--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Dec 01 02:43:21 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/74/CG14511-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/74/CG14511-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/74/CG14511-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/74/CG14511-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2494.68         -2507.14
2      -2494.64         -2504.79
--------------------------------------
TOTAL    -2494.66         -2506.54
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/74/CG14511-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/74/CG14511-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/74/CG14511-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.444860    0.002836    0.341857    0.545788    0.441947   1251.30   1256.73    1.000
r(A<->C){all}   0.109679    0.000711    0.061608    0.164440    0.108010   1061.75   1108.15    1.001
r(A<->G){all}   0.359469    0.002154    0.272091    0.452137    0.359306    853.12    918.79    1.000
r(A<->T){all}   0.071527    0.000551    0.029166    0.116876    0.068794    849.12    909.15    1.001
r(C<->G){all}   0.076520    0.000362    0.040738    0.112440    0.074883    944.74   1010.74    1.000
r(C<->T){all}   0.318986    0.001867    0.231895    0.398308    0.316643    770.98    857.54    1.000
r(G<->T){all}   0.063818    0.000312    0.032259    0.098510    0.062713   1051.64   1128.35    1.001
pi(A){all}      0.184158    0.000137    0.162831    0.208135    0.183906    931.22   1074.14    1.001
pi(C){all}      0.269051    0.000171    0.242256    0.294168    0.269185   1165.44   1280.85    1.000
pi(G){all}      0.263218    0.000166    0.238874    0.288915    0.263174   1284.87   1300.54    1.000
pi(T){all}      0.283573    0.000202    0.256343    0.311714    0.283598   1047.54   1136.50    1.001
alpha{1,2}      0.138106    0.004079    0.000195    0.242312    0.141178   1068.32   1160.49    1.000
alpha{3}        2.016024    0.644410    0.782677    3.641494    1.876296   1235.78   1338.15    1.000
pinvar{all}     0.234517    0.013019    0.013713    0.431221    0.234450   1069.53   1118.24    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-2366.626417
Model 2: PositiveSelection	-2366.542202
Model 0: one-ratio	-2380.700036
Model 3: discrete	-2366.542202
Model 7: beta	-2368.033699
Model 8: beta&w>1	-2366.567002


Model 0 vs 1	28.14723800000047

Model 2 vs 1	0.16842999999971653

Model 8 vs 7	2.9333940000005896
>C1
MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFKVPMTLHMII
RGGSLISNMCLCTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKM
ENLDSGAEADTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFTGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIVYFRNPFTWWH
WLGTALVFVGTLMFANVIRVPK
>C2
MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYGLLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ENLDNGAETDTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFAGDSYQLPLLGVAVPLMLLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIMYFRNSFTWWH
WLGTALVFVGTLMFANVIRVPK
>C3
MYLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ENLDSGAETDTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFAGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIMYFRNPFTWWH
WLGTALVFVGTLMFANVIRVPK
>C4
MHLSIRAVLAICGVFLGCCSGVVFLELLVKLDPGAGNLITVAQFAFIAVE
GFVFTSKFGLAQRLISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLVLKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKQ
ENLDSRAEADKFWWLLGVALLVLALFISSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMQDDIRTHWLLAFAGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTWWH
WLGTALVFVGTLMFADVIRVPK
>C5
MHLSIRAVLAICGVFFGCCSGVVFLELLVKLDPGAGNLITAAQFAFIALE
GFIFTSKLGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ESLDSSAEEDKFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMLDDIRTHWLLAFADESNQLTLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTWWH
WLGTALVFVGTLLFADVIRVPK
>C6
MSLSTRAVLATCGVFLGCCSGVVFLELLVKLDPGAGNLITAAQFAFIALE
GFVFTSRFGLAKRVISLRDYALLVAMFFLTSVCNNYVFEFNVPMTLHMII
RGGSLISNMCLGTLILKRRYRLSQYISVVMISVGIFICTYFSSPDLGAEK
EDLDSTAKTDIFWWLVGVLLLVLALFVSSYMGVTQELLYRRHGKCAREAL
YYTHLLPLPAFLLMQDNIRTHWLLALAGESYQLPLLGVAVPLILLYLIGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTLYH
WLGTVLVFVGTLMFANVIRVPK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=322 

