-1168.278) [-1168.297] -- 0:00:37 419500 -- [-1173.290] (-1168.057) (-1167.829) (-1169.853) * (-1168.564) (-1171.981) (-1167.705) [-1169.262] -- 0:00:37 420000 -- [-1172.231] (-1167.686) (-1167.241) (-1172.170) * (-1168.986) (-1167.879) (-1166.281) [-1167.999] -- 0:00:37 Average standard deviation of split frequencies: 0.010576 420500 -- (-1171.967) [-1167.943] (-1169.323) (-1168.949) * (-1169.029) (-1166.637) (-1166.460) [-1168.173] -- 0:00:37 421000 -- (-1169.840) [-1166.709] (-1166.598) (-1169.743) * (-1169.885) (-1168.513) (-1166.460) [-1170.986] -- 0:00:37 421500 -- (-1168.187) (-1167.168) (-1168.150) [-1167.876] * (-1168.935) (-1176.461) [-1166.659] (-1169.393) -- 0:00:37 422000 -- (-1168.595) [-1167.233] (-1167.101) (-1167.489) * [-1168.215] (-1176.196) (-1167.535) (-1170.861) -- 0:00:36 422500 -- (-1170.123) [-1167.854] (-1170.797) (-1166.849) * (-1167.555) (-1171.661) [-1167.664] (-1169.683) -- 0:00:36 423000 -- (-1167.576) [-1168.270] (-1172.258) (-1169.399) * [-1167.926] (-1173.276) (-1167.070) (-1166.946) -- 0:00:36 423500 -- (-1168.415) (-1168.106) (-1171.642) [-1169.772] * (-1167.468) (-1169.253) (-1166.728) [-1167.056] -- 0:00:36 424000 -- [-1166.448] (-1169.173) (-1168.904) (-1166.829) * (-1167.220) [-1170.176] (-1167.470) (-1167.249) -- 0:00:36 424500 -- (-1166.892) [-1169.844] (-1166.598) (-1170.607) * (-1171.496) [-1167.826] (-1169.690) (-1170.213) -- 0:00:36 425000 -- (-1167.479) [-1169.363] (-1170.231) (-1166.101) * [-1168.674] (-1168.756) (-1168.276) (-1169.875) -- 0:00:36 Average standard deviation of split frequencies: 0.010236 425500 -- [-1167.479] (-1169.775) (-1171.160) (-1167.208) * (-1168.913) (-1168.410) [-1167.988] (-1173.516) -- 0:00:36 426000 -- (-1167.457) (-1167.456) [-1167.644] (-1166.843) * (-1167.828) [-1167.002] (-1167.413) (-1173.544) -- 0:00:36 426500 -- [-1169.714] (-1168.323) (-1168.435) (-1167.295) * (-1168.835) (-1169.022) (-1168.948) [-1168.802] -- 0:00:36 427000 -- (-1168.735) (-1170.331) (-1167.761) [-1167.385] * (-1169.552) (-1168.405) [-1167.764] (-1171.201) -- 0:00:36 427500 -- [-1166.552] (-1166.496) (-1171.073) (-1168.436) * [-1167.087] (-1167.460) (-1167.738) (-1166.985) -- 0:00:36 428000 -- [-1166.948] (-1168.731) (-1173.182) (-1170.235) * (-1167.614) (-1169.078) [-1170.628] (-1169.621) -- 0:00:36 428500 -- (-1167.792) (-1168.887) [-1168.572] (-1171.284) * (-1167.711) (-1168.195) [-1166.684] (-1170.809) -- 0:00:36 429000 -- (-1167.182) [-1167.436] (-1169.420) (-1171.830) * (-1168.189) (-1172.148) [-1167.806] (-1171.228) -- 0:00:35 429500 -- [-1167.781] (-1169.205) (-1167.320) (-1168.640) * (-1168.689) [-1170.112] (-1170.963) (-1167.242) -- 0:00:35 430000 -- [-1167.379] (-1172.603) (-1167.667) (-1169.472) * (-1167.823) [-1169.065] (-1174.946) (-1169.089) -- 0:00:37 Average standard deviation of split frequencies: 0.010399 430500 -- (-1167.210) (-1173.398) (-1169.841) [-1169.587] * (-1170.403) (-1168.317) [-1167.119] (-1169.222) -- 0:00:37 431000 -- (-1167.586) (-1172.000) [-1167.428] (-1168.249) * (-1171.029) (-1168.250) (-1166.993) [-1167.807] -- 0:00:36 431500 -- (-1171.462) [-1169.204] (-1168.717) (-1166.778) * (-1167.442) (-1168.031) (-1167.168) [-1168.979] -- 0:00:36 432000 -- (-1171.196) [-1166.352] (-1167.491) (-1166.639) * (-1169.031) (-1168.734) [-1166.871] (-1170.988) -- 0:00:36 432500 -- (-1173.394) [-1169.198] (-1168.076) (-1167.774) * (-1169.044) (-1168.108) (-1171.906) [-1167.828] -- 0:00:36 433000 -- (-1168.925) (-1168.510) [-1169.764] (-1167.790) * [-1168.221] (-1167.810) (-1168.081) (-1166.729) -- 0:00:36 433500 -- (-1168.011) [-1166.993] (-1168.500) (-1167.723) * (-1167.785) [-1167.942] (-1168.601) (-1167.026) -- 0:00:36 434000 -- (-1166.983) [-1168.381] (-1168.742) (-1169.449) * (-1166.828) [-1171.260] (-1169.376) (-1168.728) -- 0:00:36 434500 -- (-1168.918) (-1170.781) (-1169.777) [-1169.220] * (-1168.758) [-1167.579] (-1167.004) (-1171.710) -- 0:00:36 435000 -- (-1169.885) (-1170.320) (-1168.265) [-1169.462] * (-1167.290) (-1167.293) (-1167.871) [-1168.072] -- 0:00:36 Average standard deviation of split frequencies: 0.009934 435500 -- [-1170.300] (-1169.673) (-1167.586) (-1168.024) * [-1167.199] (-1167.539) (-1167.435) (-1167.823) -- 0:00:36 436000 -- [-1169.132] (-1168.153) (-1168.455) (-1167.432) * (-1168.045) (-1168.434) (-1167.317) [-1166.729] -- 0:00:36 436500 -- (-1167.137) [-1168.531] (-1167.348) (-1169.371) * (-1168.728) (-1167.495) (-1167.085) [-1167.386] -- 0:00:36 437000 -- (-1168.979) [-1168.909] (-1168.767) (-1174.908) * (-1166.315) (-1167.400) (-1167.610) [-1167.733] -- 0:00:36 437500 -- (-1167.102) (-1171.149) [-1172.049] (-1166.205) * (-1167.728) [-1167.597] (-1172.784) (-1166.760) -- 0:00:36 438000 -- [-1167.933] (-1167.443) (-1171.823) (-1167.551) * (-1168.057) [-1169.771] (-1167.213) (-1167.473) -- 0:00:35 438500 -- (-1170.301) (-1166.892) [-1166.784] (-1166.829) * (-1165.906) (-1168.742) [-1166.002] (-1166.681) -- 0:00:35 439000 -- [-1167.358] (-1168.308) (-1166.527) (-1167.161) * (-1170.100) [-1169.182] (-1167.396) (-1166.798) -- 0:00:35 439500 -- [-1166.859] (-1166.473) (-1166.824) (-1169.710) * [-1169.470] (-1168.591) (-1167.468) (-1167.640) -- 0:00:35 440000 -- (-1167.772) (-1167.647) [-1167.934] (-1167.876) * (-1168.756) (-1169.653) [-1166.499] (-1167.200) -- 0:00:35 Average standard deviation of split frequencies: 0.009271 440500 -- (-1172.601) (-1167.069) [-1168.341] (-1169.935) * (-1169.634) [-1169.769] (-1167.081) (-1167.617) -- 0:00:35 441000 -- (-1168.112) (-1168.992) (-1167.495) [-1170.262] * (-1167.137) (-1169.412) [-1166.314] (-1169.354) -- 0:00:35 441500 -- [-1168.393] (-1169.829) (-1170.747) (-1168.754) * (-1167.016) [-1169.756] (-1168.389) (-1173.508) -- 0:00:35 442000 -- [-1168.058] (-1168.788) (-1169.544) (-1170.781) * (-1166.294) [-1169.270] (-1167.595) (-1169.459) -- 0:00:35 442500 -- (-1166.869) (-1170.163) (-1173.351) [-1168.437] * [-1167.422] (-1168.733) (-1168.257) (-1167.878) -- 0:00:35 443000 -- (-1168.579) (-1170.110) (-1169.159) [-1168.654] * [-1169.937] (-1167.203) (-1168.333) (-1171.641) -- 0:00:35 443500 -- (-1168.168) (-1167.568) [-1166.801] (-1166.726) * [-1166.526] (-1167.457) (-1168.423) (-1167.257) -- 0:00:35 444000 -- (-1169.302) (-1167.230) (-1169.071) [-1167.278] * (-1167.323) (-1166.711) (-1168.584) [-1168.710] -- 0:00:35 444500 -- (-1168.297) [-1166.815] (-1170.855) (-1167.019) * (-1166.655) [-1166.336] (-1169.742) (-1169.919) -- 0:00:34 445000 -- [-1166.287] (-1170.403) (-1168.204) (-1169.374) * (-1166.904) [-1166.828] (-1170.458) (-1169.579) -- 0:00:34 Average standard deviation of split frequencies: 0.009777 445500 -- (-1168.049) (-1167.195) (-1170.020) [-1167.038] * [-1167.015] (-1172.924) (-1169.682) (-1172.795) -- 0:00:34 446000 -- (-1167.500) [-1168.621] (-1169.758) (-1167.697) * (-1167.333) (-1170.417) (-1171.973) [-1167.338] -- 0:00:36 446500 -- (-1166.534) (-1168.228) [-1168.902] (-1166.674) * (-1169.167) [-1170.913] (-1168.741) (-1167.657) -- 0:00:35 447000 -- (-1167.294) [-1166.741] (-1172.663) (-1167.006) * (-1170.866) [-1171.963] (-1168.682) (-1168.560) -- 0:00:35 447500 -- (-1167.268) [-1168.636] (-1170.027) (-1168.356) * (-1171.233) [-1167.829] (-1168.413) (-1168.125) -- 0:00:35 448000 -- [-1167.363] (-1166.660) (-1169.999) (-1172.270) * [-1169.253] (-1166.777) (-1174.248) (-1166.813) -- 0:00:35 448500 -- (-1169.466) [-1166.566] (-1171.788) (-1167.934) * (-1166.994) [-1171.681] (-1171.456) (-1167.290) -- 0:00:35 449000 -- (-1167.084) (-1167.066) [-1171.213] (-1168.215) * (-1168.054) [-1166.718] (-1168.410) (-1169.690) -- 0:00:35 449500 -- (-1168.894) [-1167.465] (-1170.007) (-1169.684) * (-1168.631) (-1169.437) [-1168.888] (-1173.864) -- 0:00:35 450000 -- [-1166.866] (-1171.041) (-1170.737) (-1166.341) * (-1169.370) [-1169.339] (-1168.509) (-1170.059) -- 0:00:35 Average standard deviation of split frequencies: 0.009476 450500 -- (-1172.733) [-1168.181] (-1169.092) (-1167.884) * (-1169.715) (-1173.046) (-1167.338) [-1169.799] -- 0:00:35 451000 -- (-1173.670) [-1166.951] (-1167.689) (-1173.655) * (-1170.302) [-1170.955] (-1167.229) (-1170.021) -- 0:00:35 451500 -- [-1172.746] (-1167.362) (-1169.079) (-1170.942) * [-1168.240] (-1167.030) (-1170.880) (-1169.145) -- 0:00:35 452000 -- [-1167.172] (-1167.915) (-1166.855) (-1171.568) * (-1170.414) (-1168.093) [-1169.436] (-1167.138) -- 0:00:35 452500 -- [-1166.853] (-1168.673) (-1167.663) (-1173.035) * [-1168.681] (-1167.243) (-1166.510) (-1167.555) -- 0:00:35 453000 -- (-1166.819) (-1169.503) [-1166.922] (-1173.149) * (-1170.567) (-1166.584) [-1170.924] (-1167.547) -- 0:00:35 453500 -- (-1167.374) (-1168.498) [-1167.770] (-1170.139) * (-1172.927) (-1169.693) (-1169.220) [-1167.317] -- 0:00:34 454000 -- (-1171.577) [-1167.747] (-1168.243) (-1170.397) * (-1170.418) [-1167.615] (-1167.305) (-1169.294) -- 0:00:34 454500 -- (-1169.663) [-1167.129] (-1167.695) (-1166.781) * (-1168.853) [-1167.797] (-1171.085) (-1167.693) -- 0:00:34 455000 -- [-1167.372] (-1166.929) (-1168.579) (-1170.095) * (-1169.886) [-1167.650] (-1166.323) (-1167.352) -- 0:00:34 Average standard deviation of split frequencies: 0.009243 455500 -- [-1167.635] (-1166.052) (-1166.839) (-1168.051) * (-1169.717) [-1168.255] (-1171.251) (-1170.862) -- 0:00:34 456000 -- [-1167.171] (-1166.052) (-1167.100) (-1167.230) * (-1170.109) (-1168.713) [-1170.004] (-1169.480) -- 0:00:34 456500 -- (-1168.218) (-1167.354) [-1167.935] (-1173.078) * (-1167.026) (-1169.239) (-1169.867) [-1167.241] -- 0:00:34 457000 -- (-1167.381) [-1167.904] (-1167.087) (-1167.199) * (-1168.281) [-1167.156] (-1168.552) (-1169.416) -- 0:00:34 457500 -- (-1168.089) (-1169.477) [-1167.022] (-1169.822) * (-1171.653) [-1166.889] (-1168.370) (-1168.358) -- 0:00:34 458000 -- [-1166.694] (-1166.849) (-1166.242) (-1169.012) * (-1171.852) (-1167.905) (-1167.482) [-1170.051] -- 0:00:34 458500 -- (-1175.446) (-1169.670) [-1165.972] (-1169.039) * (-1168.257) [-1167.656] (-1167.680) (-1169.976) -- 0:00:34 459000 -- (-1167.035) (-1170.389) [-1167.709] (-1169.289) * (-1167.939) (-1168.441) (-1170.081) [-1167.630] -- 0:00:34 459500 -- (-1174.491) (-1169.154) (-1170.127) [-1171.253] * [-1168.063] (-1167.922) (-1169.947) (-1168.763) -- 0:00:34 460000 -- (-1167.307) [-1167.811] (-1168.824) (-1169.057) * (-1168.910) (-1168.527) [-1167.544] (-1169.437) -- 0:00:34 Average standard deviation of split frequencies: 0.009402 460500 -- [-1168.498] (-1166.617) (-1167.665) (-1167.351) * (-1173.124) (-1169.048) [-1169.406] (-1168.259) -- 0:00:33 461000 -- (-1168.810) [-1166.455] (-1171.002) (-1174.598) * [-1168.469] (-1167.967) (-1167.543) (-1167.351) -- 0:00:33 461500 -- (-1167.897) (-1166.341) (-1169.218) [-1168.155] * [-1173.990] (-1171.070) (-1170.056) (-1167.380) -- 0:00:33 462000 -- (-1169.447) [-1167.196] (-1169.713) (-1168.067) * [-1169.434] (-1168.077) (-1168.887) (-1168.262) -- 0:00:33 462500 -- (-1168.870) (-1170.122) [-1168.001] (-1169.922) * [-1169.384] (-1166.706) (-1172.696) (-1170.492) -- 0:00:34 463000 -- (-1168.251) [-1170.501] (-1169.562) (-1166.472) * (-1170.638) (-1166.975) (-1169.469) [-1166.562] -- 0:00:34 463500 -- (-1172.137) (-1174.541) (-1166.603) [-1168.688] * (-1171.767) [-1166.567] (-1169.417) (-1166.929) -- 0:00:34 464000 -- [-1171.287] (-1172.059) (-1166.521) (-1169.537) * (-1168.855) [-1167.320] (-1169.654) (-1167.234) -- 0:00:34 464500 -- [-1168.711] (-1167.808) (-1168.468) (-1169.639) * (-1167.243) [-1168.205] (-1167.782) (-1169.660) -- 0:00:34 465000 -- (-1168.550) [-1168.166] (-1170.492) (-1169.788) * (-1167.626) [-1168.043] (-1167.554) (-1167.074) -- 0:00:34 Average standard deviation of split frequencies: 0.009800 465500 -- (-1168.135) (-1167.100) (-1168.580) [-1166.290] * [-1166.759] (-1169.197) (-1168.725) (-1169.893) -- 0:00:34 466000 -- [-1173.767] (-1166.292) (-1167.794) (-1166.713) * (-1172.315) (-1166.929) (-1168.315) [-1170.668] -- 0:00:34 466500 -- [-1168.332] (-1170.035) (-1168.313) (-1167.465) * (-1169.408) [-1166.399] (-1173.259) (-1169.863) -- 0:00:34 467000 -- [-1167.766] (-1169.486) (-1169.267) (-1169.705) * (-1168.374) [-1167.859] (-1170.486) (-1169.675) -- 0:00:34 467500 -- (-1168.290) (-1169.541) (-1166.830) [-1168.894] * (-1166.345) (-1167.905) [-1170.470] (-1167.079) -- 0:00:34 468000 -- (-1168.073) [-1168.964] (-1167.170) (-1176.270) * (-1167.043) (-1166.689) (-1167.733) [-1168.093] -- 0:00:34 468500 -- (-1168.788) (-1167.347) [-1167.494] (-1173.453) * (-1167.238) [-1168.763] (-1168.439) (-1168.021) -- 0:00:34 469000 -- (-1168.605) (-1167.641) [-1168.705] (-1168.843) * (-1169.472) (-1167.652) [-1166.173] (-1168.948) -- 0:00:33 469500 -- (-1167.275) (-1171.329) (-1167.994) [-1167.257] * (-1167.519) [-1167.581] (-1168.815) (-1166.414) -- 0:00:33 470000 -- (-1168.818) [-1169.184] (-1167.749) (-1167.026) * [-1169.719] (-1167.654) (-1168.031) (-1169.703) -- 0:00:33 Average standard deviation of split frequencies: 0.009390 470500 -- (-1170.543) (-1172.329) (-1169.071) [-1168.179] * [-1167.116] (-1168.688) (-1167.897) (-1167.618) -- 0:00:33 471000 -- (-1167.946) (-1167.078) [-1168.369] (-1168.625) * [-1166.040] (-1173.728) (-1168.173) (-1167.214) -- 0:00:33 471500 -- (-1167.878) (-1167.406) (-1168.228) [-1167.769] * [-1166.040] (-1171.230) (-1168.533) (-1168.363) -- 0:00:33 472000 -- (-1167.706) (-1166.674) [-1170.138] (-1168.480) * (-1166.276) (-1167.920) [-1166.929] (-1166.935) -- 0:00:33 472500 -- (-1172.229) (-1168.251) (-1167.921) [-1167.862] * (-1169.269) (-1167.415) [-1169.917] (-1167.364) -- 0:00:33 473000 -- (-1166.594) (-1169.427) [-1168.718] (-1171.678) * (-1170.153) [-1167.414] (-1167.255) (-1166.828) -- 0:00:33 473500 -- [-1168.116] (-1168.099) (-1169.814) (-1170.730) * (-1168.974) (-1168.003) [-1166.919] (-1168.217) -- 0:00:33 474000 -- (-1168.338) [-1167.919] (-1168.523) (-1169.647) * (-1169.559) (-1167.002) (-1167.260) [-1168.828] -- 0:00:33 474500 -- [-1169.642] (-1169.763) (-1170.836) (-1172.225) * [-1167.437] (-1167.693) (-1168.219) (-1167.775) -- 0:00:33 475000 -- (-1172.663) [-1168.075] (-1168.644) (-1170.882) * [-1167.949] (-1167.975) (-1168.457) (-1170.062) -- 0:00:33 Average standard deviation of split frequencies: 0.009346 475500 -- (-1170.430) (-1169.287) [-1166.697] (-1168.510) * (-1167.876) (-1169.090) (-1168.668) [-1171.660] -- 0:00:33 476000 -- [-1171.209] (-1166.971) (-1167.284) (-1170.872) * [-1167.062] (-1168.105) (-1166.966) (-1170.210) -- 0:00:33 476500 -- (-1168.714) [-1167.709] (-1168.517) (-1171.423) * (-1167.073) (-1168.821) [-1168.243] (-1171.764) -- 0:00:32 477000 -- (-1167.799) (-1169.643) [-1167.463] (-1172.389) * [-1168.975] (-1168.243) (-1167.897) (-1168.169) -- 0:00:32 477500 -- [-1167.394] (-1166.836) (-1167.279) (-1169.337) * (-1166.738) (-1169.839) (-1171.407) [-1170.469] -- 0:00:33 478000 -- (-1171.238) (-1167.171) [-1168.358] (-1167.618) * (-1167.054) (-1172.958) (-1166.783) [-1171.579] -- 0:00:33 478500 -- (-1168.946) [-1166.426] (-1168.794) (-1167.329) * (-1167.124) (-1169.829) (-1170.192) [-1168.238] -- 0:00:33 479000 -- (-1166.773) (-1167.476) (-1170.219) [-1166.929] * (-1167.415) (-1169.085) [-1167.097] (-1166.560) -- 0:00:33 479500 -- (-1166.644) [-1168.923] (-1171.047) (-1168.663) * (-1170.861) [-1170.101] (-1168.275) (-1166.648) -- 0:00:33 480000 -- (-1167.013) (-1168.185) [-1167.303] (-1168.446) * (-1168.089) (-1169.946) (-1166.778) [-1167.290] -- 0:00:33 Average standard deviation of split frequencies: 0.009623 480500 -- (-1169.001) [-1168.618] (-1168.674) (-1168.152) * [-1166.473] (-1168.359) (-1167.145) (-1169.388) -- 0:00:33 481000 -- [-1169.670] (-1169.367) (-1167.946) (-1172.236) * (-1169.638) (-1167.162) (-1168.261) [-1167.423] -- 0:00:33 481500 -- (-1171.575) (-1166.911) [-1168.698] (-1169.317) * [-1168.938] (-1169.654) (-1168.215) (-1173.069) -- 0:00:33 482000 -- (-1172.793) (-1169.122) [-1167.044] (-1167.291) * (-1170.232) (-1166.982) [-1169.842] (-1169.097) -- 0:00:33 482500 -- (-1177.396) [-1167.715] (-1169.247) (-1168.171) * [-1168.552] (-1168.197) (-1174.032) (-1171.498) -- 0:00:33 483000 -- [-1170.530] (-1166.123) (-1168.695) (-1169.090) * [-1166.069] (-1167.646) (-1166.304) (-1171.139) -- 0:00:33 483500 -- [-1168.234] (-1166.399) (-1167.267) (-1167.485) * (-1167.001) (-1171.581) [-1169.428] (-1166.739) -- 0:00:33 484000 -- [-1166.488] (-1167.358) (-1168.729) (-1166.476) * (-1169.374) (-1168.467) (-1168.157) [-1166.986] -- 0:00:33 484500 -- (-1168.090) [-1167.284] (-1170.490) (-1168.511) * [-1170.923] (-1169.295) (-1171.009) (-1171.033) -- 0:00:32 485000 -- [-1167.098] (-1168.797) (-1169.595) (-1168.153) * [-1166.335] (-1168.109) (-1169.399) (-1174.714) -- 0:00:32 Average standard deviation of split frequencies: 0.009357 485500 -- [-1168.842] (-1169.080) (-1168.643) (-1167.813) * [-1168.822] (-1168.833) (-1169.762) (-1168.568) -- 0:00:32 486000 -- (-1166.801) [-1167.221] (-1168.613) (-1168.304) * [-1166.164] (-1167.959) (-1167.867) (-1168.070) -- 0:00:32 486500 -- [-1167.359] (-1167.286) (-1168.943) (-1167.655) * (-1167.377) (-1166.268) (-1167.100) [-1170.473] -- 0:00:32 487000 -- (-1167.179) [-1169.434] (-1167.379) (-1166.044) * (-1167.749) (-1169.761) [-1166.705] (-1175.926) -- 0:00:32 487500 -- (-1167.895) (-1169.569) (-1168.375) [-1168.543] * (-1169.155) (-1168.165) [-1167.877] (-1171.555) -- 0:00:32 488000 -- (-1166.319) (-1167.384) (-1168.467) [-1171.327] * [-1168.907] (-1169.258) (-1168.274) (-1167.930) -- 0:00:32 488500 -- (-1167.888) [-1167.106] (-1169.990) (-1172.802) * (-1168.472) (-1168.636) (-1168.255) [-1167.186] -- 0:00:32 489000 -- (-1169.605) (-1168.860) (-1167.911) [-1167.375] * [-1172.651] (-1167.074) (-1168.906) (-1171.622) -- 0:00:32 489500 -- (-1168.900) [-1168.538] (-1171.663) (-1167.358) * [-1169.321] (-1168.178) (-1172.158) (-1170.291) -- 0:00:32 490000 -- (-1169.028) [-1168.314] (-1175.533) (-1166.518) * (-1173.825) (-1166.764) (-1167.726) [-1167.496] -- 0:00:32 Average standard deviation of split frequencies: 0.009067 490500 -- [-1168.860] (-1169.745) (-1167.947) (-1166.443) * (-1168.143) [-1166.521] (-1167.174) (-1167.570) -- 0:00:32 491000 -- (-1172.561) (-1169.351) (-1167.550) [-1167.493] * (-1172.495) [-1171.944] (-1169.060) (-1168.806) -- 0:00:32 491500 -- (-1168.386) (-1169.879) (-1167.785) [-1167.755] * (-1166.917) (-1178.686) (-1167.834) [-1166.638] -- 0:00:32 492000 -- (-1168.952) (-1169.872) (-1168.034) [-1169.462] * [-1167.936] (-1174.906) (-1166.679) (-1166.721) -- 0:00:32 492500 -- (-1167.067) [-1167.846] (-1169.340) (-1166.318) * (-1167.156) (-1169.870) (-1168.074) [-1167.636] -- 0:00:31 493000 -- (-1168.357) [-1173.924] (-1175.748) (-1166.792) * (-1168.924) (-1168.181) (-1166.836) [-1166.838] -- 0:00:32 493500 -- (-1166.936) (-1169.966) [-1171.104] (-1167.575) * [-1167.683] (-1169.500) (-1169.809) (-1170.397) -- 0:00:32 494000 -- [-1167.716] (-1169.892) (-1167.596) (-1168.302) * (-1166.586) [-1166.557] (-1168.138) (-1168.025) -- 0:00:32 494500 -- (-1168.051) (-1168.612) [-1168.272] (-1168.492) * (-1167.143) (-1171.428) [-1166.603] (-1167.510) -- 0:00:32 495000 -- (-1168.304) (-1166.953) (-1168.209) [-1168.350] * (-1167.072) (-1174.197) [-1167.461] (-1168.530) -- 0:00:32 Average standard deviation of split frequencies: 0.009225 495500 -- (-1167.153) [-1167.502] (-1170.378) (-1167.859) * (-1168.298) (-1168.341) (-1168.338) [-1167.168] -- 0:00:32 496000 -- (-1168.389) [-1167.588] (-1169.520) (-1169.818) * (-1166.437) (-1167.528) (-1171.810) [-1170.823] -- 0:00:32 496500 -- [-1170.675] (-1170.079) (-1170.054) (-1168.541) * (-1166.801) [-1167.476] (-1171.804) (-1167.858) -- 0:00:32 497000 -- (-1169.778) [-1171.597] (-1169.298) (-1168.176) * (-1166.889) [-1167.455] (-1170.143) (-1170.499) -- 0:00:32 497500 -- (-1169.178) [-1169.718] (-1169.004) (-1166.464) * [-1167.122] (-1168.020) (-1170.943) (-1167.016) -- 0:00:32 498000 -- [-1168.479] (-1170.133) (-1168.732) (-1166.978) * (-1168.535) [-1167.665] (-1167.437) (-1168.270) -- 0:00:32 498500 -- (-1167.754) (-1169.033) [-1167.575] (-1168.106) * [-1168.931] (-1171.459) (-1168.606) (-1168.599) -- 0:00:32 499000 -- [-1167.534] (-1167.006) (-1168.168) (-1175.820) * [-1166.915] (-1167.226) (-1167.872) (-1169.022) -- 0:00:32 499500 -- (-1167.451) (-1167.494) [-1167.271] (-1169.183) * [-1166.159] (-1166.437) (-1168.335) (-1167.301) -- 0:00:32 500000 -- (-1167.407) [-1166.904] (-1168.048) (-1167.056) * (-1166.159) [-1167.874] (-1168.803) (-1170.122) -- 0:00:32 Average standard deviation of split frequencies: 0.008827 500500 -- [-1167.415] (-1169.228) (-1169.138) (-1167.489) * (-1166.159) (-1168.680) [-1167.301] (-1172.536) -- 0:00:31 501000 -- (-1167.180) [-1167.273] (-1170.767) (-1168.322) * (-1166.353) (-1169.406) (-1167.479) [-1171.302] -- 0:00:31 501500 -- (-1167.979) (-1167.546) (-1168.820) [-1167.487] * (-1166.925) (-1172.455) (-1166.917) [-1168.291] -- 0:00:31 502000 -- (-1170.717) (-1167.669) (-1168.600) [-1170.050] * (-1166.094) (-1171.844) [-1167.649] (-1170.228) -- 0:00:31 502500 -- [-1169.996] (-1169.197) (-1170.339) (-1168.942) * [-1166.892] (-1169.463) (-1167.083) (-1174.559) -- 0:00:31 503000 -- (-1169.963) (-1166.597) (-1167.871) [-1169.990] * (-1167.440) (-1170.624) (-1167.391) [-1173.799] -- 0:00:31 503500 -- (-1169.053) (-1167.339) (-1168.870) [-1169.864] * (-1169.515) [-1168.887] (-1167.832) (-1168.285) -- 0:00:31 504000 -- (-1167.932) (-1166.944) [-1167.978] (-1167.185) * [-1167.930] (-1168.428) (-1169.801) (-1167.438) -- 0:00:31 504500 -- (-1168.554) (-1167.830) [-1169.190] (-1168.239) * (-1167.631) (-1169.353) (-1171.862) [-1168.549] -- 0:00:31 505000 -- (-1170.344) [-1171.906] (-1167.302) (-1169.404) * (-1167.420) (-1166.693) (-1169.977) [-1168.741] -- 0:00:31 Average standard deviation of split frequencies: 0.009207 505500 -- (-1169.083) (-1168.246) [-1168.236] (-1168.088) * (-1168.518) (-1166.388) (-1167.435) [-1168.418] -- 0:00:31 506000 -- (-1169.105) (-1167.585) [-1168.918] (-1168.776) * (-1166.638) (-1166.886) [-1167.587] (-1167.075) -- 0:00:31 506500 -- (-1167.892) [-1170.616] (-1167.851) (-1166.881) * (-1169.293) (-1166.624) [-1168.170] (-1168.154) -- 