C1              MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
C2              MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
C3              MYLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
C4              MHLSIRAVLAICGVFLGCCSGVVFLELLVKLDPGAGNLITVAQFAFIAVE
C5              MHLSIRAVLAICGVFFGCCSGVVFLELLVKLDPGAGNLITAAQFAFIALE
C6              MSLSTRAVLATCGVFLGCCSGVVFLELLVKLDPGAGNLITAAQFAFIALE
                * ** **: * ****:************************ *******:*

C1              GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFKVPMTLHMII
C2              GFIFTSKFGLAQRVISLRDYGLLVAMFFLTSVCNNYVFKFNVPMTLHMII
C3              GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
C4              GFVFTSKFGLAQRLISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
C5              GFIFTSKLGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
C6              GFVFTSRFGLAKRVISLRDYALLVAMFFLTSVCNNYVFEFNVPMTLHMII
                **:***::***:*:******.*****************:*:*********

C1              RGGSLISNMCLCTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKM
C2              RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
C3              RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
C4              RGGSLISNMCLGTLVLKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKQ
C5              RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
C6              RGGSLISNMCLGTLILKRRYRLSQYISVVMISVGIFICTYFSSPDLGAEK
                *********** **:*** *********:*******:********* .: 

C1              ENLDSGAEADTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
C2              ENLDNGAETDTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
C3              ENLDSGAETDTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
C4              ENLDSRAEADKFWWLLGVALLVLALFISSYMGITQELLYRRHGKCAREAL
C5              ESLDSSAEEDKFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
C6              EDLDSTAKTDIFWWLVGVLLLVLALFVSSYMGVTQELLYRRHGKCAREAL
                *.**. *: * ****:** *******:*****:*****************

C1              YYTHLLPLPAFLLMHDDIRTHWLLAFTGESYQLPLLGVAVPLILLYLLGN
C2              YYTHLLPLPAFLLMHDDIRTHWLLAFAGDSYQLPLLGVAVPLMLLYLLGN
C3              YYTHLLPLPAFLLMHDDIRTHWLLAFAGESYQLPLLGVAVPLILLYLLGN
C4              YYTHLLPLPAFLLMQDDIRTHWLLAFAGESYQLPLLGVAVPLILLYLLGN
C5              YYTHLLPLPAFLLMLDDIRTHWLLAFADESNQLTLLGVAVPLILLYLLGN
C6              YYTHLLPLPAFLLMQDNIRTHWLLALAGESYQLPLLGVAVPLILLYLIGN
                ************** *:********::.:* **.********:****:**

C1              VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIVYFRNPFTWWH
C2              VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIMYFRNSFTWWH
C3              VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIMYFRNPFTWWH
C4              VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTWWH
C5              VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTWWH
C6              VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTLYH
                ***************************************:****.** :*

C1              WLGTALVFVGTLMFANVIRVPK
C2              WLGTALVFVGTLMFANVIRVPK
C3              WLGTALVFVGTLMFANVIRVPK
C4              WLGTALVFVGTLMFADVIRVPK
C5              WLGTALVFVGTLLFADVIRVPK
C6              WLGTVLVFVGTLMFANVIRVPK
                ****.*******:**:******




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 lugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  322 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  322 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9660]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [9660]--->[9660]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/74/CG14511-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.358 Mb, Max= 30.741 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFKVPMTLHMII
RGGSLISNMCLCTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKM
ENLDSGAEADTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFTGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIVYFRNPFTWWH
WLGTALVFVGTLMFANVIRVPK
>C2
MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYGLLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ENLDNGAETDTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFAGDSYQLPLLGVAVPLMLLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIMYFRNSFTWWH
WLGTALVFVGTLMFANVIRVPK
>C3
MYLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ENLDSGAETDTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFAGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIMYFRNPFTWWH
WLGTALVFVGTLMFANVIRVPK
>C4
MHLSIRAVLAICGVFLGCCSGVVFLELLVKLDPGAGNLITVAQFAFIAVE
GFVFTSKFGLAQRLISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLVLKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKQ
ENLDSRAEADKFWWLLGVALLVLALFISSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMQDDIRTHWLLAFAGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTWWH
WLGTALVFVGTLMFADVIRVPK
>C5
MHLSIRAVLAICGVFFGCCSGVVFLELLVKLDPGAGNLITAAQFAFIALE
GFIFTSKLGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ESLDSSAEEDKFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMLDDIRTHWLLAFADESNQLTLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTWWH
WLGTALVFVGTLLFADVIRVPK
>C6
MSLSTRAVLATCGVFLGCCSGVVFLELLVKLDPGAGNLITAAQFAFIALE
GFVFTSRFGLAKRVISLRDYALLVAMFFLTSVCNNYVFEFNVPMTLHMII
RGGSLISNMCLGTLILKRRYRLSQYISVVMISVGIFICTYFSSPDLGAEK
EDLDSTAKTDIFWWLVGVLLLVLALFVSSYMGVTQELLYRRHGKCAREAL
YYTHLLPLPAFLLMQDNIRTHWLLALAGESYQLPLLGVAVPLILLYLIGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTLYH
WLGTVLVFVGTLMFANVIRVPK

FORMAT of file /tmp/tmp2738607153833681200aln Not Supported[FATAL:T-COFFEE]
>C1
MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFKVPMTLHMII
RGGSLISNMCLCTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKM
ENLDSGAEADTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFTGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIVYFRNPFTWWH
WLGTALVFVGTLMFANVIRVPK
>C2
MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYGLLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ENLDNGAETDTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFAGDSYQLPLLGVAVPLMLLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIMYFRNSFTWWH
WLGTALVFVGTLMFANVIRVPK
>C3
MYLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ENLDSGAETDTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFAGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIMYFRNPFTWWH
WLGTALVFVGTLMFANVIRVPK
>C4
MHLSIRAVLAICGVFLGCCSGVVFLELLVKLDPGAGNLITVAQFAFIAVE
GFVFTSKFGLAQRLISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLVLKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKQ
ENLDSRAEADKFWWLLGVALLVLALFISSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMQDDIRTHWLLAFAGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTWWH
WLGTALVFVGTLMFADVIRVPK
>C5
MHLSIRAVLAICGVFFGCCSGVVFLELLVKLDPGAGNLITAAQFAFIALE
GFIFTSKLGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ESLDSSAEEDKFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMLDDIRTHWLLAFADESNQLTLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTWWH
WLGTALVFVGTLLFADVIRVPK
>C6
MSLSTRAVLATCGVFLGCCSGVVFLELLVKLDPGAGNLITAAQFAFIALE
GFVFTSRFGLAKRVISLRDYALLVAMFFLTSVCNNYVFEFNVPMTLHMII
RGGSLISNMCLGTLILKRRYRLSQYISVVMISVGIFICTYFSSPDLGAEK
EDLDSTAKTDIFWWLVGVLLLVLALFVSSYMGVTQELLYRRHGKCAREAL
YYTHLLPLPAFLLMQDNIRTHWLLALAGESYQLPLLGVAVPLILLYLIGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTLYH
WLGTVLVFVGTLMFANVIRVPK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:322 S:100 BS:322
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.58 C1	 C2	 96.58
TOP	    1    0	 96.58 C2	 C1	 96.58
BOT	    0    2	 97.83 C1	 C3	 97.83
TOP	    2    0	 97.83 C3	 C1	 97.83
BOT	    0    3	 94.41 C1	 C4	 94.41
TOP	    3    0	 94.41 C4	 C1	 94.41
BOT	    0    4	 93.48 C1	 C5	 93.48
TOP	    4    0	 93.48 C5	 C1	 93.48
BOT	    0    5	 88.82 C1	 C6	 88.82
TOP	    5    0	 88.82 C6	 C1	 88.82
BOT	    1    2	 98.14 C2	 C3	 98.14
TOP	    2    1	 98.14 C3	 C2	 98.14
BOT	    1    3	 93.48 C2	 C4	 93.48
TOP	    3    1	 93.48 C4	 C2	 93.48
BOT	    1    4	 93.17 C2	 C5	 93.17
TOP	    4    1	 93.17 C5	 C2	 93.17
BOT	    1    5	 88.51 C2	 C6	 88.51
TOP	    5    1	 88.51 C6	 C2	 88.51
BOT	    2    3	 95.03 C3	 C4	 95.03
TOP	    3    2	 95.03 C4	 C3	 95.03
BOT	    2    4	 94.72 C3	 C5	 94.72
TOP	    4    2	 94.72 C5	 C3	 94.72
BOT	    2    5	 90.06 C3	 C6	 90.06
TOP	    5    2	 90.06 C6	 C3	 90.06
BOT	    3    4	 94.72 C4	 C5	 94.72
TOP	    4    3	 94.72 C5	 C4	 94.72
BOT	    3    5	 89.75 C4	 C6	 89.75
TOP	    5    3	 89.75 C6	 C4	 89.75
BOT	    4    5	 88.82 C5	 C6	 88.82
TOP	    5    4	 88.82 C6	 C5	 88.82
AVG	 0	 C1	  *	 94.22
AVG	 1	 C2	  *	 93.98
AVG	 2	 C3	  *	 95.16
AVG	 3	 C4	  *	 93.48
AVG	 4	 C5	  *	 92.98
AVG	 5	 C6	  *	 89.19
TOT	 TOT	  *	 93.17
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGAATTTATCCATCCGCGCTATTTCGGCCATCTGCGGCGTTTTCTTGGG
C2              ATGAATTTATCCATCCGCGCTATTTCGGCCATCTGCGGCGTTTTCTTGGG
C3              ATGTATTTATCCATCCGCGCTATTTCGGCCATCTGCGGCGTTTTCTTGGG
C4              ATGCATTTATCCATCCGCGCTGTTTTGGCCATCTGCGGCGTCTTCTTGGG
C5              ATGCATTTATCCATCCGCGCAGTTTTGGCCATTTGCGGCGTTTTCTTTGG
C6              ATGAGTTTATCCACCCGCGCTGTATTGGCCACTTGCGGCGTCTTTTTGGG
                *** .******** ******:.*:* *****  ******** ** ** **