0:00:31 507000 -- (-1168.041) (-1169.270) [-1167.274] (-1167.676) * [-1168.596] (-1166.091) (-1168.511) (-1169.049) -- 0:00:31 507500 -- (-1168.404) (-1168.825) (-1167.846) [-1167.300] * [-1170.723] (-1166.908) (-1166.353) (-1168.484) -- 0:00:31 508000 -- (-1168.213) [-1167.672] (-1167.798) (-1169.888) * (-1172.578) (-1166.479) (-1166.577) [-1167.763] -- 0:00:30 508500 -- (-1168.391) (-1168.578) [-1167.340] (-1168.032) * (-1169.908) (-1172.143) [-1166.628] (-1166.933) -- 0:00:30 509000 -- (-1168.227) [-1173.521] (-1169.855) (-1168.641) * (-1167.715) [-1172.713] (-1166.273) (-1167.578) -- 0:00:31 509500 -- (-1168.102) (-1170.856) (-1167.589) [-1166.902] * (-1173.340) (-1169.541) (-1166.442) [-1168.220] -- 0:00:31 510000 -- (-1172.995) (-1166.654) (-1169.397) [-1166.670] * [-1168.902] (-1169.059) (-1167.335) (-1171.145) -- 0:00:31 Average standard deviation of split frequencies: 0.009666 510500 -- (-1169.681) (-1168.292) (-1167.737) [-1167.859] * (-1168.934) (-1170.012) [-1166.802] (-1166.790) -- 0:00:31 511000 -- (-1169.616) (-1168.291) (-1168.298) [-1169.035] * (-1166.247) (-1168.413) (-1170.997) [-1168.893] -- 0:00:31 511500 -- (-1173.360) [-1168.125] (-1167.869) (-1169.521) * (-1171.496) (-1169.405) [-1168.162] (-1167.984) -- 0:00:31 512000 -- [-1167.579] (-1166.900) (-1168.490) (-1170.395) * [-1170.914] (-1171.687) (-1166.846) (-1166.360) -- 0:00:31 512500 -- (-1167.915) (-1166.580) [-1168.147] (-1168.298) * (-1167.847) (-1168.934) [-1168.956] (-1166.557) -- 0:00:31 513000 -- (-1169.251) [-1166.906] (-1168.129) (-1170.776) * (-1171.697) [-1168.164] (-1168.175) (-1166.407) -- 0:00:31 513500 -- [-1172.045] (-1167.950) (-1167.766) (-1167.726) * (-1166.866) (-1167.160) (-1169.812) [-1166.628] -- 0:00:31 514000 -- (-1171.586) [-1167.134] (-1167.298) (-1167.562) * (-1166.936) (-1168.667) [-1166.175] (-1167.162) -- 0:00:31 514500 -- (-1166.348) [-1166.904] (-1173.575) (-1170.475) * (-1167.717) [-1166.870] (-1166.617) (-1171.535) -- 0:00:31 515000 -- (-1170.891) [-1167.379] (-1183.717) (-1169.239) * (-1170.210) [-1167.267] (-1170.590) (-1171.522) -- 0:00:31 Average standard deviation of split frequencies: 0.009684 515500 -- (-1172.910) (-1167.255) [-1168.079] (-1167.655) * (-1168.981) [-1166.281] (-1169.650) (-1167.524) -- 0:00:31 516000 -- (-1172.016) (-1167.112) (-1167.416) [-1167.465] * (-1170.116) (-1166.285) [-1168.640] (-1167.600) -- 0:00:30 516500 -- (-1167.196) (-1166.712) [-1169.014] (-1167.825) * (-1169.927) (-1167.528) [-1166.960] (-1169.666) -- 0:00:30 517000 -- (-1167.655) (-1166.627) (-1167.898) [-1166.824] * (-1169.119) (-1167.523) [-1173.592] (-1167.172) -- 0:00:30 517500 -- (-1167.021) [-1167.632] (-1169.059) (-1166.958) * (-1168.366) [-1166.729] (-1166.475) (-1166.202) -- 0:00:30 518000 -- (-1168.147) (-1168.252) [-1168.982] (-1167.058) * [-1166.727] (-1168.619) (-1166.648) (-1169.185) -- 0:00:30 518500 -- (-1166.357) (-1171.999) (-1169.594) [-1168.197] * (-1170.129) [-1170.638] (-1169.594) (-1167.760) -- 0:00:30 519000 -- (-1166.364) [-1166.316] (-1172.239) (-1168.343) * (-1168.828) (-1168.741) [-1168.756] (-1168.995) -- 0:00:30 519500 -- (-1168.829) [-1166.468] (-1174.486) (-1168.325) * (-1169.341) (-1168.334) (-1166.926) [-1168.137] -- 0:00:30 520000 -- (-1166.499) (-1167.701) [-1171.858] (-1169.797) * (-1167.956) (-1166.431) (-1167.141) [-1169.875] -- 0:00:30 Average standard deviation of split frequencies: 0.009356 520500 -- (-1167.802) [-1169.411] (-1171.050) (-1166.381) * [-1167.617] (-1166.960) (-1168.534) (-1170.633) -- 0:00:30 521000 -- (-1166.458) [-1170.741] (-1170.962) (-1167.217) * [-1170.506] (-1166.516) (-1167.704) (-1167.296) -- 0:00:30 521500 -- (-1168.519) (-1169.471) (-1169.884) [-1170.476] * (-1169.550) [-1172.369] (-1168.455) (-1167.474) -- 0:00:30 522000 -- (-1167.547) (-1168.596) [-1167.523] (-1173.353) * (-1168.364) [-1167.906] (-1169.011) (-1168.099) -- 0:00:30 522500 -- (-1166.054) [-1167.447] (-1170.984) (-1171.203) * [-1167.179] (-1167.781) (-1168.737) (-1170.644) -- 0:00:30 523000 -- (-1166.254) (-1166.489) [-1174.591] (-1168.147) * (-1173.196) (-1168.934) (-1169.770) [-1170.350] -- 0:00:30 523500 -- [-1166.655] (-1166.688) (-1166.287) (-1170.603) * (-1167.050) (-1171.378) [-1168.052] (-1168.942) -- 0:00:30 524000 -- (-1166.645) (-1168.779) [-1166.389] (-1170.760) * (-1168.045) (-1174.883) [-1168.277] (-1169.014) -- 0:00:29 524500 -- [-1167.758] (-1166.893) (-1167.051) (-1174.296) * (-1171.204) (-1166.495) (-1169.200) [-1166.458] -- 0:00:29 525000 -- [-1167.579] (-1172.067) (-1166.784) (-1170.496) * (-1169.389) (-1167.098) [-1168.062] (-1172.116) -- 0:00:30 Average standard deviation of split frequencies: 0.009634 525500 -- [-1168.669] (-1168.479) (-1166.885) (-1168.034) * (-1166.976) [-1167.109] (-1173.285) (-1171.446) -- 0:00:30 526000 -- (-1169.611) [-1168.607] (-1166.514) (-1167.726) * [-1166.307] (-1166.144) (-1171.967) (-1168.605) -- 0:00:30 526500 -- (-1168.125) [-1170.141] (-1167.539) (-1167.464) * [-1166.727] (-1166.811) (-1167.896) (-1168.360) -- 0:00:30 527000 -- (-1169.784) [-1172.049] (-1170.763) (-1169.322) * (-1168.532) [-1168.305] (-1173.075) (-1166.558) -- 0:00:30 527500 -- [-1167.846] (-1169.054) (-1166.652) (-1169.087) * [-1170.705] (-1167.106) (-1166.898) (-1169.176) -- 0:00:30 528000 -- (-1168.743) [-1167.281] (-1167.111) (-1166.884) * (-1168.359) (-1166.781) (-1168.979) [-1167.241] -- 0:00:30 528500 -- (-1166.494) (-1176.586) [-1167.351] (-1168.464) * (-1170.068) [-1167.768] (-1167.417) (-1169.677) -- 0:00:30 529000 -- (-1170.072) (-1171.493) (-1167.328) [-1168.621] * [-1169.548] (-1167.713) (-1170.803) (-1168.396) -- 0:00:30 529500 -- (-1170.411) (-1168.125) [-1169.562] (-1168.192) * (-1174.419) [-1167.273] (-1173.071) (-1168.405) -- 0:00:30 530000 -- (-1167.188) [-1168.057] (-1170.555) (-1168.680) * (-1173.022) [-1167.363] (-1169.373) (-1167.975) -- 0:00:30 Average standard deviation of split frequencies: 0.009716 530500 -- [-1169.136] (-1168.799) (-1170.850) (-1167.556) * (-1167.211) (-1172.413) (-1167.075) [-1167.340] -- 0:00:30 531000 -- (-1168.764) [-1171.532] (-1169.206) (-1167.609) * [-1167.171] (-1168.917) (-1173.061) (-1167.054) -- 0:00:30 531500 -- [-1171.107] (-1168.802) (-1167.399) (-1169.791) * (-1168.811) [-1172.568] (-1168.119) (-1167.054) -- 0:00:29 532000 -- (-1172.781) [-1167.035] (-1166.379) (-1167.877) * (-1167.161) (-1167.574) [-1167.466] (-1168.434) -- 0:00:29 532500 -- (-1167.796) [-1169.070] (-1170.658) (-1167.798) * (-1168.086) (-1167.574) [-1169.434] (-1172.720) -- 0:00:29 533000 -- (-1170.362) (-1166.380) [-1166.879] (-1169.206) * [-1167.937] (-1169.745) (-1167.795) (-1166.404) -- 0:00:29 533500 -- (-1170.347) [-1167.939] (-1166.484) (-1172.114) * (-1167.569) (-1170.858) (-1168.727) [-1168.003] -- 0:00:29 534000 -- (-1171.460) [-1167.280] (-1165.964) (-1172.714) * (-1168.025) (-1169.826) [-1166.626] (-1168.796) -- 0:00:29 534500 -- (-1169.810) (-1166.893) (-1169.301) [-1173.715] * [-1168.887] (-1171.497) (-1171.435) (-1167.852) -- 0:00:29 535000 -- (-1172.478) (-1170.245) (-1167.829) [-1168.089] * [-1170.080] (-1169.905) (-1166.721) (-1170.919) -- 0:00:29 Average standard deviation of split frequencies: 0.009564 535500 -- (-1169.712) (-1168.682) [-1167.399] (-1167.884) * [-1167.451] (-1168.197) (-1168.345) (-1168.604) -- 0:00:29 536000 -- (-1166.939) (-1166.776) [-1168.590] (-1167.480) * (-1167.001) (-1167.431) (-1170.896) [-1167.125] -- 0:00:29 536500 -- (-1171.443) (-1168.224) (-1171.764) [-1167.193] * (-1170.742) (-1168.371) (-1169.073) [-1168.146] -- 0:00:29 537000 -- (-1169.840) (-1168.729) (-1171.479) [-1168.657] * (-1169.709) (-1169.576) (-1167.897) [-1168.826] -- 0:00:29 537500 -- (-1168.482) [-1167.886] (-1168.544) (-1167.368) * (-1167.805) (-1168.151) [-1169.863] (-1167.890) -- 0:00:29 538000 -- [-1166.933] (-1168.893) (-1169.427) (-1167.662) * [-1167.659] (-1167.238) (-1170.209) (-1174.014) -- 0:00:29 538500 -- (-1169.757) (-1167.563) (-1167.804) [-1166.712] * (-1169.244) [-1167.838] (-1169.308) (-1166.696) -- 0:00:29 539000 -- (-1171.236) [-1168.340] (-1167.067) (-1167.244) * (-1168.009) (-1167.814) [-1173.525] (-1169.684) -- 0:00:29 539500 -- (-1170.638) (-1167.645) [-1168.949] (-1166.905) * (-1166.475) (-1170.085) (-1169.922) [-1170.546] -- 0:00:29 540000 -- (-1169.100) (-1167.441) (-1169.999) [-1167.772] * (-1167.282) [-1170.197] (-1166.735) (-1169.155) -- 0:00:28 Average standard deviation of split frequencies: 0.009427 540500 -- (-1170.835) [-1170.716] (-1168.069) (-1168.559) * (-1167.664) (-1169.300) (-1166.245) [-1169.980] -- 0:00:29 541000 -- [-1168.273] (-1170.582) (-1167.311) (-1167.510) * (-1167.913) [-1169.125] (-1167.411) (-1169.260) -- 0:00:29 541500 -- (-1170.336) (-1167.638) [-1169.294] (-1169.663) * (-1172.729) (-1167.897) [-1167.149] (-1169.583) -- 0:00:29 542000 -- (-1171.090) (-1168.264) (-1168.888) [-1177.223] * [-1168.618] (-1168.521) (-1166.947) (-1167.240) -- 0:00:29 542500 -- [-1169.032] (-1170.388) (-1167.804) (-1172.324) * (-1167.280) [-1172.081] (-1170.087) (-1166.838) -- 0:00:29 543000 -- [-1168.025] (-1166.987) (-1167.055) (-1169.971) * (-1168.269) (-1169.709) [-1170.294] (-1170.120) -- 0:00:29 543500 -- (-1171.309) (-1170.423) [-1167.703] (-1171.574) * (-1169.520) (-1168.057) (-1169.712) [-1170.805] -- 0:00:29 544000 -- (-1170.744) (-1167.887) [-1169.320] (-1166.647) * (-1169.290) (-1166.596) (-1168.266) [-1167.843] -- 0:00:29 544500 -- (-1167.589) (-1166.995) (-1166.953) [-1168.100] * (-1167.551) (-1168.391) [-1170.815] (-1168.185) -- 0:00:29 545000 -- (-1166.777) (-1170.743) [-1167.913] (-1168.861) * (-1166.432) (-1167.738) [-1170.431] (-1167.565) -- 0:00:29 Average standard deviation of split frequencies: 0.009929 545500 -- (-1167.580) [-1168.599] (-1167.233) (-1169.901) * (-1168.753) (-1166.534) (-1167.514) [-1168.294] -- 0:00:29 546000 -- (-1168.294) [-1169.565] (-1168.260) (-1169.816) * (-1167.972) (-1166.727) (-1175.286) [-1166.576] -- 0:00:29 546500 -- (-1167.960) (-1167.771) (-1167.901) [-1169.203] * (-1168.760) (-1169.131) (-1171.391) [-1168.186] -- 0:00:29 547000 -- (-1166.310) (-1167.037) [-1171.206] (-1174.315) * (-1169.771) [-1168.138] (-1170.993) (-1168.468) -- 0:00:28 547500 -- (-1169.777) [-1168.062] (-1168.363) (-1170.514) * (-1169.859) (-1168.108) (-1166.273) [-1170.308] -- 0:00:28 548000 -- [-1171.544] (-1166.523) (-1171.501) (-1168.518) * (-1167.122) [-1166.553] (-1166.880) (-1167.975) -- 0:00:28 548500 -- [-1169.773] (-1166.523) (-1169.549) (-1170.186) * [-1166.164] (-1168.761) (-1168.499) (-1169.512) -- 0:00:28 549000 -- (-1167.437) (-1167.602) (-1168.388) [-1169.881] * (-1168.784) [-1168.227] (-1168.777) (-1167.718) -- 0:00:28 549500 -- (-1168.426) (-1166.845) (-1168.267) [-1166.593] * (-1171.584) (-1166.539) [-1166.339] (-1170.024) -- 0:00:28 550000 -- (-1166.678) (-1169.339) [-1167.822] (-1168.119) * (-1169.677) (-1166.484) (-1168.599) [-1170.850] -- 0:00:28 Average standard deviation of split frequencies: 0.009524 550500 -- (-1166.874) (-1165.947) (-1169.433) [-1171.639] * (-1168.500) (-1167.361) (-1168.297) [-1166.703] -- 0:00:28 551000 -- (-1166.977) (-1167.509) (-1167.275) [-1171.074] * (-1168.301) (-1166.831) [-1166.558] (-1168.092) -- 0:00:28 551500 -- (-1166.965) (-1167.426) [-1169.347] (-1167.656) * (-1169.035) (-1166.384) [-1167.533] (-1167.028) -- 0:00:28 552000 -- (-1167.631) (-1169.214) [-1166.935] (-1170.143) * (-1168.575) [-1166.547] (-1168.102) (-1167.682) -- 0:00:28 552500 -- (-1167.622) (-1169.978) [-1169.005] (-1169.364) * (-1168.739) (-1167.643) (-1171.041) [-1168.971] -- 0:00:28 553000 -- (-1169.837) (-1169.939) (-1167.245) [-1168.521] * (-1171.806) (-1166.992) (-1171.419) [-1168.143] -- 0:00:28 553500 -- [-1167.450] (-1172.104) (-1166.848) (-1166.082) * [-1168.286] (-1167.640) (-1169.110) (-1169.028) -- 0:00:28 554000 -- [-1168.606] (-1168.796) (-1169.453) (-1170.117) * (-1166.184) (-1175.345) (-1169.153) [-1169.007] -- 0:00:28 554500 -- (-1168.771) [-1168.855] (-1166.800) (-1168.258) * (-1169.217) [-1174.368] (-1177.884) (-1170.484) -- 0:00:28 555000 -- (-1166.846) [-1168.542] (-1166.998) (-1169.705) * [-1169.579] (-1166.907) (-1169.505) (-1169.194) -- 0:00:28 Average standard deviation of split frequencies: 0.009538 555500 -- (-1168.832) [-1167.699] (-1166.884) (-1168.886) * (-1168.608) (-1167.198) [-1167.980] (-1170.239) -- 0:00:28 556000 -- (-1173.978) (-1170.566) (-1169.490) [-1169.911] * (-1167.354) (-1168.558) [-1168.034] (-1169.802) -- 0:00:28 556500 -- (-1172.733) [-1168.177] (-1167.951) (-1168.361) * [-1166.546] (-1168.048) (-1168.664) (-1173.063) -- 0:00:28 557000 -- (-1167.944) [-1167.404] (-1169.560) (-1168.995) * [-1167.663] (-1167.736) (-1168.739) (-1170.030) -- 0:00:28 557500 -- [-1169.730] (-1167.554) (-1168.719) (-1171.578) * [-1167.855] (-1168.245) (-1168.955) (-1167.910) -- 0:00:28 558000 -- (-1168.263) (-1166.476) (-1166.792) [-1167.628] * [-1170.544] (-1168.308) (-1169.259) (-1167.927) -- 0:00:28 558500 -- (-1168.351) (-1167.493) (-1166.703) [-1169.206] * (-1176.686) (-1168.803) (-1167.742) [-1168.408] -- 0:00:28 559000 -- [-1167.861] (-1170.045) (-1170.542) (-1169.722) * [-1167.987] (-1169.048) (-1168.802) (-1170.782) -- 0:00:28 559500 -- (-1167.509) (-1168.413) (-1170.717) [-1172.494] * (-1167.512) [-1167.890] (-1171.862) (-1168.816) -- 0:00:28 560000 -- (-1168.365) (-1166.950) [-1168.579] (-1167.602) * (-1170.575) (-1168.475) (-1170.188) [-1170.659] -- 0:00:28 Average standard deviation of split frequencies: 0.009564 560500 -- [-1167.500] (-1166.318) (-1167.158) (-1168.112) * (-1171.335) (-1169.721) [-1167.293] (-1167.418) -- 0:00:28 561000 -- (-1171.305) (-1168.306) [-1168.233] (-1170.260) * (-1171.431) [-1166.220] (-1170.026) (-1167.490) -- 0:00:28 561500 -- [-1166.764] (-1166.521) (-1168.447) (-1169.556) * (-1172.261) (-1169.355) (-1168.041) [-1168.599] -- 0:00:28 562000 -- (-1168.920) (-1167.434) [-1168.188] (-1167.379) * (-1169.997) [-1167.691] (-1169.037) (-1176.204) -- 0:00:28 562500 -- (-1168.981) (-1166.831) [-1168.461] (-1168.706) * (-1168.355) (-1167.436) (-1166.878) [-1169.656] -- 0:00:28 563000 -- (-1169.255) [-1166.534] (-1167.966) (-1168.501) * (-1170.200) [-1169.055] (-1166.557) (-1168.608) -- 0:00:27 563500 -- (-1168.775) (-1170.783) [-1167.522] (-1168.765) * (-1169.990) (-1172.844) (-1168.916) [-1167.048] -- 0:00:27 564000 -- (-1166.849) (-1169.280) (-1169.732) [-1166.487] * [-1167.160] (-1168.262) (-1170.183) (-1168.341) -- 0:00:27 564500 -- [-1173.471] (-1173.238) (-1171.080) (-1168.191) * [-1166.803] (-1169.548) (-1168.197) (-1170.086) -- 0:00:27 565000 -- (-1168.192) (-1166.702) (-1172.616) [-1167.529] * (-1168.994) (-1167.307) (-1167.550) [-1168.495] -- 0:00:27 Average standard deviation of split frequencies: 0.010411 565500 -- (-1171.149) (-1169.955) [-1170.631] (-1168.023) * (-1166.925) (-1169.960) (-1167.524) [-1167.341] -- 0:00:27 566000 -- (-1173.874) (-1170.635) (-1167.927) [-1168.430] * (-1167.401) (-1168.506) [-1169.907] (-1167.646) -- 0:00:27 566500 -- [-1169.793] (-1170.291) (-1167.401) (-1166.540) * (-1168.740) [-1166.480] (-1172.695) (-1168.000) -- 0:00:27 567000 -- (-1170.614) (-1171.336) (-1166.432) [-1167.177] * (-1169.933) (-1167.958) [-1167.901] (-1167.163) -- 0:00:27 567500 -- (-1168.114) (-1171.275) (-1166.678) [-1168.991] * [-1167.409] (-1170.547) (-1167.159) (-1167.449) -- 0:00:27 568000 -- (-1172.013) [-1169.952] (-1166.601) (-1167.848) * [-1168.713] (-1168.383) (-1167.906) (-1168.965) -- 0:00:27 568500 -- (-1167.475) (-1168.151) [-1167.316] (-1166.975) * (-1167.563) (-1167.820) [-1169.969] (-1168.689) -- 0:00:27 569000 -- (-1169.052) (-1167.526) (-1167.813) [-1168.235] * (-1166.540) (-1168.350) (-1168.475) [-1167.566] -- 0:00:27 569500 -- [-1167.396] (-1166.660) (-1168.998) (-1167.681) * [-1167.055] (-1168.565) (-1167.783) (-1169.519) -- 0:00:27 570000 -- (-1169.458) (-1169.184) [-1167.966] (-1169.785) * (-1169.135) (-1168.650) [-1167.788] (-1167.332) -- 0:00:27 Average standard deviation of split frequencies: 0.010377 570500 -- (-1168.072) [-1166.483] (-1168.793) (-1168.747) * [-1166.595] (-1168.418) (-1166.844) (-1169.753) -- 0:00:27 571000 -- [-1167.067] (-1167.021) (-1168.772) (-1168.667) * (-1177.174) [-1168.770] (-1169.888) (-1169.270) -- 0:00:27 571500 -- [-1166.725] (-1166.848) (-1170.648) (-1167.563) * (-1170.430) (-1167.211) (-1170.423) [-1169.861] -- 0:00:26 572000 -- (-1171.012) (-1169.013) [-1166.269] (-1167.410) * (-1170.227) (-1171.129) (-1166.950) [-1171.547] -- 0:00:26 572500 -- [-1169.110] (-1168.903) (-1166.239) (-1168.705) * (-1167.837) (-1167.221) [-1168.923] (-1178.245) -- 0:00:27 573000 -- [-1167.249] (-1167.632) (-1170.185) (-1170.837) * [-1168.023] (-1167.523) (-1168.598) (-1171.068) -- 0:00:27 573500 -- [-1172.654] (-1168.791) (-1168.014) (-1176.602) * (-1166.539) (-1167.708) (-1166.246) [-1166.663] -- 0:00:27 574000 -- (-1168.161) (-1169.720) (-1169.360) [-1171.394] * (-1169.402) (-1167.227) [-1167.222] (-1168.923) -- 0:00:27 574500 -- [-1169.427] (-1169.176) (-1168.887) (-1174.396) * (-1168.873) (-1167.739) (-1169.737) [-1167.845] -- 0:00:27 575000 -- (-1166.480) [-1166.565] (-1166.901) (-1169.507) * [-1168.780] (-1169.600) (-1168.934) (-1166.358) -- 0:00:27 Average standard deviation of split frequencies: 0.010486 575500 -- [-1166.941] (-1167.501) (-1166.859) (-1171.116) * (-1169.784) [-1169.799] (-1167.887) (-1166.362) -- 0:00:27 576000 -- (-1168.131) (-1169.691) [-1168.849] (-1170.892) * [-1168.345] (-1166.823) (-1170.006) (-1166.360) -- 0:00:27 576500 -- (-1168.441) (-1168.679) [-1171.178] (-1169.000) * [-1167.100] (-1167.581) (-1166.732) (-1166.539) -- 0:00:27 577000 -- (-1169.199) (-1167.455) [-1168.013] (-1170.741) * (-1168.136) (-1168.094) (-1169.736) [-1168.640] -- 0:00:27 577500 -- (-1171.059) (-1170.029) (-1168.002) [-1170.067] * (-1166.053) (-1167.287) [-1168.270] (-1168.171) -- 0:00:27 578000 -- (-1171.317) [-1167.145] (-1172.917) (-1171.606) * [-1169.265] (-1167.163) (-1166.225) (-1169.871) -- 0:00:27 578500 -- (-1166.770) (-1167.546) (-1171.010) [-1170.281] * (-1170.048) [-1167.725] (-1167.800) (-1168.559) -- 0:00:26 579000 -- (-1167.488) (-1169.019) [-1166.834] (-1167.860) * (-1167.526) (-1167.528) [-1169.525] (-1170.898) -- 0:00:26 579500 -- (-1170.313) (-1169.785) (-1166.993) [-1166.882] * (-1166.830) [-1166.860] (-1169.054) (-1166.769) -- 0:00:26 580000 -- (-1168.983) (-1167.393) [-1167.480] (-1169.113) * (-1167.087) (-1166.939) (-1178.960) [-1166.786] -- 0:00:26 Average standard deviation of split frequencies: 0.011061 580500 -- (-1170.719) (-1168.174) [-1167.463] (-1168.282) * [-1167.075] (-1170.902) (-1167.770) (-1167.328) -- 0:00:26 581000 -- (-1168.424) (-1166.977) (-1167.550) [-1168.841] * [-1171.045] (-1169.117) (-1167.494) (-1172.603) -- 0:00:26 581500 -- (-1169.504) [-1169.457] (-1169.766) (-1166.544) * (-1167.109) (-1168.043) [-1168.097] (-1172.201) -- 0:00:26 582000 -- (-1167.501) (-1171.399) (-1169.442) [-1169.622] * [-1167.444] (-1167.434) (-1169.285) (-1172.151) -- 0:00:26 582500 -- (-1167.951) (-1167.591) [-1168.233] (-1166.441) * [-1169.441] (-1167.398) (-1169.968) (-1171.673) -- 0:00:26 583000 -- (-1166.797) (-1167.546) [-1169.237] (-1171.784) * (-1169.247) [-1167.113] (-1169.038) (-1166.985) -- 0:00:26 583500 -- [-1167.614] (-1171.155) (-1172.734) (-1168.386) * (-1167.625) (-1170.959) (-1174.144) [-1167.557] -- 0:00:26 584000 -- (-1171.791) (-1172.406) (-1168.804) [-1166.647] * (-1169.810) [-1168.808] (-1174.706) (-1168.362) -- 0:00:26 584500 -- (-1166.681) [-1168.857] (-1169.629) (-1167.913) * (-1167.574) [-1167.672] (-1174.888) (-1174.422) -- 0:00:26 585000 -- [-1167.729] (-1168.768) (-1168.043) (-1166.981) * (-1167.598) (-1171.177) [-1166.217] (-1173.692) -- 0:00:26 Average standard deviation of split frequencies: 0.010552 585500 -- (-1168.207) (-1168.560) [-1168.304] (-1173.442) * (-1167.478) [-1167.214] (-1168.011) (-1172.928) -- 0:00:26 586000 -- (-1168.096) [-1167.253] (-1168.513) (-1167.141) * (-1169.904) [-1166.351] (-1166.967) (-1168.536) -- 0:00:26 586500 -- (-1169.767) (-1167.161) [-1168.631] (-1166.935) * [-1169.073] (-1167.894) (-1167.147) (-1177.361) -- 0:00:26 587000 -- (-1170.741) (-1168.095) [-1168.912] (-1172.997) * (-1170.412) (-1170.565) [-1167.619] (-1166.358) -- 0:00:26 587500 -- [-1172.249] (-1168.095) (-1168.408) (-1167.200) * [-1167.700] (-1170.580) (-1166.942) (-1168.733) -- 0:00:26 588000 -- (-1167.891) (-1169.419) [-1167.631] (-1167.813) * [-1166.840] (-1178.862) (-1167.290) (-1170.020) -- 0:00:26 588500 -- (-1167.911) [-1167.835] (-1168.089) (-1170.533) * (-1168.971) (-1169.175) (-1169.151) [-1169.262] -- 0:00:26 589000 -- (-1167.554) [-1168.738] (-1170.217) (-1170.000) * (-1169.948) (-1169.124) [-1167.904] (-1168.223) -- 0:00:26 589500 -- (-1166.933) (-1168.596) [-1167.165] (-1167.634) * [-1167.854] (-1168.976) (-1168.737) (-1167.680) -- 0:00:26 590000 -- (-1169.607) (-1167.981) [-1167.958] (-1168.346) * (-1171.766) (-1168.244) (-1166.634) [-1167.808] -- 0:00:26 Average standard deviation of split frequencies: 0.010325 590500 -- [-1167.281] (-1171.042) (-1170.862) (-1166.183) * (-1177.305) [-1167.796] (-1168.402) (-1169.744) -- 0:00:26 591000 -- (-1172.669) [-1170.521] (-1167.890) (-1167.870) * (-1170.161) (-1168.212) (-1171.730) [-1167.003] -- 0:00:26 591500 -- (-1169.960) (-1168.200) (-1170.012) [-1166.105] * (-1166.930) (-1167.850) [-1167.341] (-1168.842) -- 0:00:26 592000 -- (-1170.491) (-1167.602) (-1167.433) [-1167.279] * (-1167.817) (-1167.369) [-1168.629] (-1167.501) -- 0:00:26 592500 -- (-1167.800) (-1168.253) [-1170.790] (-1166.686) * (-1169.233) (-1168.018) (-1167.973) [-1166.649] -- 0:00:26 593000 -- [-1169.251] (-1168.561) (-1168.614) (-1168.121) * (-1169.653) (-1169.784) [-1166.728] (-1166.616) -- 0:00:26 593500 -- (-1171.816) [-1167.790] (-1166.970) (-1167.430) * (-1168.265) [-1169.297] (-1168.688) (-1167.655) -- 0:00:26 594000 -- (-1173.812) (-1167.407) [-1169.716] (-1168.670) * (-1168.436) (-1168.577) [-1168.990] (-1168.641) -- 0:00:25 594500 -- (-1168.062) [-1167.458] (-1169.869) (-1166.420) * [-1167.717] (-1166.682) (-1168.226) (-1173.388) -- 0:00:25 595000 -- (-1167.968) (-1167.716) (-1168.758) [-1166.751] * [-1167.769] (-1166.695) (-1169.066) (-1174.659) -- 0:00:25 Average standard deviation of split frequencies: 0.010579 595500 -- [-1168.438] (-1175.075) (-1167.408) (-1169.387) * (-1167.588) (-1168.075) [-1169.993] (-1169.811) -- 0:00:25 596000 -- (-1169.171) (-1175.271) [-1166.475] (-1167.625) * (-1167.989) (-1167.343) (-1169.866) [-1170.750] -- 0:00:25 596500 -- (-1168.461) [-1174.121] (-1168.800) (-1168.013) * (-1171.307) (-1167.596) [-1170.542] (-1170.671) -- 0:00:25 597000 -- (-1166.854) (-1172.720) [-1168.994] (-1165.941) * [-1167.742] (-1167.238) (-1167.755) (-1171.188) -- 0:00:25 597500 -- (-1167.738) [-1168.024] (-1166.471) (-1168.419) * (-1171.806) [-1166.596] (-1167.126) (-1169.203) -- 0:00:25 598000 -- (-1167.387) (-1169.660) (-1166.697) [-1167.043] * (-1166.585) (-1167.527) [-1168.159] (-1166.459) -- 0:00:25 598500 -- (-1168.090) [-1167.199] (-1168.825) (-1166.283) * (-1169.367) [-1166.189] (-1168.155) (-1177.391) -- 0:00:25 599000 -- (-1167.105) [-1168.941] (-1173.030) (-1167.948) * (-1168.103) (-1167.563) (-1168.824) [-1168.700] -- 0:00:25 599500 -- (-1166.423) [-1167.536] (-1167.424) (-1167.088) * (-1172.891) (-1168.522) (-1167.144) [-1167.222] -- 0:00:25 600000 -- (-1172.842) [-1166.612] (-1171.047) (-1170.105) * (-1170.085) (-1167.682) (-1171.856) [-1166.856] -- 0:00:25 Average standard deviation of split frequencies: 0.011232 600500 -- (-1168.241) [-1168.453] (-1167.348) (-1166.546) * [-1168.589] (-1168.158) (-1169.162) (-1171.471) -- 0:00:25 601000 -- (-1170.728) (-1169.633) (-1167.211) [-1166.708] * (-1170.342) [-1169.531] (-1170.380) (-1172.274) -- 0:00:25 601500 -- (-1168.490) (-1168.283) (-1168.303) [-1169.596] * (-1169.723) (-1168.262) (-1170.038) [-1167.416] -- 0:00:25 602000 -- (-1168.645) [-1167.204] (-1168.273) (-1168.294) * (-1168.515) (-1167.843) [-1167.182] (-1167.452) -- 0:00:25 602500 -- [-1167.982] (-1167.783) (-1169.963) (-1168.049) * (-1170.943) [-1166.855] (-1168.588) (-1168.367) -- 0:00:25 603000 -- [-1167.169] (-1170.558) (-1170.774) (-1169.295) * (-1172.271) (-1168.257) (-1170.155) [-1168.752] -- 0:00:25 603500 -- (-1167.891) (-1167.217) [-1168.783] (-1167.817) * [-1168.827] (-1170.154) (-1171.749) (-1167.316) -- 0:00:25 604000 -- [-1172.731] (-1166.961) (-1169.489) (-1170.403) * (-1168.066) (-1167.636) [-1168.755] (-1169.339) -- 0:00:25 604500 -- [-1166.684] (-1169.333) (-1168.483) (-1170.766) * (-1167.595) [-1168.297] (-1168.030) (-1173.044) -- 0:00:25 605000 -- (-1167.315) (-1172.968) [-1166.464] (-1166.624) * (-1167.761) [-1170.633] (-1169.254) (-1168.581) -- 0:00:25 Average standard deviation of split frequencies: 0.011231 605500 -- (-1166.535) [-1167.383] (-1167.767) (-1166.741) * (-1168.555) (-1166.801) [-1169.413] (-1168.616) -- 0:00:25 606000 -- [-1166.163] (-1168.994) (-1169.034) (-1166.348) * (-1168.439) [-1166.439] (-1170.374) (-1170.752) -- 0:00:25 606500 -- (-1166.655) (-1170.712) [-1166.807] (-1168.152) * (-1168.157) [-1166.758] (-1169.172) (-1168.248) -- 0:00:25 607000 -- [-1168.888] (-1168.642) (-1172.825) (-1168.844) * (-1167.273) [-1167.708] (-1168.569) (-1167.278) -- 0:00:25 607500 -- (-1167.096) [-1169.015] (-1168.635) (-1168.430) * (-1166.541) [-1167.774] (-1167.140) (-1171.406) -- 0:00:25 608000 -- (-1169.341) (-1166.755) (-1168.554) [-1167.469] * [-1166.650] (-1173.563) (-1169.411) (-1169.658) -- 0:00:25 608500 -- (-1168.483) (-1170.157) [-1167.701] (-1168.405) * [-1167.418] (-1168.894) (-1168.556) (-1169.665) -- 0:00:25 609000 -- (-1169.042) [-1167.121] (-1167.701) (-1169.611) * (-1168.306) (-1169.564) (-1167.744) [-1171.980] -- 0:00:25 609500 -- [-1166.656] (-1166.318) (-1171.150) (-1166.499) * (-1169.533) (-1168.273) (-1167.084) [-1167.423] -- 0:00:24 610000 -- (-1167.778) (-1166.021) [-1166.614] (-1167.159) * (-1172.332) (-1167.753) [-1167.635] (-1171.156) -- 0:00:24 Average standard deviation of split frequencies: 0.011338 610500 -- (-1168.965) [-1166.847] (-1168.125) (-1167.422) * (-1168.808) (-1167.163) (-1168.098) [-1168.235] -- 0:00:24 611000 -- (-1171.816) (-1167.030) (-1169.401) [-1169.857] * (-1166.880) (-1166.638) [-1167.456] (-1172.236) -- 0:00:24 611500 -- (-1168.734) [-1166.518] (-1167.513) (-1170.273) * (-1170.695) (-1168.694) [-1174.321] (-1168.125) -- 0:00:24 612000 -- (-1170.311) [-1167.725] (-1170.553) (-1171.672) * (-1169.535) (-1173.199) [-1167.968] (-1172.221) -- 0:00:24 612500 -- (-1168.265) (-1166.651) [-1167.738] (-1169.502) * (-1171.457) (-1169.137) [-1166.701] (-1167.260) -- 0:00:24 613000 -- (-1169.622) (-1169.571) [-1168.003] (-1169.229) * [-1167.021] (-1167.648) (-1166.238) (-1167.871) -- 0:00:24 613500 -- (-1169.247) [-1170.486] (-1167.341) (-1167.039) * (-1167.425) [-1167.757] (-1167.393) (-1167.060) -- 0:00:24 614000 -- (-1168.642) (-1167.623) (-1173.439) [-1171.867] * (-1166.187) [-1168.743] (-1167.120) (-1167.035) -- 0:00:24 614500 -- (-1166.966) (-1166.932) (-1173.467) [-1169.885] * (-1167.487) (-1170.374) [-1169.720] (-1169.664) -- 0:00:24 615000 -- [-1166.257] (-1167.067) (-1169.390) (-1168.440) * (-1167.327) (-1167.610) [-1167.773] (-1167.316) -- 0:00:24 Average standard deviation of split frequencies: 0.010255 615500 -- [-1166.142] (-1166.399) (-1167.223) (-1170.851) * (-1172.315) (-1168.496) [-1168.034] (-1168.306) -- 0:00:24 616000 -- (-1166.142) [-1167.331] (-1166.837) (-1169.781) * (-1170.955) (-1167.697) [-1169.268] (-1167.848) -- 0:00:24 616500 -- (-1167.492) [-1168.416] (-1168.372) (-1167.335) * [-1168.372] (-1168.824) (-1168.687) (-1167.163) -- 0:00:24 617000 -- (-1167.193) [-1168.141] (-1167.773) (-1167.456) * (-1168.518) [-1171.845] (-1170.268) (-1167.279) -- 0:00:24 617500 -- (-1167.403) (-1171.130) [-1168.515] (-1169.419) * [-1168.142] (-1167.396) (-1167.573) (-1168.397) -- 0:00:24 618000 -- (-1166.753) [-1168.915] (-1167.396) (-1169.820) * (-1167.937) (-1169.754) (-1168.808) [-1168.660] -- 0:00:24 618500 -- [-1167.424] (-1170.392) (-1167.054) (-1168.900) * (-1167.908) [-1168.538] (-1170.937) (-1166.736) -- 0:00:24 619000 -- (-1168.008) (-1169.151) (-1166.825) [-1167.869] * (-1169.715) [-1169.352] (-1171.480) (-1168.101) -- 0:00:24 619500 -- (-1167.131) (-1169.242) [-1166.753] (-1168.929) * (-1169.242) (-1170.269) (-1169.987) [-1168.464] -- 0:00:24 620000 -- (-1166.368) (-1168.468) [-1166.571] (-1167.049) * (-1169.712) [-1168.131] (-1171.647) (-1169.946) -- 0:00:24 Average standard deviation of split frequencies: 0.009975 620500 -- (-1169.066) (-1168.254) [-1169.486] (-1167.559) * (-1168.191) (-1171.540) (-1168.446) [-1168.436] -- 0:00:24 621000 -- (-1168.119) (-1169.116) (-1167.121) [-1168.834] * [-1167.445] (-1168.087) (-1166.688) (-1168.415) -- 0:00:24 621500 -- (-1168.800) (-1167.963) (-1166.625) [-1168.094] * (-1166.953) [-1167.309] (-1166.785) (-1168.363) -- 0:00:24 622000 -- (-1168.168) (-1169.108) (-1167.282) [-1167.392] * (-1167.540) (-1169.833) [-1167.387] (-1169.880) -- 0:00:24 622500 -- (-1168.365) (-1169.204) (-1168.256) [-1167.954] * (-1166.262) [-1168.471] (-1167.857) (-1169.083) -- 0:00:24 623000 -- (-1167.743) (-1167.590) (-1166.635) [-1166.844] * [-1166.956] (-1170.153) (-1168.609) (-1167.648) -- 0:00:24 623500 -- (-1167.693) (-1166.350) (-1166.325) [-1166.196] * (-1167.624) (-1168.100) (-1167.554) [-1166.735] -- 0:00:24 624000 -- [-1167.907] (-1167.319) (-1173.093) (-1168.669) * (-1170.637) [-1166.537] (-1169.592) (-1166.609) -- 0:00:24 624500 -- (-1166.799) (-1169.941) (-1172.727) [-1169.822] * [-1168.088] (-1169.031) (-1169.631) (-1168.732) -- 0:00:24 625000 -- [-1169.111] (-1172.671) (-1169.991) (-1168.163) * (-1168.123) (-1167.852) [-1168.171] (-1168.279) -- 0:00:24 Average standard deviation of split frequencies: 0.009890 625500 -- (-1167.813) (-1171.134) (-1169.332) [-1167.621] * (-1170.855) [-1166.597] (-1170.460) (-1170.942) -- 0:00:23 626000 -- (-1167.020) (-1166.673) [-1167.755] (-1167.271) * (-1169.404) [-1168.986] (-1167.303) (-1166.628) -- 0:00:23 626500 -- (-1167.672) (-1166.115) (-1167.126) [-1167.289] * (-1167.988) (-1172.322) (-1166.898) [-1167.058] -- 0:00:23 627000 -- (-1167.727) (-1166.618) [-1166.900] (-1172.348) * (-1168.529) (-1168.115) (-1168.489) [-1167.789] -- 0:00:23 627500 -- (-1171.376) [-1168.665] (-1170.801) (-1167.497) * (-1173.000) (-1168.874) [-1168.373] (-1167.048) -- 0:00:23 628000 -- (-1174.179) (-1168.445) (-1177.296) [-1166.939] * (-1169.558) [-1166.654] (-1170.899) (-1173.901) -- 0:00:23 628500 -- (-1169.957) [-1168.612] (-1168.556) (-1169.003) * (-1168.264) (-1168.429) (-1170.008) [-1169.550] -- 0:00:23 629000 -- (-1167.429) (-1167.792) [-1167.503] (-1173.402) * (-1167.382) [-1166.808] (-1167.390) (-1167.604) -- 0:00:23 629500 -- [-1172.220] (-1168.046) (-1167.686) (-1168.014) * (-1166.851) [-1166.602] (-1171.839) (-1168.141) -- 0:00:23 630000 -- (-1173.359) [-1170.654] (-1168.785) (-1168.309) * (-1166.714) (-1167.317) (-1167.050) [-1168.031] -- 0:00:23 Average standard deviation of split frequencies: 0.009717 630500 -- (-1174.432) [-1169.920] (-1170.734) (-1166.004) * (-1170.680) [-1166.966] (-1168.054) (-1166.790) -- 0:00:23 631000 -- (-1170.876) (-1173.559) [-1171.470] (-1166.974) * (-1167.400) (-1169.914) (-1168.112) [-1169.764] -- 0:00:23 631500 -- (-1170.848) (-1172.459) (-1173.072) [-1170.927] * (-1169.129) [-1170.105] (-1166.670) (-1170.143) -- 0:00:23 632000 -- (-1168.628) [-1169.189] (-1168.383) (-1169.227) * (-1169.566) [-1167.457] (-1167.963) (-1172.532) -- 0:00:23 632500 -- (-1169.279) (-1171.170) (-1169.013) [-1169.205] * [-1169.335] (-1166.320) (-1167.122) (-1167.902) -- 0:00:23 633000 -- (-1169.732) (-1168.480) [-1169.401] (-1170.712) * (-1170.080) (-1167.135) (-1166.443) [-1169.190] -- 0:00:23 633500 -- (-1168.628) (-1167.766) [-1173.537] (-1169.449) * (-1170.539) (-1169.604) [-1166.548] (-1168.946) -- 0:00:23 634000 -- (-1170.352) (-1166.918) (-1173.005) [-1167.865] * (-1174.202) (-1171.437) [-1166.715] (-1169.098) -- 0:00:23 634500 -- [-1167.114] (-1166.744) (-1166.090) (-1167.215) * (-1169.169) [-1170.378] (-1167.348) (-1167.911) -- 0:00:23 635000 -- (-1167.149) (-1166.879) [-1166.410] (-1167.425) * [-1168.017] (-1167.191) (-1166.839) (-1171.515) -- 0:00:23 Average standard deviation of split frequencies: 0.009833 635500 -- [-1175.489] (-1168.316) (-1169.609) (-1167.999) * (-1166.925) (-1166.970) [-1167.689] (-1168.725) -- 0:00:23 636000 -- (-1167.540) [-1168.694] (-1169.513) (-1167.079) * [-1166.872] (-1167.535) (-1168.265) (-1172.300) -- 0:00:23 636500 -- (-1170.264) [-1168.641] (-1168.521) (-1166.517) * (-1169.880) (-1167.369) (-1166.372) [-1168.008] -- 0:00:23 637000 -- (-1166.956) (-1167.912) (-1169.897) [-1167.340] * (-1167.879) [-1167.561] (-1172.812) (-1168.784) -- 0:00:23 637500 -- (-1167.449) (-1170.106) [-1169.241] (-1168.762) * (-1166.497) (-1167.555) [-1168.568] (-1169.791) -- 0:00:23 638000 -- (-1170.229) (-1169.344) [-1170.428] (-1166.830) * [-1170.702] (-1167.260) (-1167.466) (-1167.503) -- 0:00:23 638500 -- [-1166.819] (-1167.339) (-1167.867) (-1167.785) * [-1167.466] (-1167.920) (-1167.434) (-1166.682) -- 0:00:23 639000 -- (-1168.824) (-1169.111) [-1168.899] (-1169.231) * [-1166.286] (-1166.632) (-1168.751) (-1169.600) -- 0:00:23 639500 -- [-1167.140] (-1170.459) (-1170.568) (-1167.775) * (-1167.912) (-1173.097) [-1168.752] (-1168.746) -- 0:00:23 640000 -- (-1168.744) [-1173.209] (-1176.215) (-1167.292) * (-1168.085) (-1171.211) [-1167.732] (-1167.831) -- 0:00:23 Average standard deviation of split frequencies: 0.010056 640500 -- [-1166.870] (-1169.943) (-1168.841) (-1169.753) * (-1170.656) (-1170.627) (-1169.041) [-1167.540] -- 0:00:23 641000 -- (-1170.345) (-1168.954) (-1167.051) [-1167.679] * (-1165.981) [-1168.825] (-1169.322) (-1169.702) -- 0:00:22 641500 -- (-1166.933) [-1171.072] (-1166.961) (-1167.299) * (-1171.399) (-1169.388) (-1166.432) [-1167.195] -- 0:00:22 642000 -- (-1167.605) [-1168.329] (-1166.550) (-1167.522) * (-1168.120) (-1167.309) (-1168.535) [-1169.402] -- 0:00:22 642500 -- (-1167.581) (-1167.471) [-1167.910] (-1168.180) * (-1169.409) (-1168.036) (-1166.636) [-1168.335] -- 0:00:22 643000 -- (-1167.303) (-1166.867) [-1172.444] (-1168.311) * (-1169.291) (-1168.683) (-1166.687) [-1172.277] -- 0:00:22 643500 -- (-1168.475) (-1167.415) [-1167.000] (-1167.433) * (-1173.059) [-1169.347] (-1169.663) (-1167.309) -- 0:00:22 644000 -- (-1169.489) (-1166.643) [-1169.120] (-1166.530) * (-1167.847) [-1166.694] (-1170.021) (-1170.054) -- 0:00:22 644500 -- (-1170.163) [-1167.476] (-1166.855) (-1167.589) * [-1168.384] (-1166.678) (-1167.455) (-1172.145) -- 0:00:22 645000 -- (-1168.937) (-1167.277) [-1171.318] (-1167.484) * [-1168.070] (-1168.135) (-1170.315) (-1169.462) -- 0:00:22 Average standard deviation of split frequencies: 0.010216 645500 -- (-1166.708) (-1170.566) (-1169.568) [-1168.111] * (-1167.033) (-1166.658) [-1167.315] (-1172.907) -- 0:00:22 646000 -- (-1168.266) (-1167.758) (-1168.636) [-1166.828] * (-1168.639) (-1168.991) (-1173.996) [-1168.250] -- 0:00:22 646500 -- (-1166.780) (-1170.818) (-1167.824) [-1166.594] * [-1169.264] (-1168.732) (-1168.424) (-1168.417) -- 0:00:22 647000 -- (-1167.253) [-1169.266] (-1167.228) (-1167.711) * (-1166.574) (-1168.233) [-1168.737] (-1168.244) -- 0:00:22 647500 -- (-1167.643) (-1169.805) [-1167.102] (-1167.486) * (-1166.542) (-1167.705) [-1170.292] (-1166.510) -- 0:00:22 648000 -- (-1167.786) [-1169.034] (-1166.470) (-1167.062) * (-1168.376) [-1168.299] (-1172.372) (-1167.247) -- 0:00:22 648500 -- [-1167.446] (-1166.577) (-1167.136) (-1168.305) * (-1168.821) (-1168.369) [-1171.414] (-1166.688) -- 0:00:22 649000 -- [-1169.403] (-1166.340) (-1170.093) (-1168.913) * (-1169.346) (-1169.970) (-1171.165) [-1167.053] -- 0:00:22 649500 -- (-1170.124) (-1167.931) (-1166.511) [-1167.023] * (-1168.312) (-1167.332) [-1173.060] (-1168.143) -- 0:00:22 650000 -- (-1171.955) [-1166.438] (-1166.702) (-1167.768) * (-1166.625) (-1169.309) (-1171.686) [-1168.618] -- 0:00:22 Average standard deviation of split frequencies: 0.009950 650500 -- [-1169.029] (-1166.800) (-1171.010) (-1166.144) * (-1168.130) [-1170.384] (-1169.990) (-1167.054) -- 0:00:22 651000 -- [-1169.709] (-1171.666) (-1170.379) (-1166.114) * (-1167.332) [-1168.458] (-1167.006) (-1172.767) -- 0:00:22 651500 -- (-1172.874) [-1167.596] (-1168.655) (-1166.729) * (-1168.196) [-1168.463] (-1171.547) (-1166.328) -- 0:00:22 652000 -- (-1168.581) (-1166.687) (-1166.713) [-1166.931] * (-1171.294) (-1168.997) [-1167.729] (-1168.028) -- 0:00:22 652500 -- (-1172.232) (-1166.630) (-1166.857) [-1167.471] * (-1171.352) (-1167.951) [-1166.312] (-1167.212) -- 0:00:22 653000 -- (-1171.183) [-1168.576] (-1166.961) (-1172.404) * (-1170.376) [-1170.212] (-1168.048) (-1172.735) -- 0:00:22 653500 -- [-1168.852] (-1167.860) (-1166.163) (-1168.236) * (-1167.091) [-1168.414] (-1169.547) (-1170.652) -- 0:00:22 654000 -- [-1168.376] (-1166.940) (-1169.368) (-1168.097) * (-1168.579) (-1167.771) (-1167.189) [-1170.351] -- 0:00:22 654500 -- [-1166.830] (-1169.221) (-1168.615) (-1166.725) * (-1168.620) (-1169.798) [-1166.779] (-1167.758) -- 0:00:22 655000 -- (-1167.191) (-1166.192) (-1167.605) [-1167.313] * (-1173.918) (-1167.405) (-1167.722) [-1167.026] -- 0:00:22 Average standard deviation of split frequencies: 0.009677 655500 -- (-1171.525) (-1166.376) (-1167.450) [-1169.601] * (-1169.137) [-1169.579] (-1168.803) (-1167.493) -- 0:00:22 656000 -- (-1168.418) (-1166.376) (-1167.515) [-1168.102] * (-1171.077) [-1168.652] (-1167.972) (-1168.092) -- 0:00:22 656500 -- (-1170.093) [-1170.211] (-1167.203) (-1166.609) * (-1168.943) (-1170.626) [-1170.004] (-1167.814) -- 0:00:21 657000 -- (-1168.283) [-1168.855] (-1167.340) (-1174.865) * (-1169.960) (-1172.315) [-1167.122] (-1174.778) -- 0:00:21 657500 -- (-1169.506) (-1170.272) (-1169.082) [-1171.321] * (-1167.662) (-1169.913) (-1168.099) [-1167.555] -- 0:00:21 658000 -- (-1170.278) [-1168.715] (-1167.757) (-1170.956) * (-1167.317) (-1167.305) [-1169.973] (-1171.811) -- 0:00:21 658500 -- (-1169.817) (-1169.637) [-1166.786] (-1170.666) * (-1167.641) (-1167.497) [-1168.570] (-1172.149) -- 0:00:21 659000 -- (-1172.435) (-1166.627) (-1167.944) [-1167.682] * (-1168.168) (-1167.140) (-1168.585) [-1168.208] -- 0:00:21 659500 -- (-1166.588) [-1167.894] (-1166.730) (-1167.117) * (-1167.968) [-1171.929] (-1170.012) (-1167.993) -- 0:00:21 660000 -- (-1171.468) (-1167.581) [-1167.234] (-1172.187) * (-1167.171) (-1168.764) [-1167.341] (-1166.921) -- 0:00:21 Average standard deviation of split frequencies: 0.010480 660500 -- (-1170.459) (-1170.178) [-1167.436] (-1168.700) * [-1167.312] (-1170.080) (-1167.164) (-1166.974) -- 0:00:21 661000 -- (-1174.059) (-1168.282) [-1166.668] (-1170.376) * [-1169.523] (-1170.636) (-1170.885) (-1169.437) -- 0:00:21 661500 -- (-1169.919) (-1167.527) (-1169.196) [-1171.192] * (-1172.785) [-1168.420] (-1172.974) (-1171.894) -- 0:00:21 662000 -- (-1172.739) (-1170.372) [-1168.858] (-1169.502) * [-1167.565] (-1167.373) (-1167.016) (-1170.590) -- 0:00:21 662500 -- (-1166.667) [-1168.519] (-1168.440) (-1169.443) * [-1168.913] (-1166.507) (-1167.221) (-1167.801) -- 0:00:21 663000 -- (-1168.700) (-1168.672) (-1169.019) [-1168.007] * (-1166.738) (-1171.731) (-1166.632) [-1169.377] -- 0:00:21 663500 -- (-1168.345) [-1168.834] (-1167.857) (-1167.212) * (-1171.508) (-1170.013) [-1166.411] (-1167.042) -- 0:00:21 664000 -- (-1169.294) (-1166.321) (-1166.317) [-1166.811] * [-1167.878] (-1167.094) (-1168.746) (-1167.122) -- 0:00:21 664500 -- (-1172.389) [-1168.605] (-1167.700) (-1168.160) * (-1168.277) (-1171.426) (-1166.991) [-1167.962] -- 0:00:21 665000 -- (-1168.607) (-1169.282) (-1169.129) [-1167.118] * (-1168.092) [-1169.035] (-1167.554) (-1167.269) -- 0:00:21 Average standard deviation of split frequencies: 0.010308 665500 -- (-1166.286) (-1168.048) (-1167.766) [-1171.134] * (-1171.757) (-1166.646) (-1166.375) [-1166.481] -- 0:00:21 666000 -- (-1166.915) (-1168.374) [-1171.235] (-1167.209) * (-1172.068) (-1170.018) (-1167.800) [-1167.395] -- 0:00:21 666500 -- (-1169.627) [-1167.526] (-1170.876) (-1169.393) * (-1168.992) (-1168.915) (-1171.612) [-1168.699] -- 0:00:21 667000 -- (-1167.002) [-1166.471] (-1171.670) (-1167.510) * (-1172.152) (-1169.803) (-1167.849) [-1170.186] -- 0:00:21 667500 -- (-1170.131) (-1166.428) [-1169.114] (-1167.749) * (-1169.035) (-1169.443) (-1169.199) [-1166.918] -- 0:00:21 668000 -- (-1170.235) (-1171.349) [-1171.347] (-1166.954) * (-1168.071) (-1169.086) [-1167.924] (-1169.040) -- 0:00:21 668500 -- [-1169.808] (-1169.155) (-1170.937) (-1166.630) * [-1168.832] (-1169.483) (-1167.680) (-1169.947) -- 0:00:21 669000 -- [-1169.438] (-1168.170) (-1168.733) (-1170.040) * (-1168.722) [-1167.122] (-1168.167) (-1169.165) -- 0:00:21 669500 -- (-1166.314) [-1166.741] (-1168.499) (-1170.918) * (-1173.339) [-1172.141] (-1168.160) (-1167.921) -- 0:00:21 670000 -- (-1166.367) (-1171.158) [-1167.253] (-1167.772) * (-1167.917) [-1168.518] (-1171.039) (-1167.018) -- 0:00:21 Average standard deviation of split frequencies: 0.010324 670500 -- (-1167.059) (-1168.277) [-1167.183] (-1169.983) * (-1170.485) [-1173.171] (-1172.047) (-1167.184) -- 0:00:21 671000 -- (-1166.965) [-1167.545] (-1167.456) (-1168.790) * [-1167.219] (-1169.692) (-1168.029) (-1168.737) -- 0:00:21 671500 -- (-1170.756) (-1166.930) [-1167.327] (-1169.186) * [-1167.227] (-1168.470) (-1167.764) (-1167.155) -- 0:00:21 672000 -- (-1170.372) [-1168.579] (-1170.170) (-1168.484) * [-1168.289] (-1167.223) (-1167.159) (-1168.664) -- 0:00:20 672500 -- (-1174.185) (-1168.401) (-1169.117) [-1167.690] * (-1170.859) (-1172.014) [-1168.136] (-1166.228) -- 0:00:20 673000 -- (-1170.887) [-1167.645] (-1168.622) (-1168.832) * (-1167.147) (-1167.602) [-1167.966] (-1166.707) -- 0:00:20 673500 -- (-1171.258) (-1166.581) (-1167.983) [-1168.954] * (-1168.150) (-1167.987) (-1166.083) [-1166.778] -- 0:00:20 674000 -- (-1171.684) (-1170.680) [-1167.815] (-1170.291) * (-1168.897) (-1167.233) [-1166.331] (-1169.824) -- 0:00:20 674500 -- (-1174.077) (-1170.256) (-1167.139) [-1168.221] * (-1168.296) [-1168.547] (-1167.459) (-1171.306) -- 0:00:20 675000 -- [-1169.912] (-1168.968) (-1169.834) (-1168.354) * (-1173.313) (-1168.365) (-1172.093) [-1167.956] -- 0:00:20 Average standard deviation of split frequencies: 0.010155 675500 -- (-1168.269) [-1167.368] (-1168.173) (-1167.878) * (-1172.140) [-1169.451] (-1167.836) (-1167.244) -- 0:00:20 676000 -- (-1167.696) (-1169.788) [-1167.869] (-1167.387) * [-1168.408] (-1168.174) (-1166.837) (-1169.210) -- 0:00:20 676500 -- (-1167.021) (-1169.978) (-1172.214) [-1166.884] * (-1169.520) (-1167.207) [-1169.634] (-1167.080) -- 0:00:20 677000 -- [-1167.008] (-1167.966) (-1169.184) (-1167.740) * (-1167.253) (-1171.255) [-1167.789] (-1166.806) -- 0:00:20 677500 -- (-1167.422) (-1169.271) [-1166.725] (-1167.578) * (-1168.066) [-1170.470] (-1167.861) (-1169.682) -- 0:00:20 678000 -- (-1167.801) (-1168.686) [-1166.683] (-1169.653) * (-1167.454) (-1170.176) [-1168.093] (-1168.953) -- 0:00:20 678500 -- [-1166.951] (-1168.193) (-1171.154) (-1170.197) * (-1166.905) [-1170.779] (-1170.124) (-1166.813) -- 0:00:20 679000 -- [-1166.242] (-1168.492) (-1170.700) (-1175.468) * (-1169.218) [-1168.417] (-1169.460) (-1167.523) -- 0:00:20 679500 -- (-1166.855) (-1167.616) (-1172.774) [-1168.755] * [-1171.934] (-1172.553) (-1169.174) (-1169.779) -- 0:00:20 680000 -- (-1167.450) (-1169.299) (-1169.053) [-1167.167] * [-1168.462] (-1170.307) (-1171.375) (-1169.546) -- 0:00:20 Average standard deviation of split frequencies: 0.010129 680500 -- [-1166.534] (-1167.206) (-1169.436) (-1167.713) * [-1167.398] (-1178.010) (-1168.525) (-1173.613) -- 0:00:20 681000 -- (-1168.298) (-1169.630) (-1167.544) [-1167.821] * (-1166.813) (-1170.741) [-1168.784] (-1178.188) -- 0:00:20 681500 -- (-1168.718) [-1166.870] (-1167.030) (-1166.094) * (-1167.339) [-1168.849] (-1167.843) (-1169.466) -- 0:00:20 682000 -- (-1170.386) (-1168.186) [-1171.256] (-1166.775) * (-1167.029) (-1166.924) [-1169.361] (-1169.424) -- 