C1              CTGCTGCAGTGGCGTCGTCTTCTTGGAGCTCCTGGTTAAACTGGATCCCG
C2              CTGCTGCAGTGGCGTCGTCTTCCTGGAGCTCCTGGTTAAACTGGATCCCG
C3              CTGCTGCAGTGGCGTCGTCTTCCTGGAGCTCCTGGTTAAACTGGATCCCG
C4              CTGCTGCAGTGGCGTCGTTTTTCTGGAGCTTCTGGTCAAACTGGATCCTG
C5              CTGCTGCAGTGGCGTCGTCTTCCTGGAGCTCCTGGTTAAACTAGATCCCG
C6              CTGCTGCAGTGGCGTTGTTTTCCTGGAGCTCCTAGTTAAACTGGATCCCG
                *************** ** **  ******* **.** *****.***** *

C1              GCGCTGGAAACCTTATAACTGGCGCCCAGTTTGCATTTATTGCCCTCGAG
C2              GCGCTGGAAACCTTATAACTGGCGCCCAGTTTGCATTTATTGCCCTCGAG
C3              GCGCTGGAAACCTTATAACTGGCGCCCAGTTTGCATTTATTGCCCTCGAG
C4              GCGCTGGAAACCTTATAACTGTCGCCCAGTTTGCATTTATTGCTGTGGAG
C5              GCGCTGGAAACCTTATAACTGCCGCCCAGTTTGCATTTATTGCCCTGGAG
C6              GCGCTGGAAACCTGATAACTGCCGCCCAGTTTGCATTTATTGCCCTGGAG
                ************* ******* *********************  * ***

C1              GGCTTCATCTTCACCTCGAAGTTTGGCCTGGCCCAGAGAGTGATCAGCCT
C2              GGCTTCATTTTCACCTCGAAGTTTGGCCTGGCTCAGAGAGTGATCAGCCT
C3              GGCTTCATTTTCACCTCGAAGTTTGGCCTGGCTCAGAGAGTGATCAGCTT
C4              GGCTTTGTCTTCACCTCGAAGTTCGGGCTGGCCCAGAGATTGATCAGCCT
C5              GGCTTTATTTTCACCTCCAAGCTTGGGCTGGCCCAGAGAGTGATCAGCCT
C6              GGCTTCGTCTTCACCTCAAGGTTTGGATTGGCCAAGCGGGTGATCAGTCT
                ***** .* ******** *.* * **  **** .**.*. *******  *