0:00:20 682500 -- [-1166.691] (-1169.576) (-1169.385) (-1170.582) * [-1167.823] (-1167.497) (-1167.134) (-1168.692) -- 0:00:20 683000 -- (-1167.419) [-1166.338] (-1166.750) (-1171.638) * (-1167.387) (-1167.790) [-1168.102] (-1166.442) -- 0:00:20 683500 -- (-1167.883) (-1168.114) (-1167.063) [-1169.658] * (-1169.046) (-1166.894) [-1167.799] (-1166.160) -- 0:00:20 684000 -- (-1167.732) (-1167.504) (-1166.773) [-1170.337] * (-1168.147) [-1168.990] (-1173.194) (-1166.886) -- 0:00:20 684500 -- [-1170.837] (-1167.503) (-1170.038) (-1166.903) * (-1167.091) [-1166.970] (-1167.303) (-1169.575) -- 0:00:20 685000 -- (-1167.088) (-1167.294) [-1167.653] (-1169.176) * (-1169.190) [-1167.347] (-1169.101) (-1170.324) -- 0:00:20 Average standard deviation of split frequencies: 0.009792 685500 -- (-1166.057) (-1169.646) (-1167.968) [-1168.064] * (-1167.048) (-1167.807) [-1168.876] (-1168.554) -- 0:00:20 686000 -- (-1169.947) (-1166.541) (-1169.958) [-1168.926] * (-1167.460) [-1168.250] (-1168.979) (-1167.995) -- 0:00:20 686500 -- (-1169.216) (-1168.255) (-1171.932) [-1169.513] * (-1168.253) (-1168.520) [-1166.311] (-1168.527) -- 0:00:20 687000 -- (-1166.852) (-1167.754) [-1167.837] (-1171.592) * (-1166.561) (-1166.665) (-1168.549) [-1169.315] -- 0:00:20 687500 -- (-1167.337) [-1167.570] (-1169.175) (-1168.893) * [-1170.770] (-1169.060) (-1167.521) (-1170.152) -- 0:00:20 688000 -- (-1166.533) (-1169.679) [-1166.685] (-1167.897) * (-1168.378) (-1166.946) [-1168.472] (-1173.844) -- 0:00:19 688500 -- (-1167.377) (-1168.696) (-1167.089) [-1169.844] * (-1166.793) (-1168.141) [-1167.015] (-1168.188) -- 0:00:19 689000 -- (-1168.238) [-1169.006] (-1167.023) (-1167.435) * [-1167.059] (-1170.783) (-1173.370) (-1166.448) -- 0:00:19 689500 -- (-1168.952) (-1168.956) [-1167.224] (-1171.468) * (-1172.425) (-1170.876) (-1168.173) [-1166.656] -- 0:00:19 690000 -- (-1167.879) (-1167.542) [-1167.819] (-1167.241) * (-1171.226) (-1169.126) (-1166.303) [-1168.784] -- 0:00:19 Average standard deviation of split frequencies: 0.009555 690500 -- (-1168.868) (-1167.890) [-1166.821] (-1168.849) * (-1168.569) (-1167.281) (-1167.701) [-1167.515] -- 0:00:19 691000 -- (-1167.142) [-1168.930] (-1166.194) (-1166.970) * (-1167.915) [-1168.315] (-1170.382) (-1166.925) -- 0:00:19 691500 -- [-1169.666] (-1172.951) (-1171.762) (-1168.425) * (-1167.832) [-1166.641] (-1169.574) (-1167.154) -- 0:00:19 692000 -- [-1172.956] (-1167.972) (-1168.172) (-1170.016) * (-1169.171) [-1168.379] (-1169.586) (-1167.456) -- 0:00:19 692500 -- (-1169.916) (-1170.405) (-1166.812) [-1168.251] * (-1167.495) (-1166.686) (-1169.768) [-1167.138] -- 0:00:19 693000 -- (-1170.584) (-1178.426) [-1168.313] (-1169.992) * (-1168.766) [-1168.136] (-1167.409) (-1167.433) -- 0:00:19 693500 -- [-1167.387] (-1169.650) (-1167.569) (-1171.609) * [-1167.484] (-1173.239) (-1166.592) (-1170.918) -- 0:00:19 694000 -- (-1170.295) [-1169.204] (-1169.216) (-1168.193) * (-1166.642) (-1169.099) [-1167.843] (-1166.588) -- 0:00:19 694500 -- [-1167.165] (-1166.535) (-1169.297) (-1167.946) * (-1167.457) (-1169.782) [-1167.478] (-1168.436) -- 0:00:19 695000 -- (-1167.767) [-1170.595] (-1167.449) (-1168.963) * (-1171.211) (-1170.680) [-1167.140] (-1169.523) -- 0:00:19 Average standard deviation of split frequencies: 0.009821 695500 -- (-1167.500) (-1167.746) (-1171.459) [-1168.959] * (-1168.801) (-1170.455) (-1171.004) [-1167.786] -- 0:00:19 696000 -- [-1167.981] (-1169.303) (-1166.960) (-1168.225) * [-1168.261] (-1168.850) (-1168.748) (-1167.067) -- 0:00:19 696500 -- (-1169.366) [-1170.496] (-1166.821) (-1168.901) * [-1166.669] (-1172.724) (-1167.554) (-1171.529) -- 0:00:19 697000 -- (-1168.439) (-1167.628) [-1167.175] (-1168.619) * (-1167.729) [-1168.499] (-1171.403) (-1170.939) -- 0:00:19 697500 -- (-1167.864) [-1166.664] (-1166.699) (-1170.080) * (-1168.390) [-1167.972] (-1171.446) (-1167.267) -- 0:00:19 698000 -- (-1169.362) (-1166.719) (-1168.147) [-1167.254] * (-1167.487) (-1167.403) [-1170.144] (-1167.311) -- 0:00:19 698500 -- (-1169.294) [-1166.691] (-1169.197) (-1167.372) * (-1170.592) (-1166.844) [-1171.294] (-1167.734) -- 0:00:19 699000 -- [-1166.304] (-1168.260) (-1168.163) (-1167.085) * (-1169.160) [-1167.184] (-1168.022) (-1168.808) -- 0:00:19 699500 -- (-1167.140) (-1168.243) (-1167.575) [-1168.604] * (-1169.543) (-1167.515) (-1169.601) [-1169.901] -- 0:00:19 700000 -- (-1169.276) (-1171.654) [-1169.188] (-1168.310) * [-1168.586] (-1168.742) (-1168.333) (-1167.042) -- 0:00:19 Average standard deviation of split frequencies: 0.009840 700500 -- (-1167.627) (-1180.928) (-1170.371) [-1167.579] * (-1167.366) (-1170.984) [-1167.339] (-1166.992) -- 0:00:19 701000 -- [-1166.386] (-1171.524) (-1170.088) (-1167.340) * (-1168.616) [-1168.095] (-1166.907) (-1167.891) -- 0:00:19 701500 -- (-1167.383) (-1167.411) [-1170.388] (-1167.999) * (-1168.779) [-1168.090] (-1167.098) (-1168.268) -- 0:00:19 702000 -- (-1167.313) (-1166.228) [-1173.710] (-1168.472) * (-1169.066) (-1168.454) [-1167.885] (-1168.435) -- 0:00:19 702500 -- (-1168.033) (-1168.366) [-1170.675] (-1168.481) * (-1170.467) (-1167.688) [-1168.254] (-1168.188) -- 0:00:19 703000 -- (-1167.646) (-1170.227) [-1168.972] (-1167.146) * [-1167.566] (-1167.954) (-1175.761) (-1171.482) -- 0:00:19 703500 -- (-1167.352) [-1167.903] (-1167.270) (-1168.357) * (-1168.842) (-1167.969) (-1171.625) [-1167.354] -- 0:00:18 704000 -- (-1168.811) (-1167.649) (-1167.244) [-1169.954] * (-1169.004) [-1167.842] (-1171.179) (-1168.988) -- 0:00:18 704500 -- (-1167.947) [-1167.664] (-1171.258) (-1166.725) * (-1167.130) [-1167.838] (-1169.513) (-1168.528) -- 0:00:18 705000 -- (-1167.864) (-1169.768) (-1167.538) [-1169.063] * [-1168.040] (-1169.934) (-1169.140) (-1169.162) -- 0:00:18 Average standard deviation of split frequencies: 0.009765 705500 -- (-1166.706) (-1168.108) (-1167.567) [-1168.410] * (-1166.799) [-1167.622] (-1167.905) (-1168.304) -- 0:00:18 706000 -- [-1166.672] (-1169.080) (-1168.296) (-1167.573) * [-1166.466] (-1167.934) (-1167.545) (-1171.095) -- 0:00:18 706500 -- (-1166.669) [-1168.464] (-1167.540) (-1168.459) * (-1167.406) [-1168.340] (-1170.788) (-1167.748) -- 0:00:18 707000 -- (-1166.847) (-1166.136) (-1170.484) [-1167.981] * [-1168.117] (-1166.872) (-1169.413) (-1172.797) -- 0:00:18 707500 -- [-1169.850] (-1170.451) (-1168.674) (-1168.092) * (-1167.220) [-1168.118] (-1169.585) (-1169.155) -- 0:00:18 708000 -- [-1168.606] (-1169.753) (-1168.829) (-1169.494) * (-1166.161) (-1169.484) (-1166.922) [-1167.165] -- 0:00:18 708500 -- (-1174.614) (-1167.419) [-1167.116] (-1170.293) * (-1167.889) [-1166.737] (-1168.426) (-1168.549) -- 0:00:18 709000 -- (-1172.260) [-1171.610] (-1171.589) (-1167.450) * (-1166.814) (-1166.810) (-1168.375) [-1167.248] -- 0:00:18 709500 -- (-1170.530) [-1167.001] (-1169.708) (-1168.789) * [-1166.506] (-1170.194) (-1169.722) (-1169.516) -- 0:00:18 710000 -- (-1167.028) (-1166.934) (-1167.834) [-1168.236] * (-1171.266) (-1169.221) [-1170.708] (-1166.960) -- 0:00:18 Average standard deviation of split frequencies: 0.010074 710500 -- (-1167.951) [-1167.646] (-1166.273) (-1168.193) * (-1168.605) (-1167.894) (-1168.110) [-1167.051] -- 0:00:18 711000 -- (-1167.804) [-1168.205] (-1170.748) (-1168.341) * (-1167.798) (-1166.799) (-1169.125) [-1166.561] -- 0:00:18 711500 -- (-1167.478) (-1171.933) [-1169.174] (-1171.744) * [-1166.696] (-1166.496) (-1167.310) (-1171.569) -- 0:00:18 712000 -- (-1167.463) [-1169.276] (-1169.394) (-1171.416) * (-1166.504) (-1170.223) (-1168.182) [-1168.128] -- 0:00:18 712500 -- [-1168.587] (-1167.620) (-1169.241) (-1170.759) * (-1167.084) [-1168.792] (-1169.198) (-1170.418) -- 0:00:18 713000 -- (-1167.522) (-1170.594) (-1168.706) [-1168.261] * [-1166.962] (-1167.455) (-1168.077) (-1170.315) -- 0:00:18 713500 -- (-1167.971) (-1167.390) (-1169.193) [-1166.663] * (-1167.115) (-1171.197) [-1169.354] (-1169.022) -- 0:00:18 714000 -- (-1166.814) (-1166.825) [-1167.190] (-1167.331) * (-1167.421) [-1167.593] (-1168.199) (-1166.869) -- 0:00:18 714500 -- (-1166.550) (-1167.999) (-1168.030) [-1168.082] * (-1169.665) [-1166.948] (-1168.184) (-1168.518) -- 0:00:18 715000 -- (-1167.772) [-1168.214] (-1168.051) (-1167.276) * (-1167.840) (-1167.564) [-1167.648] (-1168.247) -- 0:00:18 Average standard deviation of split frequencies: 0.010287 715500 -- (-1166.529) (-1171.262) [-1170.403] (-1169.714) * [-1167.493] (-1167.097) (-1167.247) (-1167.779) -- 0:00:18 716000 -- [-1166.459] (-1167.641) (-1168.895) (-1167.198) * [-1166.541] (-1171.090) (-1167.585) (-1169.783) -- 0:00:18 716500 -- [-1168.592] (-1167.213) (-1166.544) (-1166.317) * (-1166.299) [-1169.422] (-1170.151) (-1169.673) -- 0:00:18 717000 -- (-1169.268) (-1168.071) [-1166.544] (-1167.498) * (-1166.998) (-1173.034) (-1171.096) [-1169.413] -- 0:00:18 717500 -- (-1170.235) (-1171.766) [-1166.557] (-1167.984) * (-1167.166) (-1171.259) [-1173.709] (-1167.278) -- 0:00:18 718000 -- (-1167.584) [-1171.790] (-1169.195) (-1168.069) * (-1166.856) [-1169.389] (-1167.203) (-1169.446) -- 0:00:18 718500 -- (-1169.838) (-1168.902) (-1171.531) [-1167.609] * (-1168.580) (-1169.121) [-1170.001] (-1172.059) -- 0:00:18 719000 -- (-1169.205) (-1167.617) (-1171.717) [-1166.092] * (-1171.198) (-1166.746) [-1168.931] (-1167.783) -- 0:00:17 719500 -- (-1167.632) (-1169.109) (-1167.785) [-1166.724] * (-1172.773) (-1169.962) [-1167.289] (-1173.340) -- 0:00:17 720000 -- (-1169.181) [-1171.213] (-1167.580) (-1171.163) * (-1172.293) [-1169.104] (-1169.051) (-1175.827) -- 0:00:17 Average standard deviation of split frequencies: 0.009975 720500 -- (-1166.308) (-1166.999) [-1168.202] (-1167.084) * (-1168.684) (-1167.903) [-1169.914] (-1176.420) -- 0:00:17 721000 -- [-1166.313] (-1169.324) (-1170.144) (-1166.622) * [-1167.338] (-1167.846) (-1171.179) (-1171.218) -- 0:00:17 721500 -- (-1167.622) [-1167.326] (-1170.583) (-1167.153) * (-1169.219) (-1166.760) [-1168.742] (-1170.399) -- 0:00:17 722000 -- (-1168.361) (-1167.747) [-1168.025] (-1167.965) * (-1168.313) (-1166.562) [-1170.554] (-1166.570) -- 0:00:17 722500 -- (-1168.422) (-1168.643) (-1169.156) [-1167.338] * (-1172.203) (-1166.851) [-1171.148] (-1166.767) -- 0:00:17 723000 -- [-1169.738] (-1168.761) (-1171.562) (-1167.735) * (-1170.583) [-1167.567] (-1168.982) (-1167.160) -- 0:00:17 723500 -- [-1169.210] (-1170.935) (-1176.404) (-1169.911) * (-1171.650) (-1167.127) [-1168.178] (-1168.109) -- 0:00:17 724000 -- [-1170.515] (-1170.359) (-1176.490) (-1166.968) * (-1174.621) (-1167.656) [-1169.982] (-1168.186) -- 0:00:17 724500 -- (-1168.380) (-1169.482) (-1174.311) [-1167.946] * [-1172.419] (-1168.062) (-1168.964) (-1168.609) -- 0:00:17 725000 -- (-1167.770) [-1169.048] (-1170.965) (-1171.096) * (-1167.927) (-1169.480) (-1169.849) [-1169.112] -- 0:00:17 Average standard deviation of split frequencies: 0.009456 725500 -- (-1168.229) [-1169.256] (-1171.888) (-1169.820) * (-1167.581) (-1168.063) (-1167.697) [-1171.261] -- 0:00:17 726000 -- [-1168.238] (-1167.382) (-1174.118) (-1167.232) * (-1169.376) (-1166.986) (-1167.390) [-1168.203] -- 0:00:17 726500 -- (-1169.739) [-1166.921] (-1167.827) (-1167.414) * [-1166.960] (-1166.996) (-1173.179) (-1168.589) -- 0:00:17 727000 -- [-1168.523] (-1167.383) (-1168.505) (-1167.118) * (-1168.270) [-1167.738] (-1167.884) (-1170.058) -- 0:00:17 727500 -- (-1171.769) (-1168.931) (-1168.059) [-1168.641] * (-1170.678) (-1167.181) [-1168.871] (-1168.066) -- 0:00:17 728000 -- (-1169.399) (-1167.887) (-1171.351) [-1169.566] * (-1177.334) [-1169.111] (-1168.623) (-1168.343) -- 0:00:17 728500 -- (-1180.184) (-1168.947) (-1167.703) [-1171.182] * (-1169.745) [-1169.857] (-1168.239) (-1168.987) -- 0:00:17 729000 -- (-1173.962) [-1166.793] (-1168.579) (-1172.779) * (-1168.137) (-1169.869) [-1168.235] (-1170.191) -- 0:00:17 729500 -- (-1169.137) (-1167.696) [-1166.652] (-1169.785) * (-1167.283) (-1171.638) [-1166.969] (-1168.358) -- 0:00:17 730000 -- (-1167.336) [-1168.511] (-1166.477) (-1169.743) * (-1166.800) [-1168.754] (-1167.470) (-1168.585) -- 0:00:17 Average standard deviation of split frequencies: 0.009557 730500 -- (-1167.773) [-1168.453] (-1167.443) (-1171.247) * (-1166.478) [-1167.101] (-1166.687) (-1171.642) -- 0:00:17 731000 -- (-1167.347) [-1167.635] (-1169.420) (-1167.889) * (-1168.739) (-1169.559) [-1166.687] (-1169.872) -- 0:00:17 731500 -- (-1170.785) [-1169.575] (-1167.151) (-1166.844) * (-1169.778) (-1166.776) (-1167.812) [-1168.379] -- 0:00:17 732000 -- (-1167.021) (-1168.894) [-1168.579] (-1168.514) * (-1168.396) (-1167.551) [-1167.088] (-1172.952) -- 0:00:17 732500 -- [-1170.111] (-1166.775) (-1166.480) (-1168.501) * (-1166.804) [-1167.808] (-1167.622) (-1166.673) -- 0:00:17 733000 -- [-1168.237] (-1171.030) (-1168.562) (-1168.205) * [-1169.214] (-1167.789) (-1166.765) (-1167.787) -- 0:00:17 733500 -- (-1167.128) (-1170.244) [-1167.419] (-1168.574) * (-1166.984) (-1167.521) (-1168.581) [-1167.403] -- 0:00:17 734000 -- (-1169.345) (-1173.262) (-1167.433) [-1170.548] * [-1167.771] (-1167.832) (-1169.144) (-1172.029) -- 0:00:17 734500 -- (-1168.075) (-1168.854) (-1168.019) [-1169.121] * (-1169.044) (-1168.406) [-1171.784] (-1171.252) -- 0:00:16 735000 -- (-1172.689) [-1166.780] (-1168.733) (-1168.047) * (-1167.662) (-1168.096) (-1173.339) [-1167.377] -- 0:00:16 Average standard deviation of split frequencies: 0.009007 735500 -- [-1169.670] (-1166.879) (-1168.338) (-1168.040) * (-1168.412) (-1170.700) [-1172.921] (-1167.445) -- 0:00:16 736000 -- (-1169.195) (-1166.513) [-1166.743] (-1168.260) * [-1170.893] (-1169.728) (-1169.843) (-1168.570) -- 0:00:16 736500 -- [-1168.722] (-1167.206) (-1167.823) (-1168.867) * [-1168.830] (-1168.135) (-1169.122) (-1167.252) -- 0:00:16 737000 -- [-1166.900] (-1168.624) (-1167.767) (-1168.076) * (-1167.574) (-1166.661) [-1167.102] (-1169.317) -- 0:00:16 737500 -- (-1172.828) (-1167.664) [-1168.667] (-1166.873) * (-1168.391) [-1168.402] (-1167.434) (-1167.108) -- 0:00:16 738000 -- (-1168.719) (-1167.122) (-1168.680) [-1166.784] * [-1167.180] (-1168.691) (-1167.038) (-1167.013) -- 0:00:16 738500 -- (-1171.875) (-1167.592) [-1169.215] (-1171.596) * (-1167.914) (-1169.531) (-1171.969) [-1167.548] -- 0:00:16 739000 -- (-1169.027) (-1166.769) [-1169.225] (-1170.625) * (-1167.997) [-1168.925] (-1166.951) (-1167.458) -- 0:00:16 739500 -- (-1168.631) [-1167.486] (-1168.436) (-1171.432) * (-1170.583) (-1166.345) [-1166.734] (-1168.261) -- 0:00:16 740000 -- (-1167.474) (-1168.822) [-1167.062] (-1170.484) * (-1168.237) (-1171.935) (-1167.492) [-1167.290] -- 0:00:16 Average standard deviation of split frequencies: 0.008359 740500 -- [-1168.700] (-1168.441) (-1166.703) (-1174.836) * [-1170.472] (-1169.205) (-1167.959) (-1167.341) -- 0:00:16 741000 -- [-1167.975] (-1168.277) (-1165.983) (-1177.687) * (-1167.238) [-1166.920] (-1167.492) (-1166.773) -- 0:00:16 741500 -- [-1170.873] (-1168.709) (-1166.112) (-1169.282) * (-1167.907) (-1169.642) (-1167.348) [-1166.365] -- 0:00:16 742000 -- (-1169.026) [-1167.427] (-1167.139) (-1167.791) * (-1168.430) (-1169.239) [-1167.638] (-1166.322) -- 0:00:16 742500 -- (-1169.854) (-1168.108) [-1168.155] (-1168.275) * [-1169.270] (-1169.712) (-1167.048) (-1167.661) -- 0:00:16 743000 -- [-1170.158] (-1167.727) (-1167.700) (-1167.287) * (-1170.283) (-1169.944) (-1167.072) [-1169.900] -- 0:00:16 743500 -- (-1167.020) (-1171.273) [-1170.031] (-1167.957) * (-1167.512) (-1169.440) (-1166.629) [-1166.421] -- 0:00:16 744000 -- (-1166.384) (-1167.178) (-1168.994) [-1172.794] * (-1167.907) [-1172.085] (-1170.315) (-1169.379) -- 0:00:16 744500 -- (-1167.152) (-1168.143) (-1169.647) [-1170.599] * [-1168.669] (-1170.347) (-1171.038) (-1167.049) -- 0:00:16 745000 -- (-1168.080) (-1172.143) (-1169.107) [-1169.616] * [-1169.088] (-1166.125) (-1167.377) (-1166.294) -- 0:00:16 Average standard deviation of split frequencies: 0.008425 745500 -- (-1169.542) [-1168.862] (-1168.907) (-1169.001) * (-1169.088) (-1169.812) (-1170.433) [-1169.128] -- 0:00:16 746000 -- (-1166.937) (-1169.271) [-1168.448] (-1169.696) * [-1167.204] (-1168.135) (-1171.531) (-1170.866) -- 0:00:16 746500 -- (-1168.044) (-1170.659) [-1172.129] (-1172.295) * (-1169.996) (-1169.119) [-1167.255] (-1166.946) -- 0:00:16 747000 -- (-1170.229) (-1169.076) (-1167.979) [-1168.879] * (-1169.819) (-1166.764) (-1168.108) [-1166.327] -- 0:00:16 747500 -- (-1166.142) (-1170.347) [-1168.252] (-1173.012) * (-1171.209) [-1169.007] (-1169.094) (-1167.059) -- 0:00:16 748000 -- (-1168.198) (-1167.701) [-1168.772] (-1170.272) * (-1169.209) (-1168.078) (-1172.549) [-1170.329] -- 0:00:16 748500 -- [-1170.661] (-1167.762) (-1166.257) (-1170.217) * (-1167.265) (-1168.434) [-1171.725] (-1171.286) -- 0:00:16 749000 -- (-1170.017) (-1171.430) (-1166.475) [-1168.908] * (-1167.994) (-1166.999) (-1174.497) [-1166.762] -- 0:00:16 749500 -- (-1167.488) [-1168.091] (-1169.169) (-1172.965) * (-1168.674) (-1166.837) [-1172.100] (-1166.255) -- 0:00:16 750000 -- [-1169.876] (-1179.019) (-1166.253) (-1167.019) * [-1167.104] (-1167.137) (-1169.166) (-1166.299) -- 0:00:16 Average standard deviation of split frequencies: 0.008666 750500 -- (-1170.536) (-1167.773) (-1166.267) [-1168.398] * (-1168.028) (-1168.978) (-1169.193) [-1167.595] -- 0:00:15 751000 -- (-1167.851) (-1168.975) (-1167.588) [-1169.707] * (-1169.182) [-1168.780] (-1169.540) (-1166.905) -- 0:00:15 751500 -- (-1168.695) (-1167.475) (-1166.821) [-1166.936] * (-1174.750) (-1167.072) [-1170.025] (-1168.626) -- 0:00:15 752000 -- (-1168.853) [-1167.512] (-1167.714) (-1168.339) * (-1166.234) (-1167.651) [-1168.333] (-1167.713) -- 0:00:15 752500 -- (-1167.035) [-1168.248] (-1167.150) (-1171.800) * [-1169.829] (-1168.413) (-1169.378) (-1171.423) -- 0:00:15 753000 -- (-1166.039) [-1167.774] (-1167.970) (-1170.418) * (-1166.527) (-1170.723) [-1167.732] (-1166.150) -- 0:00:15 753500 -- (-1168.640) [-1167.428] (-1168.630) (-1168.885) * (-1168.598) (-1169.740) [-1168.870] (-1167.919) -- 0:00:15 754000 -- [-1167.701] (-1168.931) (-1169.425) (-1169.052) * (-1167.200) (-1169.184) [-1169.688] (-1167.704) -- 0:00:15 754500 -- (-1167.641) (-1166.995) (-1172.680) [-1169.110] * (-1166.562) (-1171.384) [-1167.363] (-1167.372) -- 0:00:15 755000 -- (-1167.161) [-1168.154] (-1167.891) (-1167.453) * [-1168.024] (-1170.838) (-1168.595) (-1172.470) -- 0:00:15 Average standard deviation of split frequencies: 0.008522 755500 -- (-1170.628) (-1169.387) [-1171.931] (-1167.549) * (-1167.649) (-1166.694) [-1166.179] (-1171.212) -- 0:00:15 756000 -- (-1170.655) (-1167.747) [-1166.905] (-1167.714) * (-1173.018) (-1168.862) [-1167.556] (-1170.769) -- 0:00:15 756500 -- (-1169.158) (-1170.783) [-1166.916] (-1168.350) * [-1169.321] (-1166.959) (-1169.697) (-1170.779) -- 0:00:15 757000 -- [-1167.306] (-1169.895) (-1167.514) (-1167.479) * [-1170.776] (-1166.244) (-1170.731) (-1169.821) -- 0:00:15 757500 -- (-1166.760) (-1167.033) [-1167.270] (-1170.154) * [-1167.399] (-1166.618) (-1168.034) (-1170.288) -- 0:00:15 758000 -- (-1172.062) [-1174.091] (-1166.642) (-1167.228) * (-1167.641) (-1171.093) (-1167.530) [-1167.347] -- 0:00:15 758500 -- [-1168.232] (-1169.219) (-1166.987) (-1169.120) * [-1167.475] (-1167.646) (-1167.892) (-1167.985) -- 0:00:15 759000 -- (-1168.546) [-1168.329] (-1167.960) (-1169.136) * (-1174.200) [-1168.084] (-1167.620) (-1170.745) -- 0:00:15 759500 -- (-1170.781) (-1170.985) [-1166.812] (-1167.998) * (-1169.639) (-1170.108) (-1167.894) [-1167.937] -- 0:00:15 760000 -- (-1167.880) (-1172.402) (-1167.177) [-1167.042] * (-1169.369) (-1167.859) [-1170.283] (-1166.456) -- 0:00:15 Average standard deviation of split frequencies: 0.008263 760500 -- (-1169.539) (-1167.806) (-1175.518) [-1166.840] * [-1166.504] (-1170.531) (-1169.459) (-1167.637) -- 0:00:15 761000 -- (-1169.661) (-1171.415) (-1172.819) [-1167.364] * (-1168.268) [-1166.190] (-1168.135) (-1167.548) -- 0:00:15 761500 -- (-1168.298) (-1166.991) [-1169.539] (-1169.117) * [-1169.672] (-1167.158) (-1167.302) (-1167.691) -- 0:00:15 762000 -- [-1167.206] (-1174.151) (-1170.809) (-1167.917) * (-1166.975) (-1171.056) (-1168.065) [-1167.557] -- 0:00:15 762500 -- (-1167.567) (-1168.072) (-1169.609) [-1168.157] * [-1168.706] (-1170.424) (-1168.799) (-1167.069) -- 0:00:15 763000 -- (-1171.915) (-1167.687) (-1167.328) [-1167.399] * (-1170.146) (-1166.735) (-1167.548) [-1169.149] -- 0:00:15 763500 -- (-1175.943) (-1166.796) (-1167.992) [-1169.237] * (-1173.340) (-1167.523) [-1169.251] (-1167.165) -- 0:00:15 764000 -- (-1175.491) (-1167.302) [-1167.605] (-1169.263) * [-1167.687] (-1171.054) (-1169.588) (-1170.511) -- 0:00:15 764500 -- (-1168.483) (-1166.577) [-1167.757] (-1167.218) * (-1166.514) (-1170.123) (-1166.541) [-1166.995] -- 0:00:15 765000 -- [-1169.249] (-1167.243) (-1169.293) (-1167.353) * (-1168.863) [-1170.082] (-1168.525) (-1169.011) -- 0:00:15 Average standard deviation of split frequencies: 0.008462 765500 -- [-1170.750] (-1168.713) (-1169.427) (-1166.227) * (-1167.025) [-1167.245] (-1168.728) (-1168.187) -- 0:00:15 766000 -- (-1171.169) (-1171.285) (-1167.307) [-1166.450] * (-1166.806) (-1168.021) (-1167.409) [-1167.408] -- 0:00:14 766500 -- (-1167.762) (-1170.092) (-1167.903) [-1168.004] * (-1166.276) [-1170.990] (-1168.055) (-1167.532) -- 0:00:14 767000 -- (-1169.490) (-1168.545) (-1168.377) [-1170.290] * (-1166.209) (-1168.243) [-1170.745] (-1166.171) -- 0:00:14 767500 -- (-1168.101) (-1167.138) (-1166.609) [-1166.921] * (-1168.868) (-1169.222) [-1167.812] (-1167.296) -- 0:00:14 768000 -- (-1168.133) [-1167.222] (-1172.514) (-1170.970) * (-1171.469) (-1168.827) (-1166.734) [-1168.505] -- 0:00:14 768500 -- [-1167.258] (-1167.445) (-1168.196) (-1169.831) * (-1168.048) (-1170.589) (-1168.702) [-1168.848] -- 0:00:14 769000 -- (-1167.457) (-1167.425) [-1169.857] (-1170.093) * (-1167.459) [-1168.617] (-1166.927) (-1167.130) -- 0:00:14 769500 -- [-1167.322] (-1169.550) (-1171.175) (-1168.892) * (-1166.773) [-1166.459] (-1166.613) (-1168.794) -- 0:00:14 770000 -- (-1166.066) [-1171.929] (-1172.724) (-1167.084) * (-1169.118) (-1166.421) [-1166.361] (-1167.828) -- 0:00:14 Average standard deviation of split frequencies: 0.008487 770500 -- [-1166.594] (-1167.213) (-1169.801) (-1167.324) * (-1168.265) [-1167.459] (-1166.245) (-1167.871) -- 0:00:14 771000 -- [-1171.625] (-1170.011) (-1166.239) (-1167.814) * (-1168.332) [-1166.747] (-1166.273) (-1167.637) -- 0:00:14 771500 -- [-1167.425] (-1171.871) (-1167.461) (-1167.963) * (-1170.891) [-1166.305] (-1166.498) (-1167.724) -- 0:00:14 772000 -- [-1168.320] (-1167.722) (-1168.895) (-1167.625) * (-1171.478) (-1166.486) (-1166.326) [-1168.454] -- 0:00:14 772500 -- (-1166.234) (-1168.896) [-1167.003] (-1168.452) * (-1167.306) [-1168.076] (-1171.698) (-1174.453) -- 0:00:14 773000 -- [-1168.987] (-1170.637) (-1167.176) (-1169.224) * (-1170.871) (-1166.254) (-1168.048) [-1171.919] -- 0:00:14 773500 -- [-1168.050] (-1166.677) (-1166.586) (-1168.625) * (-1167.252) (-1168.428) [-1166.456] (-1176.961) -- 0:00:14 774000 -- (-1169.721) [-1170.121] (-1167.246) (-1170.192) * [-1167.376] (-1174.268) (-1169.003) (-1167.431) -- 0:00:14 774500 -- [-1168.136] (-1168.804) (-1169.711) (-1167.954) * [-1166.296] (-1169.539) (-1169.009) (-1166.845) -- 0:00:14 775000 -- [-1167.910] (-1169.040) (-1167.721) (-1172.244) * [-1167.125] (-1166.418) (-1169.464) (-1168.566) -- 0:00:14 Average standard deviation of split frequencies: 0.008353 775500 -- (-1166.796) (-1171.629) (-1167.451) [-1170.125] * (-1169.276) (-1166.758) [-1166.905] (-1166.258) -- 0:00:14 776000 -- (-1167.114) (-1167.789) [-1167.542] (-1168.592) * (-1169.993) (-1169.360) [-1168.725] (-1168.683) -- 0:00:14 776500 -- (-1167.553) (-1167.281) (-1167.005) [-1166.969] * (-1169.822) (-1169.072) [-1168.473] (-1167.259) -- 0:00:14 777000 -- (-1168.540) (-1168.243) [-1171.402] (-1169.344) * (-1170.948) [-1170.030] (-1167.333) (-1166.800) -- 0:00:14 777500 -- (-1167.371) [-1166.784] (-1173.587) (-1168.023) * [-1166.907] (-1169.030) (-1169.045) (-1167.057) -- 0:00:14 778000 -- (-1167.968) (-1168.933) [-1170.923] (-1168.297) * (-1165.965) (-1167.012) [-1166.731] (-1168.337) -- 0:00:14 778500 -- [-1167.733] (-1168.711) (-1174.574) (-1167.097) * (-1166.264) (-1168.098) [-1166.228] (-1171.763) -- 0:00:14 779000 -- (-1168.027) [-1166.155] (-1169.535) (-1167.800) * (-1166.707) (-1171.259) [-1167.165] (-1170.682) -- 0:00:14 779500 -- (-1167.621) (-1168.174) [-1167.749] (-1169.409) * (-1170.789) (-1170.528) (-1168.344) [-1169.078] -- 0:00:14 780000 -- (-1168.141) [-1166.647] (-1167.715) (-1169.328) * (-1168.324) (-1170.530) (-1171.625) [-1167.204] -- 0:00:14 Average standard deviation of split frequencies: 0.008529 780500 -- (-1170.906) [-1167.081] (-1167.776) (-1166.623) * (-1170.138) (-1175.209) (-1173.603) [-1167.041] -- 0:00:14 781000 -- (-1169.300) (-1168.143) [-1167.415] (-1166.676) * (-1168.520) (-1173.422) (-1169.262) [-1167.452] -- 0:00:14 781500 -- (-1166.905) [-1169.076] (-1169.278) (-1169.199) * (-1170.541) (-1170.253) [-1167.035] (-1167.527) -- 0:00:13 782000 -- [-1166.937] (-1169.861) (-1169.016) (-1169.621) * (-1169.295) [-1169.562] (-1166.894) (-1168.123) -- 0:00:13 782500 -- [-1167.661] (-1168.871) (-1168.044) (-1168.643) * (-1167.399) (-1169.226) [-1167.496] (-1169.760) -- 0:00:13 783000 -- [-1170.812] (-1172.142) (-1168.061) (-1168.992) * (-1170.958) [-1168.630] (-1170.308) (-1168.707) -- 0:00:13 783500 -- (-1168.919) [-1168.579] (-1166.598) (-1168.296) * [-1168.787] (-1170.057) (-1167.762) (-1166.913) -- 0:00:13 784000 -- (-1168.661) [-1167.777] (-1173.703) (-1169.421) * (-1170.034) [-1167.731] (-1167.808) (-1171.222) -- 0:00:13 784500 -- (-1168.302) [-1167.390] (-1169.619) (-1168.709) * (-1166.399) (-1167.177) [-1168.316] (-1168.224) -- 0:00:13 785000 -- (-1167.492) [-1168.256] (-1167.900) (-1167.178) * (-1167.229) (-1166.892) [-1170.805] (-1167.744) -- 0:00:13 Average standard deviation of split frequencies: 0.008771 785500 -- (-1168.059) (-1167.774) (-1167.165) [-1168.949] * (-1170.839) (-1167.625) (-1166.299) [-1167.053] -- 0:00:13 786000 -- (-1167.105) (-1171.022) [-1168.369] (-1168.246) * [-1169.924] (-1170.902) (-1167.400) (-1167.844) -- 0:00:13 786500 -- [-1170.336] (-1173.805) (-1171.694) (-1168.081) * (-1168.258) [-1171.803] (-1170.857) (-1167.852) -- 0:00:13 787000 -- (-1167.249) (-1166.191) (-1169.565) [-1167.360] * [-1167.653] (-1176.314) (-1170.571) (-1169.244) -- 0:00:13 787500 -- (-1168.947) (-1170.264) [-1166.870] (-1170.987) * (-1172.405) [-1168.771] (-1169.793) (-1169.966) -- 0:00:13 788000 -- [-1166.321] (-1169.604) (-1166.953) (-1168.342) * [-1170.313] (-1167.885) (-1166.721) (-1170.925) -- 0:00:13 788500 -- (-1166.897) [-1167.949] (-1166.604) (-1167.126) * (-1167.074) [-1167.211] (-1169.572) (-1169.913) -- 0:00:13 789000 -- [-1166.445] (-1171.874) (-1168.731) (-1167.264) * (-1168.924) (-1166.997) [-1170.927] (-1168.336) -- 0:00:13 789500 -- (-1166.738) [-1168.169] (-1170.274) (-1170.196) * (-1169.732) (-1167.645) (-1168.773) [-1168.229] -- 0:00:13 790000 -- (-1168.545) (-1168.539) (-1170.647) [-1167.090] * (-1168.212) (-1171.332) [-1172.002] (-1167.304) -- 0:00:13 Average standard deviation of split frequencies: 0.008496 790500 -- (-1166.780) [-1167.815] (-1169.572) (-1168.170) * (-1170.094) [-1167.835] (-1166.993) (-1167.790) -- 0:00:13 791000 -- (-1167.918) (-1167.310) [-1170.130] (-1169.616) * (-1171.725) [-1169.382] (-1169.418) (-1169.082) -- 0:00:13 791500 -- [-1167.974] (-1167.948) (-1171.729) (-1168.520) * (-1172.745) (-1166.949) (-1170.694) [-1167.050] -- 0:00:13 792000 -- [-1168.519] (-1169.690) (-1169.997) (-1170.471) * (-1166.382) (-1167.825) [-1166.823] (-1168.522) -- 0:00:13 792500 -- (-1172.608) [-1168.574] (-1170.060) (-1169.961) * (-1167.805) [-1167.803] (-1166.504) (-1167.712) -- 0:00:13 793000 -- (-1174.427) (-1167.739) [-1166.480] (-1167.035) * (-1171.949) (-1168.017) [-1167.309] (-1166.513) -- 0:00:13 793500 -- (-1166.638) (-1166.578) (-1173.292) [-1167.061] * (-1169.032) (-1166.095) [-1169.523] (-1166.662) -- 0:00:13 794000 -- (-1166.652) (-1167.582) (-1171.662) [-1168.309] * (-1167.201) (-1168.492) (-1167.720) [-1166.694] -- 0:00:13 794500 -- (-1167.300) (-1167.543) [-1169.323] (-1166.306) * [-1169.293] (-1169.315) (-1166.850) (-1167.250) -- 0:00:13 795000 -- (-1168.464) (-1167.450) [-1166.603] (-1169.053) * (-1166.640) (-1166.768) (-1169.738) [-1169.175] -- 0:00:13 Average standard deviation of split frequencies: 0.008513 795500 -- (-1167.376) [-1167.930] (-1168.982) (-1168.738) * (-1170.936) (-1166.874) [-1169.223] (-1167.623) -- 0:00:13 796000 -- (-1168.671) (-1166.150) [-1166.876] (-1170.507) * (-1170.144) (-1166.979) (-1172.069) [-1166.265] -- 0:00:13 796500 -- (-1168.513) (-1168.314) [-1168.209] (-1168.003) * (-1168.770) [-1167.402] (-1170.965) (-1168.047) -- 0:00:13 797000 -- (-1168.648) [-1167.754] (-1168.951) (-1172.257) * (-1167.244) [-1166.813] (-1170.799) (-1167.280) -- 0:00:12 797500 -- [-1168.301] (-1166.723) (-1168.371) (-1169.912) * [-1168.546] (-1167.956) (-1167.893) (-1167.583) -- 0:00:12 798000 -- (-1169.664) [-1166.449] (-1170.100) (-1169.048) * (-1167.134) (-1166.963) [-1167.995] (-1169.310) -- 0:00:12 798500 -- [-1167.395] (-1166.587) (-1170.506) (-1166.670) * (-1166.783) (-1170.717) [-1167.409] (-1166.809) -- 0:00:12 799000 -- (-1168.013) [-1167.731] (-1170.856) (-1166.843) * (-1167.879) (-1169.978) (-1167.210) [-1168.177] -- 0:00:12 799500 -- [-1167.830] (-1168.327) (-1170.231) (-1170.743) * (-1168.714) (-1171.584) (-1166.884) [-1168.267] -- 0:00:12 800000 -- (-1168.364) (-1166.117) [-1169.387] (-1167.204) * (-1169.678) [-1169.094] (-1167.646) (-1167.748) -- 0:00:12 Average standard deviation of split frequencies: 0.008463 800500 -- [-1166.123] (-1167.499) (-1169.444) (-1173.280) * (-1168.538) (-1166.637) [-1167.285] (-1169.548) -- 0:00:12 801000 -- (-1168.309) [-1166.483] (-1173.467) (-1166.460) * (-1168.244) [-1167.222] (-1166.595) (-1170.960) -- 0:00:12 801500 -- (-1171.649) (-1167.073) [-1167.504] (-1170.786) * (-1167.588) (-1169.569) [-1166.185] (-1171.164) -- 0:00:12 802000 -- [-1167.009] (-1169.047) (-1167.042) (-1171.774) * (-1170.840) (-1170.025) (-1169.651) [-1167.747] -- 0:00:12 802500 -- (-1166.703) [-1167.632] (-1167.649) (-1171.539) * (-1169.837) [-1168.446] (-1170.709) (-1173.337) -- 0:00:12 803000 -- [-1166.883] (-1168.350) (-1168.160) (-1169.044) * (-1166.821) [-1168.392] (-1168.481) (-1169.837) -- 0:00:12 803500 -- (-1167.665) [-1168.528] (-1167.180) (-1166.839) * [-1166.087] (-1171.283) (-1167.459) (-1168.320) -- 0:00:12 804000 -- (-1168.747) (-1168.127) (-1168.940) [-1166.835] * (-1166.030) (-1167.268) [-1167.653] (-1168.320) -- 0:00:12 804500 -- [-1169.910] (-1168.752) (-1167.232) (-1168.998) * (-1166.030) (-1168.888) [-1168.506] (-1170.445) -- 0:00:12 805000 -- (-1168.117) [-1167.151] (-1166.781) (-1168.049) * (-1166.779) (-1170.841) (-1170.401) [-1167.397] -- 0:00:12 Average standard deviation of split frequencies: 0.008554 805500 -- [-1167.887] (-1173.949) (-1166.590) (-1167.612) * [-1168.550] (-1170.938) (-1167.767) (-1170.772) -- 0:00:12 806000 -- (-1166.973) (-1173.308) [-1168.417] (-1168.273) * [-1170.225] (-1173.416) (-1169.125) (-1168.266) -- 0:00:12 806500 -- (-1170.101) [-1170.871] (-1168.838) (-1168.921) * (-1169.681) (-1175.018) [-1167.549] (-1166.955) -- 0:00:12 807000 -- (-1166.475) (-1169.669) (-1169.848) [-1168.643] * (-1170.208) (-1172.691) [-1167.853] (-1169.033) -- 0:00:12 807500 -- [-1167.808] (-1166.953) (-1170.863) (-1167.434) * (-1169.070) (-1169.269) (-1168.794) [-1167.878] -- 0:00:12 808000 -- (-1167.808) [-1170.170] (-1167.055) (-1169.685) * (-1169.451) (-1166.526) (-1168.514) [-1166.544] -- 0:00:12 808500 -- (-1169.116) [-1167.115] (-1167.964) (-1167.724) * [-1169.399] (-1168.649) (-1169.556) (-1167.357) -- 0:00:12 809000 -- (-1167.620) [-1166.724] (-1168.317) (-1171.863) * (-1170.817) [-1167.690] (-1172.003) (-1167.371) -- 0:00:12 809500 -- (-1167.459) [-1166.368] (-1167.736) (-1171.479) * (-1167.062) (-1169.376) (-1166.551) [-1167.076] -- 0:00:12 810000 -- (-1169.797) (-1168.006) [-1167.936] (-1167.024) * (-1167.767) (-1170.765) [-1166.202] (-1171.213) -- 0:00:12 Average standard deviation of split frequencies: 0.008141 810500 -- (-1171.834) (-1167.665) [-1168.492] (-1169.877) * (-1168.487) (-1172.093) [-1168.039] (-1170.738) -- 0:00:12 811000 -- (-1170.261) [-1167.756] (-1172.509) (-1167.534) * (-1167.747) [-1169.053] (-1168.998) (-1167.639) -- 0:00:12 811500 -- (-1169.651) (-1167.701) (-1173.345) [-1166.517] * (-1166.357) [-1168.203] (-1166.252) (-1167.576) -- 0:00:12 812000 -- (-1167.271) (-1167.677) [-1172.135] (-1167.478) * (-1167.315) (-1169.834) [-1168.627] (-1167.646) -- 0:00:12 812500 -- (-1168.251) (-1167.935) (-1173.286) [-1169.228] * (-1167.668) (-1166.814) (-1168.260) [-1168.193] -- 0:00:12 813000 -- [-1166.937] (-1167.773) (-1168.518) (-1168.414) * (-1167.126) (-1167.956) [-1167.763] (-1169.636) -- 0:00:11 813500 -- (-1167.835) (-1171.159) (-1168.337) [-1167.996] * (-1170.179) (-1168.866) [-1168.594] (-1166.800) -- 0:00:11 814000 -- [-1167.917] (-1169.449) (-1168.850) (-1168.225) * (-1167.355) (-1167.398) [-1168.131] (-1172.038) -- 0:00:11 814500 -- [-1166.508] (-1171.366) (-1169.375) (-1170.298) * (-1169.936) [-1167.343] (-1168.464) (-1172.807) -- 0:00:11 815000 -- (-1170.875) (-1167.926) [-1169.880] (-1171.120) * (-1167.920) (-1167.299) (-1168.161) [-1170.557] -- 0:00:11 Average standard deviation of split frequencies: 0.008434 815500 -- (-1166.643) (-1167.211) [-1167.739] (-1174.721) * (-1168.604) (-1173.000) [-1168.819] (-1170.976) -- 0:00:11 816000 -- (-1168.310) [-1166.984] (-1169.023) (-1170.590) * (-1169.492) (-1169.788) (-1168.389) [-1169.720] -- 0:00:11 816500 -- (-1171.966) [-1166.100] (-1168.997) (-1168.049) * (-1166.255) (-1168.036) [-1166.795] (-1166.428) -- 0:00:11 817000 -- (-1171.458) (-1166.301) (-1170.078) [-1166.628] * (-1166.799) [-1169.323] (-1167.646) (-1167.273) -- 0:00:11 817500 -- [-1171.020] (-1172.490) (-1168.730) (-1166.613) * (-1169.020) [-1166.998] (-1171.849) (-1167.426) -- 0:00:11 818000 -- (-1167.483) [-1166.959] (-1173.093) (-1168.498) * [-1167.337] (-1167.376) (-1171.572) (-1167.819) -- 0:00:11 818500 -- (-1167.435) (-1167.252) (-1171.166) [-1168.977] * (-1173.112) (-1168.754) [-1173.972] (-1170.880) -- 0:00:11 819000 -- (-1168.986) (-1167.766) [-1170.649] (-1169.147) * (-1168.473) (-1171.750) [-1170.444] (-1168.373) -- 0:00:11 819500 -- (-1170.577) (-1168.568) (-1166.436) [-1170.381] * (-1167.877) (-1169.105) (-1169.028) [-1168.873] -- 0:00:11 820000 -- (-1169.235) [-1170.900] (-1168.021) (-1169.376) * (-1169.256) [-1169.343] (-1169.588) (-1168.535) -- 0:00:11 Average standard deviation of split frequencies: 0.008004 820500 -- [-1167.101] (-1171.584) (-1171.907) (-1168.473) * [-1166.973] (-1169.270) (-1168.375) (-1168.261) -- 0:00:11 821000 -- (-1167.939) (-1169.867) [-1170.109] (-1169.109) * (-1167.105) [-1168.420] (-1167.906) (-1168.019) -- 0:00:11 821500 -- (-1169.833) [-1171.513] (-1169.510) (-1169.017) * (-1168.061) (-1170.867) (-1169.520) [-1168.246] -- 0:00:11 822000 -- (-1172.401) (-1170.194) (-1169.173) [-1166.115] * [-1166.579] (-1168.902) (-1169.592) (-1169.366) -- 0:00:11 822500 -- [-1169.505] (-1169.996) (-1169.538) (-1167.491) * (-1166.446) [-1168.533] (-1167.262) (-1168.496) -- 0:00:11 823000 -- (-1169.016) [-1174.110] (-1167.395) (-1168.880) * (-1167.230) [-1166.461] (-1167.649) (-1175.127) -- 0:00:11 823500 -- (-1167.496) (-1168.884) [-1167.243] (-1166.912) * (-1169.752) (-1166.622) [-1175.537] (-1166.671) -- 0:00:11 824000 -- [-1167.651] (-1167.189) (-1167.097) (-1170.230) * [-1167.527] (-1168.271) (-1173.377) (-1167.509) -- 0:00:11 824500 -- [-1168.454] (-1167.662) (-1169.322) (-1169.137) * (-1168.178) (-1168.586) (-1168.187) [-1167.387] -- 0:00:11 825000 -- (-1168.383) (-1170.008) [-1167.614] (-1169.925) * (-1167.068) [-1168.282] (-1169.100) (-1170.104) -- 0:00:11 Average standard deviation of split frequencies: 0.007952 825500 -- (-1168.541) (-1169.767) (-1168.660) [-1168.400] * (-1167.028) [-1166.456] (-1170.213) (-1170.999) -- 0:00:11 826000 -- (-1169.793) [-1166.113] (-1168.450) (-1169.482) * (-1167.501) (-1167.670) (-1175.597) [-1167.841] -- 0:00:11 826500 -- (-1168.010) (-1167.897) [-1166.464] (-1170.517) * (-1167.000) (-1168.275) (-1173.731) [-1168.776] -- 0:00:11 827000 -- (-1169.596) (-1169.886) (-1166.614) [-1167.368] * [-1170.952] (-1169.360) (-1169.518) (-1167.635) -- 0:00:11 827500 -- [-1167.852] (-1167.839) (-1168.500) (-1167.246) * (-1167.231) [-1167.157] (-1169.561) (-1167.746) -- 0:00:11 828000 -- (-1168.461) [-1169.265] (-1167.493) (-1166.903) * (-1167.473) (-1168.484) [-1167.067] (-1167.961) -- 0:00:11 828500 -- (-1167.201) (-1168.968) (-1168.926) [-1167.057] * (-1169.124) (-1169.806) (-1168.460) [-1169.062] -- 0:00:10 829000 -- (-1172.826) (-1168.282) [-1171.533] (-1166.709) * (-1174.080) [-1168.210] (-1166.899) (-1170.008) -- 0:00:10 829500 -- (-1169.059) (-1168.285) (-1170.950) [-1166.326] * [-1167.599] (-1169.824) (-1166.646) (-1168.507) -- 0:00:10 830000 -- (-1169.652) [-1167.291] (-1168.349) (-1167.892) * (-1168.311) (-1174.686) [-1166.815] (-1167.441) -- 0:00:10 Average standard deviation of split frequencies: 0.007680 830500 -- (-1169.902) (-1166.474) (-1166.572) [-1167.576] * [-1168.132] (-1168.893) (-1167.697) (-1173.813) -- 0:00:10 831000 -- [-1168.637] (-1168.177) (-1168.196) (-1171.155) * (-1172.049) (-1167.757) [-1166.696] (-1168.527) -- 0:00:10 831500 -- (-1170.530) (-1166.542) [-1167.537] (-1169.581) * (-1170.001) (-1172.323) (-1166.696) [-1167.132] -- 0:00:10 832000 -- (-1169.402) (-1167.606) [-1168.809] (-1170.857) * (-1168.267) (-1172.057) [-1170.953] (-1166.876) -- 0:00:10 832500 -- [-1169.047] (-1168.580) (-1169.630) (-1169.820) * [-1167.702] (-1173.510) (-1171.643) (-1167.982) -- 0:00:10 833000 -- (-1171.065) [-1168.353] (-1168.886) (-1170.441) * (-1166.582) (-1173.062) [-1170.272] (-1170.731) -- 0:00:10 833500 -- (-1171.825) (-1167.518) [-1168.661] (-1167.732) * (-1169.734) (-1168.293) [-1167.693] (-1168.247) -- 0:00:10 834000 -- (-1167.254) (-1168.210) [-1168.514] (-1167.706) * (-1170.346) (-1167.478) [-1167.461] (-1170.693) -- 0:00:10 834500 -- (-1167.612) (-1169.562) (-1168.283) [-1171.282] * (-1168.602) [-1168.571] (-1167.450) (-1167.349) -- 0:00:10 835000 -- (-1166.952) [-1172.071] (-1169.262) (-1170.267) * (-1170.745) [-1167.216] (-1169.297) (-1166.678) -- 0:00:10 Average standard deviation of split frequencies: 0.007930 835500 -- [-1166.760] (-1167.875) (-1168.430) (-1172.725) * (-1170.322) (-1168.059) (-1168.711) [-1167.030] -- 0:00:10 836000 -- (-1167.589) (-1169.156) (-1167.919) [-1168.043] * (-1167.700) [-1167.468] (-1167.107) (-1167.153) -- 0:00:10 836500 -- [-1167.766] (-1169.365) (-1167.220) (-1169.337) * [-1167.258] (-1166.775) (-1166.470) (-1168.812) -- 0:00:10 837000 -- (-1167.559) (-1168.014) [-1170.131] (-1168.246) * (-1167.981) [-1166.585] (-1169.632) (-1167.992) -- 0:00:10 837500 -- (-1168.126) (-1168.287) (-1167.053) [-1167.873] * (-1167.407) (-1166.851) (-1166.952) [-1166.777] -- 0:00:10 838000 -- (-1167.086) (-1171.891) [-1169.689] (-1168.474) * (-1166.942) (-1168.541) [-1166.544] (-1168.525) -- 0:00:10 838500 -- [-1167.977] (-1167.250) (-1168.724) (-1170.137) * (-1167.578) [-1167.618] (-1167.812) (-1169.972) -- 0:00:10 839000 -- (-1168.040) (-1166.296) (-1168.393) [-1167.490] * (-1166.790) (-1171.926) [-1167.790] (-1168.540) -- 0:00:10 839500 -- (-1168.138) [-1168.825] (-1169.438) (-1167.138) * (-1166.825) [-1166.433] (-1171.025) (-1168.351) -- 0:00:10 840000 -- (-1167.173) (-1168.858) [-1168.349] (-1170.643) * (-1170.914) (-1168.458) [-1170.216] (-1170.669) -- 0:00:10 Average standard deviation of split frequencies: 0.008131 840500 -- (-1166.530) (-1167.825) [-1168.299] (-1167.710) * (-1166.773) (-1166.773) [-1167.906] (-1167.316) -- 0:00:10 841000 -- (-1166.640) [-1169.039] (-1171.571) (-1168.672) * [-1166.773] (-1167.969) (-1169.013) (-1169.987) -- 0:00:10 841500 -- [-1167.523] (-1169.292) (-1169.202) (-1168.583) * (-1166.048) [-1167.292] (-1167.966) (-1169.198) -- 0:00:10 842000 -- (-1169.918) (-1170.376) [-1170.588] (-1168.737) * [-1166.421] (-1168.024) (-1168.730) (-1173.359) -- 0:00:10 842500 -- [-1167.903] (-1169.734) (-1171.013) (-1167.576) * (-1168.753) (-1167.027) [-1169.181] (-1167.334) -- 0:00:10 843000 -- (-1171.420) (-1170.835) [-1167.283] (-1169.848) * (-1168.737) (-1167.042) [-1166.950] (-1168.129) -- 0:00:10 843500 -- (-1170.523) (-1170.441) [-1168.041] (-1169.362) * (-1168.319) [-1168.077] (-1168.643) (-1173.548) -- 0:00:10 844000 -- (-1171.409) (-1172.132) (-1168.568) [-1166.757] * [-1166.677] (-1170.678) (-1166.469) (-1171.906) -- 0:00:09 844500 -- (-1166.984) [-1166.503] (-1168.952) (-1166.519) * [-1168.590] (-1167.348) (-1167.103) (-1167.853) -- 0:00:09 845000 -- (-1169.362) (-1170.252) (-1167.552) [-1166.782] * (-1167.270) [-1168.243] (-1167.597) (-1169.951) -- 0:00:09 Average standard deviation of split frequencies: 0.007940 845500 -- (-1169.062) (-1167.780) (-1169.226) [-1166.762] * [-1167.647] (-1167.416) (-1167.328) (-1168.791) -- 0:00:09 846000 -- (-1167.820) [-1168.843] (-1169.165) (-1166.620) * (-1170.288) [-1166.719] (-1169.594) (-1168.590) -- 0:00:09 846500 -- [-1167.518] (-1168.326) (-1168.694) (-1166.883) * [-1166.973] (-1168.904) (-1167.582) (-1167.263) -- 0:00:09 847000 -- [-1167.533] (-1170.499) (-1168.511) (-1176.838) * (-1167.307) (-1170.087) [-1167.584] (-1174.385) -- 0:00:09 847500 -- (-1171.252) (-1169.757) (-1168.694) [-1170.626] * (-1168.105) (-1170.518) (-1171.339) [-1168.650] -- 0:00:09 848000 -- (-1167.527) (-1168.901) (-1168.316) [-1171.244] * (-1169.609) (-1168.809) [-1171.118] (-1171.005) -- 0:00:09 848500 -- (-1169.261) (-1169.593) [-1166.480] (-1168.898) * [-1169.697] (-1169.945) (-1169.649) (-1169.689) -- 0:00:09 849000 -- [-1171.279] (-1168.008) (-1166.510) (-1171.361) * [-1172.094] (-1168.195) (-1170.047) (-1171.001) -- 0:00:09 849500 -- (-1171.511) (-1168.906) (-1170.946) [-1166.114] * (-1169.197) (-1168.747) (-1170.081) [-1175.595] -- 0:00:09 850000 -- [-1167.612] (-1169.203) (-1167.813) (-1166.743) * (-1168.711) (-1166.691) [-1169.090] (-1173.504) -- 0:00:09 Average standard deviation of split frequencies: 0.007585 850500 -- (-1169.545) (-1171.043) [-1166.535] (-1169.288) * (-1167.011) [-1166.063] (-1166.855) (-1167.530) -- 0:00:09 851000 -- (-1170.220) [-1167.910] (-1168.614) (-1169.519) * [-1170.251] (-1168.210) (-1167.160) (-1169.654) -- 0:00:09 851500 -- (-1168.678) (-1167.171) (-1168.013) [-1170.493] * [-1167.377] (-1168.576) (-1167.746) (-1166.654) -- 0:00:09 852000 -- [-1167.191] (-1167.044) (-1169.795) (-1169.265) * (-1166.824) (-1167.989) [-1173.332] (-1167.622) -- 0:00:09 852500 -- (-1169.779) (-1167.914) (-1167.597) [-1170.889] * (-1167.486) (-1171.641) [-1171.491] (-1168.441) -- 0:00:09 853000 -- (-1169.997) (-1168.000) (-1167.811) [-1167.748] * (-1170.222) [-1168.140] (-1170.163) (-1169.034) -- 0:00:09 853500 -- (-1168.315) [-1168.172] (-1172.510) (-1166.876) * [-1167.019] (-1167.736) (-1167.608) (-1169.194) -- 0:00:09 854000 -- (-1167.846) (-1166.455) (-1167.760) [-1170.002] * [-1167.124] (-1167.326) (-1170.888) (-1172.380) -- 0:00:09 854500 -- (-1169.746) [-1168.352] (-1170.251) (-1167.581) * (-1166.567) [-1166.922] (-1172.241) (-1169.716) -- 0:00:09 855000 -- (-1166.978) (-1168.190) (-1169.217) [-1167.538] * [-1166.776] (-1168.891) (-1168.417) (-1167.858) -- 0:00:09 Average standard deviation of split frequencies: 0.007607 855500 -- (-1169.934) (-1170.541) (-1168.842) [-1169.707] * (-1166.868) (-1170.266) (-1171.580) [-1167.677] -- 0:00:09 856000 -- (-1167.409) (-1169.326) [-1168.197] (-1169.575) * [-1166.022] (-1168.509) (-1171.420) (-1166.815) -- 0:00:09 856500 -- (-1167.958) [-1168.006] (-1167.390) (-1169.680) * [-1166.011] (-1169.479) (-1168.715) (-1167.211) -- 0:00:09 857000 -- (-1169.873) (-1167.987) (-1168.506) [-1167.493] * [-1169.521] (-1167.442) (-1166.732) (-1168.807) -- 0:00:09 857500 -- [-1170.884] (-1169.967) (-1168.375) (-1167.462) * (-1170.432) (-1171.638) (-1166.840) [-1168.697] -- 0:00:09 858000 -- (-1171.523) [-1169.098] (-1171.711) (-1170.572) * (-1170.077) (-1167.775) [-1167.736] (-1169.676) -- 0:00:09 858500 -- (-1168.999) [-1172.202] (-1169.848) (-1167.698) * (-1167.353) (-1166.905) [-1167.751] (-1168.846) -- 0:00:09 859000 -- (-1167.825) (-1169.597) [-1167.800] (-1168.591) * (-1174.233) [-1167.874] (-1168.392) (-1167.222) -- 0:00:09 859500 -- (-1169.476) (-1169.117) [-1167.998] (-1173.645) * (-1168.161) [-1167.379] (-1168.106) (-1169.339) -- 0:00:08 860000 -- (-1168.823) [-1167.584] (-1168.227) (-1168.706) * [-1171.750] (-1168.691) (-1177.605) (-1168.956) -- 0:00:08 Average standard deviation of split frequencies: 0.007086 860500 -- [-1170.217] (-1170.175) (-1169.064) (-1167.141) * (-1167.641) [-1168.342] (-1169.348) (-1167.244) -- 0:00:08 861000 -- (-1167.920) (-1171.547) (-1170.324) [-1166.186] * (-1168.755) (-1168.414) (-1169.218) [-1167.824] -- 0:00:08 861500 -- (-1170.902) (-1170.154) (-1166.972) [-1166.683] * [-1171.070] (-1169.438) (-1171.320) (-1167.147) -- 0:00:08 862000 -- (-1169.595) (-1166.764) (-1167.504) [-1168.068] * (-1172.105) (-1166.858) [-1168.520] (-1170.107) -- 0:00:08 862500 -- (-1167.045) (-1167.746) [-1168.641] (-1167.799) * (-1169.311) (-1169.412) (-1169.262) [-1170.673] -- 0:00:08 863000 -- (-1167.016) (-1172.247) [-1169.484] (-1167.489) * (-1167.764) (-1168.468) [-1167.037] (-1170.829) -- 0:00:08 863500 -- (-1166.641) (-1170.644) (-1169.518) [-1167.683] * [-1168.575] (-1166.542) (-1166.109) (-1167.500) -- 0:00:08 864000 -- (-1166.619) (-1174.355) [-1169.563] (-1170.714) * (-1170.801) (-1173.589) (-1166.558) [-1167.711] -- 0:00:08 864500 -- [-1166.613] (-1167.597) (-1167.767) (-1169.901) * (-1167.615) (-1169.897) [-1167.638] (-1168.033) -- 0:00:08 865000 -- (-1167.628) (-1167.239) (-1169.688) [-1169.241] * (-1166.962) (-1171.853) [-1166.000] (-1167.505) -- 0:00:08 Average standard deviation of split frequencies: 0.007077 865500 -- (-1168.663) (-1166.748) (-1172.238) [-1167.078] * [-1166.867] (-1167.543) (-1169.909) (-1168.504) -- 0:00:08 866000 -- (-1170.363) (-1169.448) [-1168.272] (-1169.282) * (-1169.491) (-1170.708) [-1169.024] (-1168.288) -- 0:00:08 866500 -- (-1167.221) (-1171.369) (-1168.960) [-1170.718] * (-1168.970) (-1174.807) (-1168.209) [-1169.554] -- 0:00:08 867000 -- [-1167.103] (-1167.364) (-1173.455) (-1169.276) * [-1170.573] (-1168.920) (-1167.082) (-1167.126) -- 0:00:08 867500 -- [-1168.001] (-1169.218) (-1174.391) (-1167.748) * (-1170.384) (-1170.941) (-1166.919) [-1167.900] -- 0:00:08 868000 -- [-1166.659] (-1167.966) (-1171.019) (-1168.294) * (-1166.387) [-1169.124] (-1169.788) (-1168.679) -- 0:00:08 868500 -- (-1172.528) (-1168.591) [-1167.195] (-1167.412) * [-1167.929] (-1168.694) (-1168.096) (-1168.839) -- 0:00:08 869000 -- (-1168.626) (-1170.792) (-1169.506) [-1169.345] * (-1167.362) (-1167.508) (-1174.871) [-1167.321] -- 0:00:08 869500 -- [-1167.216] (-1170.227) (-1170.936) (-1169.443) * (-1167.201) [-1171.814] (-1169.586) (-1166.809) -- 0:00:08 870000 -- (-1167.338) (-1167.476) [-1172.195] (-1168.023) * (-1172.424) (-1167.618) [-1166.910] (-1168.378) -- 0:00:08 Average standard deviation of split frequencies: 0.007377 870500 -- (-1170.926) (-1168.939) (-1168.306) [-1168.940] * (-1168.135) (-1167.478) [-1172.851] (-1169.919) -- 0:00:08 871000 -- (-1170.633) [-1168.111] (-1168.463) (-1167.989) * [-1168.131] (-1169.274) (-1172.003) (-1168.209) -- 0:00:08 871500 -- (-1168.893) (-1167.481) [-1169.314] (-1166.486) * (-1168.444) (-1167.277) [-1170.302] (-1169.419) -- 0:00:08 872000 -- [-1167.954] (-1167.779) (-1174.058) (-1169.144) * (-1166.643) [-1168.118] (-1168.920) (-1169.229) -- 0:00:08 872500 -- (-1167.468) (-1167.003) (-1171.119) [-1169.846] * (-1168.236) [-1166.815] (-1168.808) (-1173.206) -- 0:00:08 873000 -- (-1166.300) [-1166.239] (-1167.578) (-1170.053) * [-1168.228] (-1169.767) (-1168.104) (-1167.959) -- 0:00:08 873500 -- (-1166.300) (-1167.805) [-1166.475] (-1168.415) * (-1167.440) [-1171.019] (-1169.149) (-1168.012) -- 0:00:08 874000 -- (-1168.391) [-1169.160] (-1168.479) (-1168.092) * (-1167.104) (-1167.090) [-1167.199] (-1167.388) -- 0:00:08 874500 -- (-1166.570) [-1172.109] (-1168.550) (-1167.975) * (-1166.579) (-1167.833) [-1168.844] (-1167.430) -- 0:00:08 875000 -- (-1167.900) (-1171.461) [-1168.473] (-1169.714) * (-1168.458) (-1170.246) [-1167.033] (-1172.652) -- 0:00:08 Average standard deviation of split frequencies: 0.007130 875500 -- [-1168.089] (-1168.696) (-1170.320) (-1169.586) * [-1167.842] (-1167.712) (-1174.909) (-1168.551) -- 0:00:07 876000 -- [-1174.458] (-1171.472) (-1167.549) (-1170.556) * [-1167.170] (-1171.596) (-1172.971) (-1168.350) -- 0:00:07 876500 -- (-1172.923) [-1167.389] (-1169.983) (-1168.563) * (-1168.348) (-1167.246) (-1170.322) [-1168.972] -- 0:00:07 877000 -- [-1166.980] (-1167.353) (-1172.251) (-1168.336) * (-1167.533) (-1168.503) [-1169.543] (-1167.688) -- 0:00:07 877500 -- (-1167.300) (-1169.231) (-1168.583) [-1168.002] * [-1168.004] (-1167.165) (-1173.072) (-1168.046) -- 0:00:07 878000 -- [-1168.599] (-1171.360) (-1170.202) (-1169.148) * (-1168.670) (-1170.904) (-1168.740) [-1166.942] -- 0:00:07 878500 -- [-1167.508] (-1170.683) (-1170.046) (-1166.387) * (-1168.904) [-1167.414] (-1170.639) (-1168.327) -- 0:00:07 879000 -- [-1167.332] (-1170.416) (-1174.541) (-1172.599) * (-1168.366) (-1167.376) (-1169.376) [-1168.185] -- 0:00:07 879500 -- (-1167.094) (-1170.936) [-1167.162] (-1167.391) * (-1169.412) [-1167.157] (-1169.104) (-1167.656) -- 0:00:07 880000 -- (-1166.983) [-1169.579] (-1167.552) (-1169.413) * (-1169.745) [-1167.349] (-1168.624) (-1172.148) -- 0:00:07 Average standard deviation of split frequencies: 0.006758 880500 -- [-1169.923] (-1167.365) (-1168.998) (-1166.771) * (-1170.449) (-1169.382) (-1166.171) [-1167.230] -- 0:00:07 881000 -- [-1167.764] (-1166.496) (-1171.073) (-1166.881) * (-1167.857) (-1168.284) [-1166.349] (-1166.795) -- 0:00:07 881500 -- [-1168.590] (-1166.546) (-1168.096) (-1167.338) * (-1170.918) [-1168.668] (-1168.425) (-1166.506) -- 0:00:07 882000 -- [-1168.849] (-1168.059) (-1167.736) (-1167.547) * (-1172.967) [-1168.106] (-1170.208) (-1166.555) -- 0:00:07 882500 -- [-1167.231] (-1168.218) (-1167.120) (-1169.685) * (-1167.784) (-1168.004) (-1169.990) [-1167.052] -- 0:00:07 883000 -- (-1168.654) (-1167.525) (-1167.747) [-1168.522] * (-1176.232) (-1166.494) (-1167.942) [-1167.312] -- 0:00:07 883500 -- (-1167.264) (-1168.230) (-1169.598) [-1167.645] * (-1171.202) (-1166.465) [-1167.477] (-1170.823) -- 0:00:07 884000 -- [-1167.027] (-1168.319) (-1170.767) (-1166.502) * (-1167.371) (-1169.502) [-1168.076] (-1168.143) -- 0:00:07 884500 -- (-1167.518) [-1167.760] (-1170.430) (-1168.111) * (-1168.222) (-1168.519) [-1167.375] (-1169.214) -- 0:00:07 885000 -- (-1166.172) [-1166.758] (-1169.008) (-1168.313) * (-1168.212) (-1167.495) (-1170.446) [-1166.823] -- 0:00:07 Average standard deviation of split frequencies: 0.006717 885500 -- (-1166.608) (-1167.541) (-1166.650) [-1167.957] * [-1168.719] (-1168.920) (-1167.709) (-1166.469) -- 0:00:07 886000 -- [-1168.769] (-1168.800) (-1166.692) (-1169.911) * [-1169.776] (-1169.322) (-1168.121) (-1168.889) -- 0:00:07 886500 -- (-1166.927) [-1168.502] (-1166.673) (-1168.505) * [-1169.358] (-1169.198) (-1173.093) (-1172.080) -- 0:00:07 887000 -- (-1168.510) [-1169.167] (-1166.164) (-1169.167) * (-1170.212) (-1168.290) (-1169.432) [-1169.365] -- 0:00:07 887500 -- (-1166.481) [-1167.959] (-1166.787) (-1166.958) * (-1170.659) [-1169.437] (-1167.861) (-1168.242) -- 0:00:07 888000 -- (-1169.115) (-1166.335) (-1168.137) [-1168.971] * (-1166.814) [-1167.639] (-1168.274) (-1167.281) -- 0:00:07 888500 -- (-1170.546) [-1167.825] (-1170.457) (-1166.376) * [-1168.344] (-1167.822) (-1168.455) (-1168.905) -- 0:00:07 889000 -- (-1169.620) (-1168.076) [-1168.226] (-1167.467) * (-1169.862) (-1168.954) [-1167.098] (-1172.009) -- 0:00:07 889500 -- (-1166.813) (-1166.546) (-1167.158) [-1168.337] * (-1170.101) (-1169.174) [-1168.715] (-1170.084) -- 0:00:07 890000 -- (-1166.402) [-1167.869] (-1167.174) (-1168.973) * (-1168.091) (-1168.345) [-1168.545] (-1167.045) -- 0:00:07 Average standard deviation of split frequencies: 0.006715 890500 -- (-1168.863) [-1167.857] (-1168.761) (-1176.688) * [-1168.390] (-1170.234) (-1167.720) (-1169.667) -- 0:00:07 891000 -- (-1168.444) (-1166.249) [-1171.574] (-1168.134) * (-1168.084) [-1168.404] (-1169.126) (-1169.394) -- 0:00:06 891500 -- (-1170.127) (-1167.375) [-1175.173] (-1167.226) * [-1166.059] (-1173.385) (-1174.152) (-1167.761) -- 0:00:06 892000 -- (-1170.737) (-1167.880) [-1171.914] (-1167.177) * (-1166.306) (-1167.974) (-1170.830) [-1169.409] -- 0:00:06 892500 -- (-1169.525) (-1168.081) [-1173.620] (-1167.798) * [-1166.535] (-1169.738) (-1171.695) (-1166.708) -- 0:00:06 893000 -- (-1166.079) [-1169.484] (-1170.617) (-1168.036) * (-1167.555) [-1169.072] (-1167.856) (-1166.539) -- 0:00:06 893500 -- (-1170.062) (-1169.162) (-1169.718) [-1167.325] * (-1166.919) [-1167.458] (-1168.031) (-1166.836) -- 0:00:06 894000 -- (-1169.590) (-1166.641) (-1166.346) [-1170.818] * (-1166.985) (-1166.662) [-1167.586] (-1167.936) -- 0:00:06 894500 -- (-1168.349) [-1168.525] (-1168.732) (-1170.153) * (-1167.837) (-1173.381) (-1167.196) [-1169.475] -- 0:00:06 895000 -- (-1169.519) (-1170.687) (-1168.682) [-1166.476] * [-1170.052] (-1168.477) (-1170.347) (-1166.983) -- 0:00:06 Average standard deviation of split frequencies: 0.006609 895500 -- [-1169.421] (-1170.774) (-1168.798) (-1166.678) * (-1170.523) (-1169.328) (-1170.253) [-1167.530] -- 0:00:06 896000 -- (-1166.219) [-1167.126] (-1170.219) (-1167.292) * (-1167.789) (-1171.923) (-1168.086) [-1167.814] -- 0:00:06 896500 -- [-1166.098] (-1170.065) (-1169.442) (-1168.332) * (-1168.886) (-1173.577) (-1167.510) [-1168.003] -- 0:00:06 897000 -- (-1170.841) [-1171.078] (-1167.078) (-1169.327) * [-1168.560] (-1173.300) (-1169.075) (-1167.223) -- 0:00:06 897500 -- (-1170.955) [-1169.362] (-1166.327) (-1173.228) * [-1168.639] (-1169.520) (-1168.890) (-1166.962) -- 0:00:06 898000 -- (-1169.955) [-1166.614] (-1168.934) (-1169.401) * (-1169.172) [-1170.214] (-1167.761) (-1168.945) -- 0:00:06 898500 -- (-1169.821) [-1168.585] (-1170.857) (-1173.787) * [-1169.507] (-1171.033) (-1169.920) (-1169.499) -- 0:00:06 899000 -- (-1168.680) [-1166.952] (-1171.609) (-1174.863) * (-1166.902) (-1168.103) (-1167.856) [-1169.040] -- 0:00:06 899500 -- (-1167.401) (-1168.063) [-1169.240] (-1172.597) * [-1169.970] (-1168.130) (-1167.747) (-1168.254) -- 0:00:06 900000 -- (-1167.552) [-1167.750] (-1168.037) (-1169.318) * (-1168.873) (-1167.536) [-1170.343] (-1168.449) -- 0:00:06 Average standard deviation of split frequencies: 0.006510 900500 -- [-1168.612] (-1168.728) (-1168.719) (-1170.417) * (-1169.032) [-1174.820] (-1176.850) (-1168.455) -- 0:00:06 901000 -- (-1167.408) [-1170.146] (-1167.024) (-1166.675) * (-1172.074) (-1168.016) (-1170.585) [-1166.384] -- 0:00:06 901500 -- (-1169.863) (-1166.409) (-1172.678) [-1169.438] * (-1169.687) [-1169.108] (-1169.000) (-1166.947) -- 0:00:06 902000 -- (-1166.942) (-1171.214) (-1171.247) [-1169.605] * [-1166.533] (-1169.259) (-1169.094) (-1166.945) -- 0:00:06 902500 -- (-1167.014) (-1168.530) (-1171.322) [-1167.297] * (-1168.663) [-1169.036] (-1170.613) (-1171.931) -- 0:00:06 903000 -- (-1168.481) (-1169.849) (-1170.177) [-1168.165] * (-1171.821) (-1167.081) (-1166.402) [-1167.785] -- 0:00:06 903500 -- (-1166.536) [-1168.075] (-1169.413) (-1168.314) * (-1169.556) (-1167.603) [-1168.023] (-1167.033) -- 0:00:06 904000 -- [-1167.347] (-1168.100) (-1169.273) (-1168.397) * [-1166.708] (-1171.928) (-1168.829) (-1168.742) -- 0:00:06 904500 -- [-1170.673] (-1167.642) (-1172.096) (-1167.021) * (-1170.264) (-1168.665) (-1171.042) [-1167.351] -- 0:00:06 905000 -- (-1167.721) (-1167.448) (-1170.393) [-1167.496] * (-1166.650) (-1169.079) (-1167.116) [-1165.934] -- 0:00:06 Average standard deviation of split frequencies: 0.006471 905500 -- (-1172.687) (-1168.612) (-1171.805) [-1170.172] * (-1166.503) (-1168.270) [-1167.367] (-1167.320) -- 0:00:06 906000 -- (-1168.770) [-1169.324] (-1171.369) (-1171.233) * [-1167.777] (-1173.467) (-1168.441) (-1168.747) -- 0:00:06 906500 -- (-1169.782) [-1168.538] (-1169.470) (-1170.135) * (-1167.317) (-1168.524) [-1171.354] (-1167.614) -- 0:00:05 907000 -- [-1168.046] (-1170.426) (-1173.336) (-1166.341) * (-1167.996) [-1170.713] (-1168.570) (-1170.211) -- 0:00:05 907500 -- (-1166.606) (-1169.046) (-1169.620) [-1166.080] * (-1168.144) [-1168.927] (-1168.047) (-1168.501) -- 0:00:05 908000 -- (-1167.514) (-1168.090) (-1169.427) [-1167.760] * [-1172.611] (-1168.274) (-1172.769) (-1168.429) -- 0:00:05 908500 -- (-1168.629) [-1167.711] (-1168.954) (-1167.122) * [-1166.064] (-1167.128) (-1171.264) (-1168.589) -- 0:00:05 909000 -- (-1167.163) [-1166.990] (-1166.748) (-1167.231) * (-1169.516) [-1168.909] (-1166.478) (-1167.662) -- 0:00:05 909500 -- (-1168.444) [-1168.882] (-1166.543) (-1166.956) * (-1169.367) [-1167.740] (-1166.335) (-1170.248) -- 0:00:05 910000 -- [-1169.096] (-1167.813) (-1167.448) (-1166.824) * (-1170.889) [-1167.509] (-1167.326) (-1168.872) -- 0:00:05 Average standard deviation of split frequencies: 0.006309 910500 -- [-1167.554] (-1167.988) (-1167.439) (-1168.216) * (-1169.046) (-1167.108) [-1166.546] (-1169.698) -- 0:00:05 911000 -- [-1167.293] (-1171.213) (-1168.439) (-1166.914) * (-1168.487) [-1169.324] (-1168.022) (-1172.791) -- 0:00:05 911500 -- (-1169.368) [-1167.304] (-1169.535) (-1169.886) * (-1167.962) (-1167.172) [-1167.001] (-1170.803) -- 0:00:05 912000 -- (-1167.459) (-1167.501) (-1167.958) [-1167.711] * (-1176.152) (-1168.409) [-1170.267] (-1171.828) -- 0:00:05 912500 -- (-1167.345) (-1167.566) [-1171.340] (-1169.379) * [-1170.404] (-1168.274) (-1166.984) (-1173.833) -- 0:00:05 913000 -- (-1171.388) [-1168.471] (-1174.941) (-1168.791) * (-1168.737) (-1169.756) [-1166.461] (-1167.676) -- 0:00:05 913500 -- (-1166.704) [-1166.098] (-1170.136) (-1169.206) * (-1174.254) (-1168.498) (-1166.672) [-1167.260] -- 0:00:05 914000 -- [-1166.551] (-1166.124) (-1168.006) (-1166.952) * (-1170.172) [-1168.422] (-1168.584) (-1168.390) -- 0:00:05 914500 -- (-1168.780) (-1166.028) (-1170.032) [-1167.211] * (-1171.958) (-1170.283) (-1167.864) [-1170.769] -- 0:00:05 915000 -- (-1170.796) (-1168.014) (-1168.384) [-1174.732] * [-1169.004] (-1170.225) (-1166.832) (-1167.831) -- 0:00:05 Average standard deviation of split frequencies: 0.006497 915500 -- [-1167.844] (-1166.335) (-1170.894) (-1167.333) * (-1167.270) (-1167.878) (-1168.255) [-1170.864] -- 0:00:05 916000 -- (-1170.671) (-1168.171) (-1172.062) [-1169.206] * (-1169.008) [-1169.953] (-1170.739) (-1166.469) -- 0:00:05 916500 -- (-1168.658) (-1167.538) [-1168.224] (-1168.021) * (-1168.440) (-1170.009) (-1168.120) [-1167.816] -- 0:00:05 917000 -- [-1168.232] (-1167.269) (-1168.247) (-1169.103) * (-1170.629) [-1169.031] (-1168.749) (-1167.068) -- 0:00:05 917500 -- (-1167.765) [-1167.796] (-1167.787) (-1171.040) * (-1166.638) [-1170.752] (-1168.946) (-1170.813) -- 0:00:05 918000 -- (-1168.632) [-1173.484] (-1169.929) (-1168.956) * (-1172.128) (-1167.848) (-1172.900) [-1167.710] -- 0:00:05 918500 -- (-1170.639) (-1167.992) [-1167.479] (-1169.774) * [-1172.373] (-1169.826) (-1171.032) (-1167.009) -- 0:00:05 919000 -- (-1169.774) (-1167.709) (-1168.290) [-1168.477] * (-1171.486) (-1169.570) [-1169.819] (-1168.845) -- 0:00:05 919500 -- [-1168.371] (-1166.726) (-1166.634) (-1166.503) * (-1167.231) [-1167.926] (-1169.315) (-1167.217) -- 0:00:05 920000 -- (-1168.156) [-1167.077] (-1171.378) (-1170.741) * [-1166.681] (-1167.564) (-1167.890) (-1168.781) -- 0:00:05 Average standard deviation of split frequencies: 0.006176 920500 -- (-1168.799) (-1169.214) [-1169.843] (-1168.401) * (-1166.594) (-1167.436) [-1167.825] (-1166.150) -- 0:00:05 921000 -- (-1171.593) (-1167.080) (-1168.743) [-1166.445] * (-1166.411) (-1168.985) [-1167.589] (-1167.319) -- 0:00:05 921500 -- (-1176.210) (-1175.083) [-1168.297] (-1166.860) * (-1166.872) (-1168.772) [-1168.853] (-1167.053) -- 0:00:05 922000 -- (-1170.396) (-1173.942) (-1167.377) [-1166.758] * (-1166.759) (-1167.271) [-1168.232] (-1167.068) -- 0:00:04 922500 -- (-1167.596) (-1168.949) (-1167.256) [-1166.767] * [-1171.659] (-1173.105) (-1166.699) (-1167.701) -- 0:00:04 923000 -- (-1174.612) (-1167.766) (-1167.039) [-1168.940] * (-1171.237) [-1170.019] (-1166.735) (-1166.472) -- 0:00:04 923500 -- (-1169.518) (-1170.094) [-1166.423] (-1169.484) * (-1168.332) (-1169.340) (-1168.778) [-1167.738] -- 0:00:04 924000 -- (-1172.215) (-1170.376) [-1168.010] (-1170.947) * [-1167.948] (-1167.682) (-1168.359) (-1167.193) -- 0:00:04 924500 -- (-1168.741) [-1167.870] (-1167.326) (-1169.443) * (-1166.265) [-1166.837] (-1169.054) (-1170.746) -- 0:00:04 925000 -- (-1168.787) [-1166.853] (-1169.598) (-1167.620) * [-1167.910] (-1168.054) (-1166.537) (-1171.305) -- 0:00:04 Average standard deviation of split frequencies: 0.006268 925500 -- (-1167.267) (-1167.868) (-1170.604) [-1168.745] * (-1169.782) [-1166.627] (-1166.182) (-1171.349) -- 0:00:04 926000 -- (-1167.267) (-1170.273) [-1168.283] (-1167.214) * (-1167.320) (-1169.541) (-1166.236) [-1171.957] -- 0:00:04 926500 -- (-1167.165) (-1170.984) (-1168.145) [-1167.213] * (-1168.149) [-1167.322] (-1167.426) (-1166.863) -- 0:00:04 927000 -- (-1168.053) (-1166.810) (-1166.450) [-1169.779] * [-1167.619] (-1170.037) (-1167.509) (-1169.519) -- 0:00:04 927500 -- (-1167.639) (-1167.034) (-1166.608) [-1168.036] * (-1174.159) [-1168.456] (-1168.294) (-1166.593) -- 0:00:04 928000 -- (-1168.283) [-1170.542] (-1167.119) (-1170.415) * (-1168.191) [-1169.319] (-1167.862) (-1166.211) -- 0:00:04 928500 -- (-1168.103) [-1171.001] (-1167.046) (-1166.967) * [-1168.106] (-1167.444) (-1168.156) (-1166.662) -- 0:00:04 929000 -- [-1167.961] (-1168.905) (-1167.567) (-1167.008) * (-1171.257) (-1169.783) (-1168.707) [-1170.251] -- 0:00:04 929500 -- (-1167.063) (-1166.633) (-1168.525) [-1167.944] * [-1166.827] (-1172.050) (-1178.278) (-1167.236) -- 0:00:04 930000 -- [-1166.737] (-1169.194) (-1168.451) (-1167.106) * [-1167.117] (-1173.004) (-1167.235) (-1169.059) -- 0:00:04 Average standard deviation of split frequencies: 0.005825 930500 -- (-1167.725) (-1167.602) [-1167.318] (-1171.657) * [-1166.642] (-1171.629) (-1168.811) (-1169.925) -- 0:00:04 931000 -- (-1169.738) (-1170.940) (-1167.296) [-1170.429] * [-1172.365] (-1167.759) (-1170.291) (-1168.893) -- 0:00:04 931500 -- [-1170.821] (-1166.636) (-1167.584) (-1169.018) * (-1169.992) (-1166.319) [-1167.114] (-1171.712) -- 0:00:04 932000 -- (-1166.428) [-1166.939] (-1167.078) (-1168.368) * (-1167.053) (-1168.119) [-1167.439] (-1169.850) -- 0:00:04 932500 -- (-1169.034) (-1169.665) (-1167.529) [-1168.256] * (-1166.838) [-1167.640] (-1166.855) (-1170.729) -- 0:00:04 933000 -- (-1167.303) [-1168.234] (-1166.450) (-1169.134) * (-1166.705) (-1168.651) [-1170.848] (-1169.203) -- 0:00:04 933500 -- [-1167.243] (-1167.230) (-1167.854) (-1167.314) * (-1166.393) (-1167.916) (-1171.340) [-1166.437] -- 0:00:04 934000 -- [-1167.933] (-1166.956) (-1166.819) (-1169.645) * (-1168.504) [-1167.949] (-1174.444) (-1168.355) -- 0:00:04 934500 -- (-1167.609) [-1166.562] (-1167.162) (-1166.982) * (-1170.656) (-1166.474) [-1167.173] (-1167.289) -- 0:00:04 935000 -- (-1170.568) (-1166.728) [-1167.477] (-1167.530) * (-1170.421) (-1169.929) (-1168.334) [-1167.397] -- 0:00:04 Average standard deviation of split frequencies: 0.005855 935500 -- (-1170.576) (-1173.715) (-1166.495) [-1167.454] * [-1167.433] (-1173.666) (-1167.740) (-1168.613) -- 0:00:04 936000 -- (-1166.740) [-1167.424] (-1166.505) (-1167.802) * (-1169.300) (-1170.999) (-1167.116) [-1168.738] -- 0:00:04 936500 -- (-1167.408) (-1169.432) (-1167.431) [-1168.578] * (-1167.090) (-1170.865) [-1168.408] (-1169.798) -- 0:00:04 937000 -- [-1167.427] (-1169.940) (-1167.579) (-1168.652) * (-1167.010) (-1169.095) [-1169.332] (-1167.989) -- 0:00:03 937500 -- [-1167.570] (-1166.457) (-1167.940) (-1168.309) * (-1170.643) (-1168.680) [-1168.830] (-1169.617) -- 0:00:04 938000 -- (-1167.122) (-1169.458) (-1166.855) [-1168.585] * [-1169.136] (-1168.973) (-1169.908) (-1170.743) -- 0:00:03 938500 -- (-1166.717) (-1166.721) [-1169.085] (-1172.459) * (-1168.018) (-1167.938) (-1166.484) [-1170.602] -- 0:00:03 939000 -- [-1166.624] (-1172.660) (-1167.004) (-1167.418) * (-1167.211) (-1168.778) [-1166.530] (-1166.725) -- 0:00:03 939500 -- (-1169.192) (-1169.602) (-1166.894) [-1166.562] * [-1173.520] (-1168.747) (-1166.874) (-1167.037) -- 0:00:03 940000 -- [-1168.404] (-1170.754) (-1166.634) (-1166.063) * (-1170.757) (-1167.954) (-1166.997) [-1167.471] -- 0:00:03 Average standard deviation of split frequencies: 0.006108 940500 -- [-1170.512] (-1171.532) (-1169.746) (-1168.977) * [-1168.555] (-1168.270) (-1166.988) (-1167.539) -- 0:00:03 941000 -- (-1170.610) (-1169.128) [-1167.299] (-1170.995) * (-1170.354) (-1167.884) (-1170.652) [-1166.615] -- 0:00:03 941500 -- (-1168.875) (-1167.479) (-1169.054) [-1167.891] * [-1170.386] (-1169.093) (-1170.078) (-1167.932) -- 0:00:03 942000 -- (-1167.429) [-1169.773] (-1167.769) (-1168.818) * [-1170.698] (-1169.934) (-1168.682) (-1176.209) -- 0:00:03 942500 -- (-1170.607) (-1166.969) (-1169.581) [-1168.354] * [-1170.090] (-1167.180) (-1170.701) (-1169.371) -- 0:00:03 943000 -- [-1167.075] (-1168.229) (-1167.102) (-1167.753) * (-1170.376) (-1168.788) [-1166.969] (-1169.372) -- 0:00:03 943500 -- (-1167.314) [-1167.471] (-1169.677) (-1172.222) * (-1169.575) (-1169.163) (-1167.150) [-1171.957] -- 0:00:03 944000 -- (-1170.463) (-1168.919) [-1166.583] (-1167.815) * [-1166.532] (-1169.549) (-1166.507) (-1167.350) -- 0:00:03 944500 -- (-1168.772) (-1170.327) (-1171.168) [-1167.663] * (-1166.593) (-1167.605) [-1168.074] (-1169.317) -- 0:00:03 945000 -- (-1167.746) (-1167.941) [-1167.870] (-1169.926) * [-1167.703] (-1169.516) (-1173.918) (-1169.127) -- 0:00:03 Average standard deviation of split frequencies: 0.006229 945500 -- (-1168.166) [-1167.199] (-1167.057) (-1169.425) * (-1168.102) (-1169.349) [-1166.719] (-1167.648) -- 0:00:03 946000 -- [-1167.882] (-1167.374) (-1166.513) (-1167.235) * [-1167.212] (-1167.567) (-1168.671) (-1168.513) -- 0:00:03 946500 -- (-1166.487) (-1166.761) [-1167.256] (-1167.606) * (-1170.162) (-1168.556) (-1167.327) [-1168.297] -- 0:00:03 947000 -- (-1166.209) [-1167.366] (-1173.210) (-1170.680) * [-1168.292] (-1167.605) (-1167.010) (-1171.264) -- 0:00:03 947500 -- [-1166.711] (-1166.778) (-1168.988) (-1168.584) * (-1169.581) [-1168.691] (-1166.917) (-1172.297) -- 0:00:03 948000 -- (-1168.920) [-1168.383] (-1169.856) (-1173.187) * [-1166.324] (-1168.620) (-1171.000) (-1167.186) -- 0:00:03 948500 -- (-1168.731) [-1169.280] (-1167.947) (-1171.262) * [-1166.651] (-1167.948) (-1168.683) (-1167.063) -- 0:00:03 949000 -- [-1166.653] (-1169.977) (-1166.863) (-1170.760) * (-1169.514) [-1166.437] (-1168.998) (-1169.803) -- 0:00:03 949500 -- (-1168.131) (-1169.566) (-1168.239) [-1171.221] * (-1167.000) [-1168.663] (-1166.884) (-1167.768) -- 0:00:03 950000 -- (-1167.617) (-1169.360) [-1167.184] (-1169.321) * (-1168.468) [-1167.639] (-1169.369) (-1166.968) -- 0:00:03 Average standard deviation of split frequencies: 0.006291 950500 -- [-1168.012] (-1167.414) (-1167.074) (-1167.020) * (-1167.895) [-1169.901] (-1173.175) (-1167.463) -- 0:00:03 951000 -- (-1170.757) (-1168.596) (-1167.601) [-1169.242] * [-1168.009] (-1167.212) (-1169.754) (-1167.861) -- 0:00:03 951500 -- (-1167.929) [-1167.716] (-1167.866) (-1174.531) * (-1166.946) (-1167.772) [-1168.082] (-1167.556) -- 0:00:03 952000 -- (-1169.865) [-1167.733] (-1168.600) (-1168.466) * (-1168.629) [-1168.757] (-1168.283) (-1167.556) -- 0:00:03 952500 -- (-1176.625) (-1170.014) [-1167.392] (-1168.920) * [-1167.646] (-1168.070) (-1168.189) (-1167.970) -- 0:00:02 953000 -- (-1172.137) (-1169.188) (-1172.685) [-1167.879] * (-1167.680) [-1173.788] (-1166.432) (-1167.879) -- 0:00:02 953500 -- [-1174.054] (-1168.686) (-1172.355) (-1168.910) * (-1168.291) (-1169.290) [-1167.451] (-1168.349) -- 0:00:02 954000 -- (-1169.766) (-1167.357) [-1171.991] (-1168.140) * (-1168.917) (-1168.924) [-1167.833] (-1168.848) -- 0:00:02 954500 -- (-1171.888) (-1166.964) (-1167.277) [-1167.716] * [-1168.224] (-1170.687) (-1168.250) (-1168.545) -- 0:00:02 955000 -- (-1169.110) (-1169.788) [-1167.420] (-1167.400) * (-1166.965) (-1169.545) [-1168.387] (-1170.879) -- 0:00:02 Average standard deviation of split frequencies: 0.006318 955500 -- [-1167.828] (-1168.842) (-1166.825) (-1167.618) * [-1166.699] (-1168.803) (-1167.931) (-1170.984) -- 0:00:02 956000 -- (-1168.913) [-1167.955] (-1167.169) (-1170.720) * (-1167.208) (-1168.365) [-1167.720] (-1166.704) -- 0:00:02 956500 -- [-1168.985] (-1169.409) (-1167.410) (-1167.643) * (-1167.090) (-1168.476) [-1168.343] (-1168.089) -- 0:00:02 957000 -- (-1169.193) (-1168.780) [-1167.288] (-1168.635) * (-1170.508) [-1173.041] (-1166.314) (-1167.828) -- 0:00:02 957500 -- (-1168.618) (-1168.084) (-1166.745) [-1167.162] * (-1169.508) [-1171.124] (-1168.447) (-1171.266) -- 0:00:02 958000 -- (-1168.714) [-1167.339] (-1166.578) (-1167.027) * (-1169.649) [-1167.588] (-1167.785) (-1168.287) -- 0:00:02 958500 -- [-1168.286] (-1168.615) (-1170.772) (-1166.745) * (-1167.291) (-1169.203) [-1168.610] (-1169.490) -- 0:00:02 959000 -- (-1167.630) (-1167.406) [-1170.385] (-1166.420) * [-1169.617] (-1170.809) (-1166.208) (-1167.737) -- 0:00:02 959500 -- (-1167.090) (-1176.702) (-1170.858) [-1168.119] * (-1170.002) [-1168.307] (-1167.017) (-1166.734) -- 0:00:02 960000 -- [-1168.921] (-1174.022) (-1167.267) (-1166.562) * [-1166.800] (-1167.817) (-1175.911) (-1172.612) -- 0:00:02 Average standard deviation of split frequencies: 0.006164 960500 -- (-1167.177) [-1167.575] (-1167.807) (-1170.034) * [-1166.830] (-1167.249) (-1167.777) (-1167.043) -- 0:00:02 961000 -- (-1168.421) (-1166.826) [-1170.474] (-1169.414) * [-1168.925] (-1167.466) (-1172.999) (-1169.504) -- 0:00:02 961500 -- (-1170.336) (-1168.802) [-1170.689] (-1169.935) * (-1172.641) (-1170.075) [-1168.178] (-1166.681) -- 0:00:02 962000 -- (-1170.874) [-1169.172] (-1167.839) (-1172.337) * (-1168.133) [-1168.115] (-1168.392) (-1167.734) -- 0:00:02 962500 -- (-1168.742) (-1167.921) (-1170.313) [-1168.293] * (-1171.820) (-1169.059) (-1167.591) [-1168.140] -- 0:00:02 963000 -- [-1171.243] (-1181.320) (-1168.389) (-1172.666) * (-1172.690) [-1170.898] (-1167.969) (-1168.106) -- 0:00:02 963500 -- (-1170.902) (-1171.088) [-1168.214] (-1168.574) * (-1167.515) (-1169.582) [-1168.833] (-1172.150) -- 0:00:02 964000 -- [-1170.456] (-1169.896) (-1167.649) (-1168.096) * (-1168.506) (-1167.891) (-1167.607) [-1167.025] -- 0:00:02 964500 -- (-1166.757) (-1169.651) (-1167.357) [-1168.621] * (-1169.955) (-1169.203) [-1166.378] (-1167.556) -- 0:00:02 965000 -- [-1169.250] (-1169.348) (-1168.712) (-1167.299) * [-1167.663] (-1167.166) (-1170.701) (-1169.106) -- 0:00:02 Average standard deviation of split frequencies: 0.005978 965500 -- (-1167.981) [-1166.610] (-1169.229) (-1167.434) * [-1169.590] (-1169.585) (-1166.592) (-1167.943) -- 0:00:02 966000 -- (-1167.453) [-1170.013] (-1166.845) (-1171.426) * (-1171.934) (-1170.382) [-1167.615] (-1168.020) -- 0:00:02 966500 -- (-1168.636) (-1169.507) [-1167.661] (-1169.424) * (-1169.081) (-1168.761) [-1168.931] (-1172.157) -- 0:00:02 967000 -- (-1169.221) [-1167.450] (-1171.056) (-1167.257) * (-1168.575) (-1167.722) (-1169.551) [-1167.217] -- 0:00:02 967500 -- (-1167.260) [-1174.001] (-1169.601) (-1167.709) * [-1166.475] (-1166.458) (-1170.587) (-1166.718) -- 0:00:02 968000 -- (-1167.413) (-1170.411) [-1172.216] (-1170.536) * [-1166.863] (-1166.729) (-1169.185) (-1169.027) -- 0:00:02 968500 -- (-1167.703) (-1170.906) (-1169.402) [-1166.158] * (-1169.367) (-1166.702) (-1167.412) [-1169.319] -- 0:00:01 969000 -- (-1168.166) (-1169.366) (-1168.534) [-1167.696] * (-1168.944) (-1167.091) [-1166.698] (-1168.367) -- 0:00:01 969500 -- (-1170.236) (-1169.376) [-1172.845] (-1168.621) * (-1169.030) [-1169.257] (-1167.336) (-1168.466) -- 0:00:01 970000 -- (-1172.048) [-1167.434] (-1169.501) (-1167.151) * (-1168.128) [-1166.387] (-1168.182) (-1167.998) -- 0:00:01 Average standard deviation of split frequencies: 0.006313 970500 -- [-1170.275] (-1167.211) (-1166.398) (-1169.072) * (-1167.415) (-1167.249) [-1167.045] (-1169.951) -- 0:00:01 971000 -- [-1166.803] (-1167.138) (-1166.399) (-1170.506) * (-1172.050) (-1171.366) [-1167.904] (-1169.608) -- 0:00:01 971500 -- (-1167.733) (-1168.613) [-1168.042] (-1168.484) * (-1171.388) [-1166.988] (-1168.094) (-1169.449) -- 0:00:01 972000 -- [-1167.493] (-1169.597) (-1167.042) (-1172.126) * (-1169.364) (-1169.419) [-1166.364] (-1167.429) -- 0:00:01 972500 -- (-1167.207) (-1169.393) (-1168.325) [-1169.881] * (-1167.332) (-1171.946) (-1166.860) [-1169.206] -- 0:00:01 973000 -- (-1169.860) (-1166.754) [-1166.341] (-1167.891) * [-1167.279] (-1167.945) (-1166.773) (-1167.366) -- 0:00:01 973500 -- [-1168.656] (-1167.811) (-1166.273) (-1168.596) * (-1172.692) [-1170.112] (-1169.457) (-1169.531) -- 0:00:01 974000 -- (-1167.975) [-1168.909] (-1168.753) (-1168.422) * [-1166.611] (-1167.694) (-1172.679) (-1168.052) -- 0:00:01 974500 -- (-1166.546) (-1170.022) [-1167.177] (-1166.275) * [-1167.974] (-1168.001) (-1167.748) (-1168.637) -- 0:00:01 975000 -- (-1166.476) [-1169.888] (-1168.189) (-1166.721) * (-1167.081) [-1167.700] (-1168.631) (-1168.534) -- 0:00:01 Average standard deviation of split frequencies: 0.006219 975500 -- (-1166.523) (-1168.974) (-1168.898) [-1169.020] * (-1166.951) (-1168.488) [-1168.430] (-1167.753) -- 0:00:01 976000 -- (-1174.278) (-1169.827) (-1168.603) [-1170.821] * (-1167.780) [-1167.352] (-1167.879) (-1167.804) -- 0:00:01 976500 -- (-1168.715) (-1167.910) [-1166.390] (-1166.679) * [-1172.077] (-1167.260) (-1168.740) (-1167.755) -- 0:00:01 977000 -- [-1170.487] (-1166.899) (-1166.305) (-1167.658) * (-1166.676) [-1167.576] (-1167.310) (-1166.776) -- 0:00:01 977500 -- (-1168.044) (-1169.708) [-1167.703] (-1167.298) * [-1170.418] (-1167.782) (-1167.736) (-1167.249) -- 0:00:01 978000 -- (-1168.510) [-1168.040] (-1169.985) (-1168.096) * (-1167.887) [-1169.463] (-1168.384) (-1168.662) -- 0:00:01 978500 -- (-1168.715) [-1166.668] (-1171.385) (-1170.334) * (-1167.035) (-1166.907) (-1169.245) [-1168.212] -- 0:00:01 979000 -- [-1168.571] (-1166.823) (-1168.213) (-1173.016) * (-1168.047) (-1168.085) (-1166.896) [-1166.952] -- 0:00:01 979500 -- (-1169.171) (-1167.808) [-1167.478] (-1167.806) * (-1170.942) (-1167.472) [-1167.736] (-1169.199) -- 0:00:01 980000 -- (-1166.348) [-1168.402] (-1167.512) (-1168.547) * (-1167.905) [-1167.571] (-1170.041) (-1168.919) -- 0:00:01 Average standard deviation of split frequencies: 0.005768 980500 -- (-1166.530) (-1168.803) (-1166.582) [-1168.434] * [-1166.098] (-1170.068) (-1167.593) (-1172.521) -- 0:00:01 981000 -- (-1168.092) (-1172.004) (-1166.265) [-1170.097] * (-1166.424) (-1171.604) (-1168.385) [-1169.200] -- 0:00:01 981500 -- (-1168.629) (-1175.636) (-1167.208) [-1167.999] * [-1167.090] (-1167.068) (-1167.296) (-1172.399) -- 0:00:01 982000 -- (-1172.008) (-1167.263) (-1172.100) [-1167.261] * [-1168.243] (-1168.239) (-1168.851) (-1177.522) -- 0:00:01 982500 -- (-1172.377) [-1170.223] (-1168.412) (-1169.467) * [-1168.466] (-1169.696) (-1168.374) (-1170.156) -- 0:00:01 983000 -- [-1172.140] (-1170.934) (-1166.517) (-1168.337) * (-1167.457) (-1170.040) (-1166.905) [-1173.445] -- 0:00:01 983500 -- (-1171.032) (-1171.904) (-1168.304) [-1169.934] * (-1170.688) [-1167.741] (-1167.412) (-1171.318) -- 0:00:01 984000 -- (-1168.658) (-1167.579) [-1167.140] (-1168.729) * (-1167.521) [-1166.538] (-1170.157) (-1171.555) -- 0:00:01 984500 -- (-1169.265) (-1170.227) [-1166.844] (-1166.370) * (-1169.336) (-1167.337) [-1166.327] (-1174.282) -- 0:00:00 985000 -- (-1167.582) [-1170.359] (-1166.839) (-1168.508) * (-1170.033) (-1172.263) [-1166.690] (-1168.410) -- 0:00:00 Average standard deviation of split frequencies: 0.005648 985500 -- (-1173.049) [-1167.557] (-1166.904) (-1168.181) * (-1170.703) [-1167.488] (-1166.716) (-1168.837) -- 0:00:00 986000 -- [-1167.657] (-1168.385) (-1170.157) (-1166.741) * [-1171.935] (-1167.916) (-1167.622) (-1168.412) -- 0:00:00 986500 -- (-1168.643) (-1168.755) (-1168.158) [-1166.504] * (-1167.281) (-1168.470) (-1170.374) [-1166.985] -- 0:00:00 987000 -- (-1167.071) (-1167.543) [-1166.944] (-1166.439) * (-1168.640) (-1167.604) (-1167.754) [-1167.792] -- 0:00:00 987500 -- [-1168.348] (-1168.800) (-1172.388) (-1166.990) * (-1166.926) (-1173.941) [-1167.207] (-1167.353) -- 0:00:00 988000 -- [-1166.475] (-1169.831) (-1168.451) (-1169.116) * (-1169.229) [-1167.221] (-1167.772) (-1168.511) -- 0:00:00 988500 -- (-1167.471) (-1170.391) [-1168.901] (-1169.832) * (-1168.788) (-1167.709) [-1168.899] (-1167.800) -- 0:00:00 989000 -- [-1168.963] (-1167.489) (-1170.609) (-1168.907) * [-1167.997] (-1167.224) (-1170.772) (-1167.952) -- 0:00:00 989500 -- (-1166.286) (-1167.921) [-1171.114] (-1169.908) * (-1169.114) (-1168.961) [-1169.623] (-1171.510) -- 0:00:00 990000 -- (-1166.484) [-1168.107] (-1168.978) (-1169.254) * (-1172.720) (-1170.387) [-1168.926] (-1167.909) -- 0:00:00 Average standard deviation of split frequencies: 0.005442 990500 -- [-1166.627] (-1169.197) (-1167.216) (-1169.172) * [-1167.972] (-1167.783) (-1169.727) (-1167.105) -- 0:00:00 991000 -- (-1167.023) (-1167.445) (-1167.466) [-1169.725] * [-1170.589] (-1168.711) (-1166.630) (-1168.902) -- 0:00:00 991500 -- (-1167.326) (-1167.508) (-1166.176) [-1169.432] * (-1169.093) [-1167.782] (-1166.709) (-1169.064) -- 0:00:00 992000 -- [-1169.487] (-1168.153) (-1167.388) (-1168.823) * (-1169.030) (-1168.789) [-1167.514] (-1170.023) -- 0:00:00 992500 -- (-1170.975) (-1167.031) (-1168.667) [-1169.833] * (-1168.264) (-1167.574) [-1168.914] (-1168.033) -- 0:00:00 993000 -- [-1167.664] (-1168.845) (-1168.070) (-1170.171) * (-1166.617) (-1169.416) [-1166.353] (-1170.539) -- 0:00:00 993500 -- [-1168.689] (-1168.057) (-1169.064) (-1167.959) * (-1167.936) (-1167.376) (-1168.222) [-1167.082] -- 0:00:00 994000 -- [-1166.730] (-1168.202) (-1166.673) (-1167.333) * (-1167.842) (-1166.354) (-1166.885) [-1168.960] -- 0:00:00 994500 -- (-1168.682) [-1166.961] (-1167.312) (-1168.393) * (-1168.962) [-1166.384] (-1167.385) (-1169.126) -- 0:00:00 995000 -- (-1166.995) (-1168.320) (-1169.518) [-1170.081] * (-1168.609) (-1168.220) [-1170.383] (-1170.908) -- 0:00:00 Average standard deviation of split frequencies: 0.005413 995500 -- (-1166.549) [-1167.280] (-1167.543) (-1167.018) * [-1170.983] (-1167.934) (-1168.682) (-1169.671) -- 0:00:00 996000 -- [-1170.505] (-1166.858) (-1170.148) (-1168.602) * [-1168.115] (-1168.785) (-1167.846) (-1170.448) -- 0:00:00 996500 -- (-1168.868) (-1167.067) [-1167.168] (-1167.935) * (-1167.144) [-1166.224] (-1171.138) (-1168.281) -- 0:00:00 997000 -- (-1172.185) [-1167.747] (-1171.423) (-1168.587) * (-1167.660) (-1167.738) (-1169.231) [-1167.837] -- 0:00:00 997500 -- (-1167.398) (-1167.301) (-1170.231) [-1168.138] * (-1169.089) [-1167.372] (-1167.114) (-1167.070) -- 0:00:00 998000 -- [-1169.563] (-1169.621) (-1171.267) (-1168.290) * (-1168.092) [-1170.173] (-1167.071) (-1172.248) -- 0:00:00 998500 -- (-1174.244) (-1169.548) (-1167.874) [-1168.063] * (-1168.748) (-1166.443) (-1167.786) [-1173.774] -- 0:00:00 999000 -- (-1169.222) [-1167.120] (-1168.989) (-1167.864) * (-1168.031) (-1169.162) [-1167.847] (-1174.372) -- 0:00:00 999500 -- (-1169.169) [-1167.818] (-1168.312) (-1167.047) * (-1167.504) [-1171.571] (-1168.459) (-1168.250) -- 0:00:00 1000000 -- [-1167.897] (-1168.092) (-1168.706) (-1169.393) * (-1172.811) (-1170.382) (-1170.944) [-1167.497] -- 0:00:00 Average standard deviation of split frequencies: 0.005241 Analysis completed in 1 mins 3 seconds Analysis used 62.17 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1165.92 Likelihood of best state for "cold" chain of run 2 was -1165.92 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.5 % ( 59 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.6 % ( 31 %) Dirichlet(Pi{all}) 28.5 % ( 21 %) Slider(Pi{all}) 79.1 % ( 53 %) Multiplier(Alpha{1,2}) 78.2 % ( 58 %) Multiplier(Alpha{3}) 19.2 % ( 30 %) Slider(Pinvar{all}) 98.7 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 76 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 82 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 22 %) Multiplier(V{all}) 97.3 % ( 99 %) Nodeslider(V{all}) 30.4 % ( 26 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 76.6 % ( 68 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 26.3 % ( 30 %) Dirichlet(Pi{all}) 28.0 % ( 20 %) Slider(Pi{all}) 78.3 % ( 59 %) Multiplier(Alpha{1,2}) 77.9 % ( 49 %) Multiplier(Alpha{3}) 18.7 % ( 30 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 63 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.2 % ( 94 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 25 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.7 % ( 28 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 167228 0.83 0.67 3 | 166261 166467 0.84 4 | 166261 166895 166888 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166888 0.82 0.67 3 | 166687 166603 0.84 4 | 166681 166356 166785 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1167.68 | 1 1 1 2 1 | | 2 2 2 2 | | 2 2 1 2 1 | | 1 21 1 22 1 | | 2 1 2 2 2 * 2 1 22 | |1 1 1 1 1 12 1 * 1 * 1 * 2 | | 2 12 2 1 2 2 2 1 2 1 2 1 1 1| |2 22 22 2 2 1 1 1 12 1 1 2 2 1 | | 1 2 1 2 2 1 2 2| | 1 1 1 1 1 2 * 2 * | | 1 21 12 1 2 1 | | 2 2 1 | | 1 2 2 2 | | 1 1 1 1 | | 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1169.24 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1167.65 -1170.95 2 -1167.61 -1170.80 -------------------------------------- TOTAL -1167.63 -1170.88 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899955 0.090754 0.379139 1.532987 0.859462 1314.91 1342.78 1.000 r(A<->C){all} 0.175971 0.021783 0.000070 0.461744 0.137083 215.11 296.77 1.001 r(A<->G){all} 0.172260 0.021551 0.000032 0.469017 0.129672 110.33 119.06 1.000 r(A<->T){all} 0.164051 0.018649 0.000091 0.444509 0.128633 219.27 312.50 1.000 r(C<->G){all} 0.161184 0.019642 0.000171 0.439103 0.123554 245.33 278.74 1.000 r(C<->T){all} 0.163311 0.020204 0.000159 0.458815 0.124742 142.67 169.67 1.000 r(G<->T){all} 0.163223 0.018964 0.000071 0.426802 0.126476 247.69 248.71 1.006 pi(A){all} 0.166333 0.000160 0.141820 0.190354 0.165696 1122.02 1311.51 1.000 pi(C){all} 0.326052 0.000254 0.296385 0.358033 0.326009 1043.87 1206.46 1.000 pi(G){all} 0.314931 0.000238 0.283321 0.343901 0.314981 1276.25 1388.62 1.000 pi(T){all} 0.192684 0.000180 0.167199 0.218646 0.192189 1332.92 1346.82 1.000 alpha{1,2} 0.431898 0.225550 0.000126 1.361259 0.265020 1177.87 1276.18 1.000 alpha{3} 0.454786 0.229382 0.000169 1.377253 0.308068 1152.54 1170.48 1.001 pinvar{all} 0.998261 0.000005 0.994368 0.999999 0.998918 1396.68 1415.07 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .**.** 8 -- .*...* 9 -- .***.* 10 -- ..*.*. 11 -- ...*.* 12 -- ...**. 13 -- .****. 14 -- ..*..* 15 -- .**... 16 -- .*.*** 17 -- ..**.. 18 -- .*..*. 19 -- ..**** 20 -- .*.*.. 21 -- ....** 22 -- .**.*. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 458 0.152565 0.003769 0.149900 0.155230 2 8 453 0.150899 0.007066 0.145903 0.155896 2 9 447 0.148901 0.003298 0.146569 0.151233 2 10 443 0.147568 0.000471 0.147235 0.147901 2 11 440 0.146569 0.000942 0.145903 0.147235 2 12 434 0.144570 0.003769 0.141905 0.147235 2 13 431 0.143571 0.003298 0.141239 0.145903 2 14 426 0.141905 0.005653 0.137908 0.145903 2 15 423 0.140906 0.010835 0.133245 0.148568 2 16 422 0.140573 0.001884 0.139241 0.141905 2 17 418 0.139241 0.005653 0.135243 0.143238 2 18 417 0.138907 0.006124 0.134577 0.143238 2 19 414 0.137908 0.012248 0.129247 0.146569 2 20 409 0.136243 0.000471 0.135909 0.136576 2 21 402 0.133911 0.004711 0.130580 0.137242 2 22 289 0.096269 0.013662 0.086609 0.105929 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.099616 0.009498 0.000014 0.293750 0.071182 1.000 2 length{all}[2] 0.103673 0.010775 0.000014 0.314532 0.070967 1.000 2 length{all}[3] 0.102627 0.010123 0.000158 0.300815 0.072383 1.000 2 length{all}[4] 0.099297 0.010089 0.000087 0.302453 0.068286 1.000 2 length{all}[5] 0.099794 0.010531 0.000049 0.305785 0.067649 1.000 2 length{all}[6] 0.096274 0.009496 0.000031 0.290042 0.066617 1.000 2 length{all}[7] 0.092593 0.007948 0.000001 0.276740 0.066998 1.000 2 length{all}[8] 0.092858 0.007517 0.000183 0.262370 0.069522 1.000 2 length{all}[9] 0.105807 0.011782 0.000034 0.326471 0.076891 0.999 2 length{all}[10] 0.103513 0.010337 0.000393 0.328994 0.072386 0.998 2 length{all}[11] 0.101739 0.009866 0.000026 0.300933 0.072273 0.999 2 length{all}[12] 0.095351 0.009268 0.000353 0.260828 0.067202 1.000 2 length{all}[13] 0.102948 0.011445 0.000334 0.292720 0.076132 0.998 2 length{all}[14] 0.097492 0.009089 0.000050 0.266761 0.065970 0.999 2 length{all}[15] 0.099697 0.010807 0.000435 0.301503 0.065746 0.998 2 length{all}[16] 0.097664 0.010239 0.000069 0.314025 0.059326 1.004 2 length{all}[17] 0.099166 0.009637 0.000639 0.301019 0.066968 0.999 2 length{all}[18] 0.091468 0.009206 0.000367 0.293206 0.057826 0.998 2 length{all}[19] 0.104275 0.012777 0.000666 0.301576 0.070619 1.000 2 length{all}[20] 0.098119 0.009323 0.000009 0.285205 0.066217 1.002 2 length{all}[21] 0.105581 0.010440 0.000281 0.325335 0.077780 0.999 2 length{all}[22] 0.101343 0.008300 0.000069 0.299589 0.073639 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.005241 Maximum standard deviation of split frequencies = 0.013662 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.004 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /----------------------------------------------------------------------- C1 (1) | |----------------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------------ C3 (3) + |-------------------------------------------------------------------- C4 (4) | |------------------------------------------------------------------- C5 (5) | \------------------------------------------------------------------ C6 (6) |--------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 91 trees 95 % credible set contains 97 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 867 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 55 patterns at 289 / 289 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 55 patterns at 289 / 289 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 53680 bytes for conP 4840 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.099914 0.052203 0.098377 0.014604 0.022409 0.066792 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1240.131280 Iterating by ming2 Initial: fx= 1240.131280 x= 0.09991 0.05220 0.09838 0.01460 0.02241 0.06679 0.30000 1.30000 1 h-m-p 0.0000 0.0001 692.1160 ++ 1215.546943 m 0.0001 13 | 1/8 2 h-m-p 0.0005 0.0050 64.4593 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 632.4623 ++ 1204.564518 m 0.0000 44 | 2/8 4 h-m-p 0.0003 0.0062 52.2949 ----------.. | 2/8 5 h-m-p 0.0000 0.0001 565.3090 ++ 1170.817759 m 0.0001 74 | 3/8 6 h-m-p 0.0014 0.0087 38.0516 -----------.. | 3/8 7 h-m-p 0.0000 0.0001 491.4338 ++ 1158.313402 m 0.0001 105 | 4/8 8 h-m-p 0.0009 0.0150 23.4574 -----------.. | 4/8 9 h-m-p 0.0000 0.0001 401.5300 ++ 1140.105626 m 0.0001 136 | 5/8 10 h-m-p 0.0025 0.0312 12.7200 ------------.. | 5/8 11 h-m-p 0.0000 0.0000 285.5392 ++ 1139.658738 m 0.0000 168 | 6/8 12 h-m-p 0.0160 8.0000 0.0000 +Y 1139.658738 0 0.0640 180 | 6/8 13 h-m-p 1.6000 8.0000 0.0000 ---------------Y 1139.658738 0 0.0000 208 Out.. lnL = -1139.658738 209 lfun, 209 eigenQcodon, 1254 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.049030 0.090313 0.052210 0.097580 0.067570 0.031868 0.299920 0.609208 0.203922 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 11.422737 np = 9 lnL0 = -1245.546997 Iterating by ming2 Initial: fx= 1245.546997 x= 0.04903 0.09031 0.05221 0.09758 0.06757 0.03187 0.29992 0.60921 0.20392 1 h-m-p 0.0000 0.0001 636.8662 ++ 1195.091510 m 0.0001 14 | 1/9 2 h-m-p 0.0001 0.0003 326.2122 ++ 1171.129079 m 0.0003 26 | 2/9 3 h-m-p 0.0000 0.0000 58082.8375 ++ 1167.481145 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0000 14359.7965 ++ 1154.079143 m 0.0000 50 | 4/9 5 h-m-p 0.0000 0.0000 568028.1266 ++ 1153.599440 m 0.0000 62 | 5/9 6 h-m-p 0.0001 0.0072 19.3557 ---------.. | 5/9 7 h-m-p 0.0000 0.0001 392.5957 ++ 1141.683354 m 0.0001 93 | 6/9 8 h-m-p 0.0021 0.0428 10.0682 ------------.. | 6/9 9 h-m-p 0.0000 0.0000 285.0954 ++ 1139.658765 m 0.0000 127 | 7/9 10 h-m-p 0.0214 8.0000 0.0000 +++++ 1139.658765 m 8.0000 142 | 7/9 11 h-m-p 0.0065 3.2271 0.2189 +++++ 1139.658748 m 3.2271 159 | 8/9 12 h-m-p 1.6000 8.0000 0.0862 ------------Y 1139.658748 0 0.0000 185 | 8/9 13 h-m-p 0.0160 8.0000 0.0000 ---C 1139.658748 0 0.0001 201 Out.. lnL = -1139.658748 202 lfun, 606 eigenQcodon, 2424 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.069252 0.076861 0.034299 0.011984 0.071730 0.016467 0.587724 1.621524 0.512755 0.181126 1.377212 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 10.212453 np = 11 lnL0 = -1216.337189 Iterating by ming2 Initial: fx= 1216.337189 x= 0.06925 0.07686 0.03430 0.01198 0.07173 0.01647 0.58772 1.62152 0.51276 0.18113 1.37721 1 h-m-p 0.0000 0.0000 640.4048 ++ 1197.482360 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0001 242.9106 ++ 1191.220605 m 0.0001 30 | 2/11 3 h-m-p 0.0000 0.0001 369.0298 ++ 1174.627550 m 0.0001 44 | 3/11 4 h-m-p 0.0001 0.0004 313.7380 ++ 1155.564594 m 0.0004 58 | 4/11 5 h-m-p 0.0007 0.0034 24.8004 -----------.. | 4/11 6 h-m-p 0.0000 0.0001 478.9660 ++ 1143.444948 m 0.0001 95 | 5/11 7 h-m-p 0.0028 0.1308 7.1757 ------------.. | 5/11 8 h-m-p 0.0000 0.0000 402.5501 ++ 1141.590568 m 0.0000 133 | 6/11 9 h-m-p 0.0008 0.1693 3.9930 -----------.. | 6/11 10 h-m-p 0.0000 0.0000 285.7167 ++ 1139.658782 m 0.0000 170 | 7/11 11 h-m-p 0.0355 8.0000 0.0000 ++++ 1139.658782 m 8.0000 186 | 6/11 12 h-m-p 0.0260 8.0000 0.0037 +++++ 1139.658781 m 8.0000 207 | 6/11 13 h-m-p 0.0104 0.2118 2.8561 +++ 1139.658774 m 0.2118 227 | 6/11 14 h-m-p -0.0000 -0.0000 1.4802 h-m-p: -0.00000000e+00 -0.00000000e+00 1.48020591e+00 1139.658774 .. | 6/11 15 h-m-p 0.0160 8.0000 0.0001 +++++ 1139.658774 m 8.0000 255 | 6/11 16 h-m-p 0.0272 8.0000 0.0199 +++++ 1139.658764 m 8.0000 277 | 6/11 17 h-m-p 0.2237 1.1187 0.6957 ++ 1139.658736 m 1.1187 296 | 7/11 18 h-m-p 1.6000 8.0000 0.0505 ++ 1139.658735 m 8.0000 315 | 7/11 19 h-m-p 0.0093 0.0465 0.6492 ++ 1139.658735 m 0.0465 333 | 8/11 20 h-m-p 0.1107 8.0000 0.1431 ++++ 1139.658735 m 8.0000 353 | 8/11 21 h-m-p 1.4394 8.0000 0.7955 C 1139.658735 0 1.4394 370 | 8/11 22 h-m-p 1.6000 8.0000 0.2325 Y 1139.658735 0 1.2007 387 | 8/11 23 h-m-p 1.6000 8.0000 0.0252 C 1139.658735 0 1.2838 404 | 8/11 24 h-m-p 1.5764 8.0000 0.0205 ---Y 1139.658735 0 0.0062 424 | 8/11 25 h-m-p 1.6000 8.0000 0.0001 ++ 1139.658735 m 8.0000 441 | 8/11 26 h-m-p 0.0297 8.0000 0.0135 +++Y 1139.658735 0 4.7186 461 | 8/11 27 h-m-p 1.6000 8.0000 0.0074 C 1139.658735 0 0.4000 478 | 8/11 28 h-m-p 0.2600 8.0000 0.0113 Y 1139.658735 0 0.2600 495 | 8/11 29 h-m-p 1.6000 8.0000 0.0007 ++ 1139.658735 m 8.0000 512 | 8/11 30 h-m-p 0.0282 8.0000 0.1944 --C 1139.658735 0 0.0004 531 | 8/11 31 h-m-p 0.3140 8.0000 0.0002 ---Y 1139.658735 0 0.0012 551 | 8/11 32 h-m-p 0.0160 8.0000 0.0007 +++++ 1139.658735 m 8.0000 571 | 8/11 33 h-m-p 0.0160 8.0000 0.7506 --------N 1139.658735 0 0.0000 596 | 8/11 34 h-m-p 0.0160 8.0000 0.0000 ---Y 1139.658735 0 0.0001 616 | 8/11 35 h-m-p 0.0160 8.0000 0.0000 -Y 1139.658735 0 0.0010 634 Out.. lnL = -1139.658735 635 lfun, 2540 eigenQcodon, 11430 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1139.665063 S = -1139.653757 -0.004327 Calculating f(w|X), posterior probabilities of site classes. did 10 / 55 patterns 0:04 did 20 / 55 patterns 0:04 did 30 / 55 patterns 0:04 did 40 / 55 patterns 0:04 did 50 / 55 patterns 0:04 did 55 / 55 patterns 0:04 Time used: 0:04 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.024436 0.108792 0.054575 0.068854 0.074892 0.054746 0.000100 1.091641 1.749837 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 15.420715 np = 9 lnL0 = -1246.201056 Iterating by ming2 Initial: fx= 1246.201056 x= 0.02444 0.10879 0.05458 0.06885 0.07489 0.05475 0.00011 1.09164 1.74984 1 h-m-p 0.0000 0.0000 654.2094 ++ 1245.494965 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0204 53.3591 +++++ 1220.880983 m 0.0204 29 | 2/9 3 h-m-p 0.0000 0.0002 598.0048 ++ 1182.047182 m 0.0002 41 | 3/9 4 h-m-p 0.0072 0.0361 7.6069 -------------.. | 3/9 5 h-m-p 0.0000 0.0001 622.4234 ++ 1155.556789 m 0.0001 76 | 4/9 6 h-m-p 0.0173 8.0000 2.1747 -------------.. | 4/9 7 h-m-p 0.0000 0.0000 565.2743 ++ 1151.650269 m 0.0000 111 | 5/9 8 h-m-p 0.0160 8.0000 1.8576 -------------.. | 5/9 9 h-m-p 0.0000 0.0000 489.5045 ++ 1144.731040 m 0.0000 146 | 6/9 10 h-m-p 0.0160 8.0000 1.5181 -------------.. | 6/9 11 h-m-p 0.0000 0.0000 401.6251 ++ 1144.679819 m 0.0000 181 | 7/9 12 h-m-p 0.0160 8.0000 1.0556 -------------.. | 7/9 13 h-m-p 0.0000 0.0001 281.6466 ++ 1139.658755 m 0.0001 216 | 8/9 14 h-m-p 1.6000 8.0000 0.0000 +Y 1139.658755 0 6.4000 229 | 8/9 15 h-m-p 1.6000 8.0000 0.0000 Y 1139.658755 0 1.6000 242 Out.. lnL = -1139.658755 243 lfun, 2673 eigenQcodon, 14580 P(t) Time used: 0:08 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.055925 0.084574 0.094904 0.016184 0.014732 0.055468 0.000100 0.900000 0.734701 1.277744 1.300040 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 14.002214 np = 11 lnL0 = -1227.119892 Iterating by ming2 Initial: fx= 1227.119892 x= 0.05592 0.08457 0.09490 0.01618 0.01473 0.05547 0.00011 0.90000 0.73470 1.27774 1.30004 1 h-m-p 0.0000 0.0000 637.7442 ++ 1226.273371 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0008 185.7906 ++++ 1202.461935 m 0.0008 32 | 2/11 3 h-m-p 0.0000 0.0000 331.3301 ++ 1200.415426 m 0.0000 46 | 3/11 4 h-m-p 0.0000 0.0026 187.7149 ++++ 1158.334652 m 0.0026 62 | 4/11 5 h-m-p 0.0000 0.0000 667006.8725 ++ 1157.969246 m 0.0000 76 | 5/11 6 h-m-p 0.0000 0.0003 1770.3736 +++ 1148.608240 m 0.0003 91 | 6/11 7 h-m-p 0.0096 0.0482 15.9143 -------------.. | 6/11 8 h-m-p 0.0000 0.0000 391.3665 ++ 1142.292330 m 0.0000 130 | 7/11 9 h-m-p 0.0009 0.0315 13.1762 +++ 1141.382931 m 0.0315 145 | 7/11 10 h-m-p -0.0000 -0.0000 2.7806 h-m-p: -8.19289223e-18 -4.09644611e-17 2.78062081e+00 1141.382931 .. | 7/11 11 h-m-p 0.0000 0.0000 284.7530 ++ 1139.658755 m 0.0000 170 | 8/11 12 h-m-p 1.6000 8.0000 0.0000 ++ 1139.658755 m 8.0000 184 | 7/11 13 h-m-p 0.0011 0.1823 0.0000 --Y 1139.658755 0 0.0000 203 Out.. lnL = -1139.658755 204 lfun, 2448 eigenQcodon, 13464 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1139.720701 S = -1139.659723 -0.027105 Calculating f(w|X), posterior probabilities of site classes. did 10 / 55 patterns 0:12 did 20 / 55 patterns 0:12 did 30 / 55 patterns 0:12 did 40 / 55 patterns 0:12 did 50 / 55 patterns 0:13 did 55 / 55 patterns 0:13 Time used: 0:13 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=289 NC_011896_1_WP_010907688_1_380_MLBR_RS01820 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG NC_002677_1_NP_301364_1_236_ML0370 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG ************************************************** NC_011896_1_WP_010907688_1_380_MLBR_RS01820 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS NC_002677_1_NP_301364_1_236_ML0370 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045 VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ************************************************** NC_011896_1_WP_010907688_1_380_MLBR_RS01820 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK NC_002677_1_NP_301364_1_236_ML0370 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045 ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK ************************************************** NC_011896_1_WP_010907688_1_380_MLBR_RS01820 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD NC_002677_1_NP_301364_1_236_ML0370 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045 SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ************************************************** NC_011896_1_WP_010907688_1_380_MLBR_RS01820 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG NC_002677_1_NP_301364_1_236_ML0370 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045 ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG ************************************************** NC_011896_1_WP_010907688_1_380_MLBR_RS01820 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK NC_002677_1_NP_301364_1_236_ML0370 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045 GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK ***************************************
>NC_011896_1_WP_010907688_1_380_MLBR_RS01820 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG >NC_002677_1_NP_301364_1_236_ML0370 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG >NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG >NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG >NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG >NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045 GTGCGCTACCGTCGGCAGGTGGCCCACACCCGCAAACTCTTAGCAGCCCT CAGCCGCCGTGGCCCGCACCGGGTTTTGCGTGGTGACTTGTCCTTCGCCG GTTTGCCAGGGGTGGTGTACACCCCGGCTGGGGGTCTGAATCTGCCCGGC GTTGCGTTTGGTCACGACTGGCTCACCGGTACCGCCCGTTACGCGGGCCT GCTGGAACATTTGGCGTCGTGGGGCATCGTGACCGGCGCTCCCGACACCC AACGAGGTCTCACGCCCTCGGTGCTCAATCTGGCCTTCGACCTCGGTTCG GCACTCGACATCGTGGCGGGTGTGCGGCTGGGTCCTGGCAATATCAGCGT GCACCCCGCCAAACTCGGCCTGGTAGGACACGGTTTCGGCGGATCGGCCG CTGTACTCGCCGCAGCCGGGCTGCCAGGCTTGGCCGGTTTGCCGGCCAAA TCCGCAGTGGCGATCTTCCCGACGGTCACAAGTCCAGCGCCCGAACAGCC GGCCGCGACGTGCAAGGTCCCGGGTTTGATTCTGACCGCTCCAGGAGATC CGAAAACGTTGAATTCAAACGCTCTATCACTGTACCGCGCTTGGGATGAT GCCACCTTGCGCATCGTCAGCAAAGCCAAAGCCGGCGGCCTGGTGGAGGG GTGGCGAATGACGAAGGTCGTCGGGTTGGCCGGTCCGCATCGAGCGACGC AAAAAGCGGTTCGGTCGCTGCTCACCGGTTACTTGCTTTATGCGCTTGGC GGCGACAAAGAATATCGCGACTTCGCCGACCCAGACATGCACCTACCTCA TACGGTCCCGGTGGACCCCGAGGCGCCATTGGTCACCCCCGAACAGAAGA TCGTCACGCTGCTGAAG
>NC_011896_1_WP_010907688_1_380_MLBR_RS01820 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >NC_002677_1_NP_301364_1_236_ML0370 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK >NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045 VRYRRQVAHTRKLLAALSRRGPHRVLRGDLSFAGLPGVVYTPAGGLNLPG VAFGHDWLTGTARYAGLLEHLASWGIVTGAPDTQRGLTPSVLNLAFDLGS ALDIVAGVRLGPGNISVHPAKLGLVGHGFGGSAAVLAAAGLPGLAGLPAK SAVAIFPTVTSPAPEQPAATCKVPGLILTAPGDPKTLNSNALSLYRAWDD ATLRIVSKAKAGGLVEGWRMTKVVGLAGPHRATQKAVRSLLTGYLLYALG GDKEYRDFADPDMHLPHTVPVDPEAPLVTPEQKIVTLLK
#NEXUS [ID: 0677405464] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907688_1_380_MLBR_RS01820 NC_002677_1_NP_301364_1_236_ML0370 NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805 NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015 NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965 NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045 ; end; begin trees; translate 1 NC_011896_1_WP_010907688_1_380_MLBR_RS01820, 2 NC_002677_1_NP_301364_1_236_ML0370, 3 NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805, 4 NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015, 5 NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965, 6 NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.07118199,2:0.07096709,3:0.07238288,4:0.0682865,5:0.06764863,6:0.06661688); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.07118199,2:0.07096709,3:0.07238288,4:0.0682865,5:0.06764863,6:0.06661688); end;
Estimated marginal likelihoods for runs sampled in files "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1167.65 -1170.95 2 -1167.61 -1170.80 -------------------------------------- TOTAL -1167.63 -1170.88 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/4res/ML0370/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.899955 0.090754 0.379139 1.532987 0.859462 1314.91 1342.78 1.000 r(A<->C){all} 0.175971 0.021783 0.000070 0.461744 0.137083 215.11 296.77 1.001 r(A<->G){all} 0.172260 0.021551 0.000032 0.469017 0.129672 110.33 119.06 1.000 r(A<->T){all} 0.164051 0.018649 0.000091 0.444509 0.128633 219.27 312.50 1.000 r(C<->G){all} 0.161184 0.019642 0.000171 0.439103 0.123554 245.33 278.74 1.000 r(C<->T){all} 0.163311 0.020204 0.000159 0.458815 0.124742 142.67 169.67 1.000 r(G<->T){all} 0.163223 0.018964 0.000071 0.426802 0.126476 247.69 248.71 1.006 pi(A){all} 0.166333 0.000160 0.141820 0.190354 0.165696 1122.02 1311.51 1.000 pi(C){all} 0.326052 0.000254 0.296385 0.358033 0.326009 1043.87 1206.46 1.000 pi(G){all} 0.314931 0.000238 0.283321 0.343901 0.314981 1276.25 1388.62 1.000 pi(T){all} 0.192684 0.000180 0.167199 0.218646 0.192189 1332.92 1346.82 1.000 alpha{1,2} 0.431898 0.225550 0.000126 1.361259 0.265020 1177.87 1276.18 1.000 alpha{3} 0.454786 0.229382 0.000169 1.377253 0.308068 1152.54 1170.48 1.001 pinvar{all} 0.998261 0.000005 0.994368 0.999999 0.998918 1396.68 1415.07 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0370/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 289 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0 TTC 5 5 5 5 5 5 | TCC 2 2 2 2 2 2 | TAC 5 5 5 5 5 5 | TGC 1 1 1 1 1 1 Leu TTA 1 1 1 1 1 1 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 12 12 12 12 12 12 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 3 3 3 3 3 3 | Arg CGT 4 4 4 4 4 4 CTC 10 10 10 10 10 10 | CCC 7 7 7 7 7 7 | CAC 6 6 6 6 6 6 | CGC 6 6 6 6 6 6 CTA 2 2 2 2 2 2 | CCA 6 6 6 6 6 6 | Gln CAA 2 2 2 2 2 2 | CGA 3 3 3 3 3 3 CTG 14 14 14 14 14 14 | CCG 9 9 9 9 9 9 | CAG 3 3 3 3 3 3 | CGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1 ATC 6 6 6 6 6 6 | ACC 10 10 10 10 10 10 | AAC 1 1 1 1 1 1 | AGC 3 3 3 3 3 3 ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 8 8 8 8 8 8 | Arg AGA 0 0 0 0 0 0 Met ATG 2 2 2 2 2 2 | ACG 8 8 8 8 8 8 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 3 3 3 3 3 | Ala GCT 6 6 6 6 6 6 | Asp GAT 3 3 3 3 3 3 | Gly GGT 14 14 14 14 14 14 GTC 8 8 8 8 8 8 | GCC 17 17 17 17 17 17 | GAC 10 10 10 10 10 10 | GGC 13 13 13 13 13 13 GTA 2 2 2 2 2 2 | GCA 4 4 4 4 4 4 | Glu GAA 4 4 4 4 4 4 | GGA 3 3 3 3 3 3 GTG 12 12 12 12 12 12 | GCG 11 11 11 11 11 11 | GAG 2 2 2 2 2 2 | GGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907688_1_380_MLBR_RS01820 position 1: T:0.13841 C:0.28720 A:0.16955 G:0.40484 position 2: T:0.28028 C:0.31142 A:0.19723 G:0.21107 position 3: T:0.15917 C:0.38062 A:0.13149 G:0.32872 Average T:0.19262 C:0.32641 A:0.16609 G:0.31488 #2: NC_002677_1_NP_301364_1_236_ML0370 position 1: T:0.13841 C:0.28720 A:0.16955 G:0.40484 position 2: T:0.28028 C:0.31142 A:0.19723 G:0.21107 position 3: T:0.15917 C:0.38062 A:0.13149 G:0.32872 Average T:0.19262 C:0.32641 A:0.16609 G:0.31488 #3: NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805 position 1: T:0.13841 C:0.28720 A:0.16955 G:0.40484 position 2: T:0.28028 C:0.31142 A:0.19723 G:0.21107 position 3: T:0.15917 C:0.38062 A:0.13149 G:0.32872 Average T:0.19262 C:0.32641 A:0.16609 G:0.31488 #4: NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015 position 1: T:0.13841 C:0.28720 A:0.16955 G:0.40484 position 2: T:0.28028 C:0.31142 A:0.19723 G:0.21107 position 3: T:0.15917 C:0.38062 A:0.13149 G:0.32872 Average T:0.19262 C:0.32641 A:0.16609 G:0.31488 #5: NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965 position 1: T:0.13841 C:0.28720 A:0.16955 G:0.40484 position 2: T:0.28028 C:0.31142 A:0.19723 G:0.21107 position 3: T:0.15917 C:0.38062 A:0.13149 G:0.32872 Average T:0.19262 C:0.32641 A:0.16609 G:0.31488 #6: NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045 position 1: T:0.13841 C:0.28720 A:0.16955 G:0.40484 position 2: T:0.28028 C:0.31142 A:0.19723 G:0.21107 position 3: T:0.15917 C:0.38062 A:0.13149 G:0.32872 Average T:0.19262 C:0.32641 A:0.16609 G:0.31488 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 0 TTC 30 | TCC 12 | TAC 30 | TGC 6 Leu L TTA 6 | TCA 12 | *** * TAA 0 | *** * TGA 0 TTG 72 | TCG 30 | TAG 0 | Trp W TGG 24 ------------------------------------------------------------------------------ Leu L CTT 12 | Pro P CCT 12 | His H CAT 18 | Arg R CGT 24 CTC 60 | CCC 42 | CAC 36 | CGC 36 CTA 12 | CCA 36 | Gln Q CAA 12 | CGA 18 CTG 84 | CCG 54 | CAG 18 | CGG 24 ------------------------------------------------------------------------------ Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 24 | Ser S AGT 6 ATC 36 | ACC 60 | AAC 6 | AGC 18 ATA 0 | ACA 6 | Lys K AAA 48 | Arg R AGA 0 Met M ATG 12 | ACG 48 | AAG 24 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 18 | Ala A GCT 36 | Asp D GAT 18 | Gly G GGT 84 GTC 48 | GCC 102 | GAC 60 | GGC 78 GTA 12 | GCA 24 | Glu E GAA 24 | GGA 18 GTG 72 | GCG 66 | GAG 12 | GGG 30 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.13841 C:0.28720 A:0.16955 G:0.40484 position 2: T:0.28028 C:0.31142 A:0.19723 G:0.21107 position 3: T:0.15917 C:0.38062 A:0.13149 G:0.32872 Average T:0.19262 C:0.32641 A:0.16609 G:0.31488 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1139.658738 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299920 1.300040 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907688_1_380_MLBR_RS01820: 0.000004, NC_002677_1_NP_301364_1_236_ML0370: 0.000004, NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805: 0.000004, NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015: 0.000004, NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965: 0.000004, NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29992 omega (dN/dS) = 1.30004 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 636.3 230.7 1.3000 0.0000 0.0000 0.0 0.0 7..2 0.000 636.3 230.7 1.3000 0.0000 0.0000 0.0 0.0 7..3 0.000 636.3 230.7 1.3000 0.0000 0.0000 0.0 0.0 7..4 0.000 636.3 230.7 1.3000 0.0000 0.0000 0.0 0.0 7..5 0.000 636.3 230.7 1.3000 0.0000 0.0000 0.0 0.0 7..6 0.000 636.3 230.7 1.3000 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1139.658748 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.587724 0.000010 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907688_1_380_MLBR_RS01820: 0.000004, NC_002677_1_NP_301364_1_236_ML0370: 0.000004, NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805: 0.000004, NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015: 0.000004, NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965: 0.000004, NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.58772 MLEs of dN/dS (w) for site classes (K=2) p: 0.00001 0.99999 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 633.1 233.9 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 633.1 233.9 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 633.1 233.9 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 633.1 233.9 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 633.1 233.9 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 633.1 233.9 1.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1139.658735 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.052314 0.847425 1.000000 2.254308 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907688_1_380_MLBR_RS01820: 0.000004, NC_002677_1_NP_301364_1_236_ML0370: 0.000004, NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805: 0.000004, NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015: 0.000004, NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965: 0.000004, NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.05231 0.84742 0.10026 w: 1.00000 1.00000 2.25431 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 640.5 226.5 1.1258 0.0000 0.0000 0.0 0.0 7..2 0.000 640.5 226.5 1.1258 0.0000 0.0000 0.0 0.0 7..3 0.000 640.5 226.5 1.1258 0.0000 0.0000 0.0 0.0 7..4 0.000 640.5 226.5 1.1258 0.0000 0.0000 0.0 0.0 7..5 0.000 640.5 226.5 1.1258 0.0000 0.0000 0.0 0.0 7..6 0.000 640.5 226.5 1.1258 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907688_1_380_MLBR_RS01820) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907688_1_380_MLBR_RS01820) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:04 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1139.658755 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.698445 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907688_1_380_MLBR_RS01820: 0.000004, NC_002677_1_NP_301364_1_236_ML0370: 0.000004, NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805: 0.000004, NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015: 0.000004, NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965: 0.000004, NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.69844 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:08 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1139.658755 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999985 0.005000 1.541154 2.005668 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907688_1_380_MLBR_RS01820: 0.000004, NC_002677_1_NP_301364_1_236_ML0370: 0.000004, NZ_LVXE01000013_1_WP_010907688_1_456_A3216_RS05805: 0.000004, NZ_LYPH01000014_1_WP_010907688_1_421_A8144_RS02015: 0.000004, NZ_CP029543_1_WP_010907688_1_383_DIJ64_RS01965: 0.000004, NZ_AP014567_1_WP_010907688_1_399_JK2ML_RS02045: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.54115 (p1 = 0.00001) w = 2.00567 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.00567 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 640.5 226.5 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907688_1_380_MLBR_RS01820) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.102 0.103 0.104 0.105 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096 Time used: 0:13
Model 1: NearlyNeutral -1139.658748 Model 2: PositiveSelection -1139.658735 Model 0: one-ratio -1139.658738 Model 7: beta -1139.658755 Model 8: beta&w>1 -1139.658755 Model 0 vs 1 1.9999999949504854E-5 Model 2 vs 1 2.6000000161729986E-5 Model 8 vs 7 0.0