C1              GCGCGACTATGCGCTCCTCGTGGCCATGTTTTTCCTGACCAGCGTATGCA
C2              GCGCGACTATGGGCTTCTTGTGGCCATGTTTTTCCTGACCAGCGTGTGTA
C3              GCGCGACTATGCGCTTCTTGTGGCCATGTTTTTTCTGACCAGCGTGTGTA
C4              TCGGGATTATGCGCTCCTAGTGGCCATGTTCTTCCTGACCAGCGTGTGCA
C5              GCGGGACTATGCGCTCCTCGTGGCCATGTTTTTTCTGACCAGCGTGTGCA
C6              GCGCGACTATGCGCTCCTGGTGGCCATGTTCTTCCTGACCAGCGTGTGCA
                 ** ** **** *** ** *********** ** ***********.** *

C1              ACAACTACGTGTTCAAGTTCAAAGTTCCAATGACACTGCACATGATCATA
C2              ACAACTACGTGTTCAAGTTCAATGTTCCAATGACACTGCACATGATCATC
C3              ACAACTACGTGTTCAAGTTCAATGTTCCAATGACACTGCACATGATCATC
C4              ACAACTACGTGTTCAAGTTCAATGTCCCAATGACGCTGCACATGATCATC
C5              ACAACTACGTGTTCAAGTTCAATGTCCCAATGACACTGCACATGATCATT
C6              ACAACTATGTGTTCGAGTTCAATGTTCCGATGACGCTACACATGATCATC
                ******* ******.*******:** **.*****.**.*********** 

C1              CGCGGCGGTTCGCTGATCTCCAACATGTGCCTGTGCACGTTGATCCTGAA
C2              CGCGGCGGTTCGCTGATCTCCAACATGTGCCTGGGCACGTTGATCCTGAA
C3              CGCGGCGGTTCGCTGATCTCCAACATGTGCCTGGGCACGTTGATCCTGAA
C4              CGCGGCGGTTCGCTGATCTCCAATATGTGCCTGGGCACATTGGTTCTTAA
C5              CGCGGCGGTTCGCTGATCTCCAACATGTGCCTGGGCACATTGATCCTGAA
C6              CGCGGCGGCTCCCTTATCTCGAATATGTGCTTAGGCACGTTGATCCTGAA
                ******** ** ** ***** ** ****** *. ****.***.* ** **

C1              GAGGAGTTACCGGTTGAGTCAGTACATATCGGTGCTCATGATCAGCGTGG
C2              GAGGAGCTACCGGTTGAGTCAGTACATATCGGTGCTCATGATCAGCGTGG
C3              GAGGAGCTACCGGTTGAGTCAGTACATATCGGTGCTCATGATCAGCGTGG
C4              GAGGAGCTACCGGTTGAGTCAGTACATATCGGTGCTCATGATCAGCGTGG
C5              GAGGAGCTACCGGTTGAGTCAGTACATATCGGTGCTCATGATCAGCGTGG
C6              GAGAAGATACCGGCTGAGTCAGTACATATCGGTGGTCATGATCAGCGTGG
                ***.** ****** ******************** ***************

C1              GCATTTTCGTCTGCACATATTTCTCCAGTCCGGATTTGGTGGGTAAGATG
C2              GTATTTTTGTCTGCACATATTTCTCCAGTCCGGATTTGGTGGGTAAGAGG
C3              GCATTTTTGTCTGCACATATTTCTCCAGTCCGGATTTGGTGGGTAAGAGG
C4              GCATTTTCGTCTGCACATATTTTTCCAGTCCGGATTTGGTTGGTAAGCAG
C5              GCATTTTCGTCTGCACATATTTTTCCAGTCCGGATTTGGTTGGTAAGAGG
C6              GCATTTTCATCTGCACTTACTTTTCCAGTCCGGATTTAGGTGCTGAGAAG
                * ***** .*******:** ** **************.*  * *.**. *

C1              GAGAATTTGGATAGTGGCGCCGAGGCGGATACGTTCTGGTGGCTGTTGGG
C2              GAGAATTTGGACAACGGCGCCGAGACGGATACGTTCTGGTGGCTGTTGGG
C3              GAGAATTTGGACAGTGGCGCCGAGACGGATACGTTCTGGTGGCTGTTGGG
C4              GAGAATTTGGATAGCAGGGCCGAGGCTGATAAGTTTTGGTGGCTGTTGGG
C5              GAGAGTTTGGACAGTAGCGCCGAGGAGGATAAGTTCTGGTGGCTGTTGGG
C6              GAGGATCTTGATAGCACTGCCAAGACGGATATATTCTGGTGGCTAGTGGG
                ***..* * ** *. .  ***.**.. **** .** ********. ****

C1              CGTGGCACTCTTGGTGCTGGCTCTATTTGTTTCCTCCTACATGGGAATTA
C2              CGTGGCACTCTTGGTGCTGGCTCTATTTGTGTCCTCCTACATGGGCATTA
C3              CGTGGCACTCTTGGTGCTGGCTCTATTTGTGTCCTCCTACATGGGCATTA
C4              CGTGGCACTCTTAGTGCTGGCTCTCTTCATCTCCTCCTACATGGGCATAA
C5              CGTAGCACTCTTGGTGCTGGCTCTGTTTGTATCCTCCTACATGGGCATAA
C6              CGTGCTCCTGCTGGTCCTGGCTCTATTTGTATCATCCTACATGGGCGTTA
                ***.  .**  *.** ******** ** .* **.***********..*:*

C1              CACAGGAGTTGCTGTATCGACGTCATGGCAAGTGCGCCAGGGAAGCGTTG
C2              CCCAGGAGTTGCTGTATCGACGTCATGGCAAGTGCGCCAGGGAAGCGTTG
C3              CCCAGGAGTTGCTGTATCGACGTCATGGCAAGTGCGCCAGGGAAGCGTTG
C4              CCCAGGAGTTGCTGTATCGACGTCATGGCAAGTGCGCGAGGGAAGCGTTG
C5              CCCAGGAGTTGCTGTATCGACGTCATGGCAAGTGCGCGAGGGAAGCGTTG
C6              CCCAGGAATTGCTGTACCGACGTCATGGCAAGTGCGCCAGGGAAGCTTTG
                *.*****.******** ******************** ******** ***

C1              TATTACACCCACCTGTTGCCGCTGCCCGCCTTCCTGCTCATGCATGACGA
C2              TATTACACCCACCTGTTGCCACTGCCCGCCTTCCTGCTCATGCATGACGA
C3              TATTACACCCACCTGTTGCCACTGCCCGCCTTCCTGCTCATGCATGACGA
C4              TACTACACCCACCTATTGCCACTGCCCGCCTTTCTGCTCATGCAGGACGA
C5              TATTACACCCACCTATTGCCACTGCCCGCCTTTCTGCTCATGCTGGACGA
C6              TATTACACCCATCTGCTGCCACTGCCCGCCTTTCTGCTGATGCAGGATAA
                ** ******** **. ****.*********** ***** ****: ** .*

C1              CATACGGACGCACTGGCTTTTGGCGTTCACGGGCGAGTCCTACCAGTTGC
C2              CATACGGACGCACTGGCTTTTGGCGTTCGCTGGCGATTCCTACCAGTTGC
C3              CATACGGACGCACTGGCTTTTGGCGTTCGCTGGCGAATCCTACCAGTTGC
C4              CATACGGACGCACTGGCTCCTGGCGTTCGCAGGCGAGTCCTACCAGTTGC
C5              CATACGGACGCACTGGCTCCTGGCGTTCGCGGACGAGTCCAACCAGTTGA
C6              CATACGGACGCACTGGCTCCTGGCCTTGGCAGGGGAGTCCTACCAGTTGC
                ******************  **** ** .* *. ** ***:********.

C1              CCCTCCTGGGCGTGGCAGTGCCCCTAATCCTGCTATACTTATTGGGCAAC
C2              CACTCCTGGGCGTGGCAGTGCCACTAATGCTGCTGTACTTATTGGGCAAC
C3              CACTCCTGGGCGTGGCAGTGCCACTAATCCTGCTGTACTTATTGGGCAAC
C4              CTCTCCTGGGCGTGGCAGTGCCATTAATCCTGCTGTACTTATTGGGCAAC
C5              CCCTCCTGGGGGTGGCAGTGCCCCTAATCCTGCTGTACTTATTGGGCAAC
C6              CTCTTCTGGGCGTGGCAGTGCCCCTAATCCTGCTATATTTAATAGGAAAC
                * ** ***** ***********. **** *****.** ***:*.**.***

C1              GTGCTTGCGCAGCATTTGTGCATCAGCTCCGTTTACACCCTGACCACGGA
C2              GTGCTGGCGCAGCATTTGTGCATCAGCTCCGTTTACACCCTGACCACGGA
C3              GTGCTGGCGCAGCATTTGTGCATCAGCTCCGTTTACACCCTGACCACGGA
C4              GTGCTGGCGCAGCATTTGTGCATCAGCTCCGTTTACACTCTGACCACGGA
C5              GTGCTGGCCCAGCATTTGTGCATCAGCTCCGTTTACACTCTGACCACAGA
C6              GTGCTAGCTCAGCATCTGTGCATCAGTTCTGTTTACACTCTGACCACAGA
                ***** ** ****** ********** ** ******** ********.**

C1              GTGCAGCTCGCTGACGGTGACTCTGATCCTCACACTCCGCAAGTTCATCT
C2              ATGCAGCTCACTGACGGTGACTCTGATCCTCACACTCCGCAAGTTCATCT
C3              ATGCAGCTCACTGACGGTGACTCTGATCCTCACACTCCGCAAGTTCATCT
C4              ATGCAGCTCGCTGACGGTGACTCTGATCCTGACACTTCGCAAGTTCATCT
C5              ATGCAGCTCGCTGACGGTGACTCTGATCCTAACACTCCGCAAGTTCATCT
C6              ATGCAGCTCACTGACGGTTACTTTGATCTTAACACTCCGGAAGTTCATCT
                .********.******** *** ***** * ***** ** **********

C1              CGCTGGTCTTTTCGATCGTATACTTCCGAAATCCCTTCACCTGGTGGCAC
C2              CGCTGGTCTTTTCGATCATGTACTTCCGTAATTCATTCACCTGGTGGCAC
C3              CGCTGGTCTTTTCGATCATGTACTTCCGTAATCCATTCACCTGGTGGCAC
C4              CGCTGGTCTTTTCGATCATATACTTCCGAAATCCCTTCACCTGGTGGCAC
C5              CGCTGGTCTTTTCGATCATATACTTCCGAAATCCCTTCACCTGGTGGCAC
C6              CGCTGGTCTTTTCGATCATATACTTCCGGAATCCCTTCACCTTGTACCAC
                *****************.*.******** *** *.******* **. ***

C1              TGGCTGGGCACCGCGCTAGTCTTTGTGGGCACCTTGATGTTTGCAAATGT
C2              TGGCTGGGCACCGCGCTGGTCTTTGTGGGCACCTTGATGTTTGCAAATGT
C3              TGGCTGGGCACCGCGCTGGTCTTTGTGGGCACCTTGATGTTTGCAAATGT
C4              TGGCTGGGCACCGCGCTCGTCTTTGTGGGCACCTTGATGTTTGCAGATGT
C5              TGGCTGGGCACCGCCCTGGTCTTCGTGGGCACCTTGCTGTTTGCTGATGT
C6              TGGCTTGGTACAGTGCTAGTCTTTGTGGGTACCTTAATGTTTGCAAATGT
                ***** ** **.*  ** ***** ***** *****..*******:.****

C1              GATCAGAGTTCCGAAA
C2              GATCAGAGTTCCGAAA
C3              GATCAGAGTTCCGAAA
C4              GATTAGAGTTCCGAAA
C5              GATCAGAGTTCCGAAA
C6              GATCAGAGTTCCCAAA
                *** ******** ***



>C1
ATGAATTTATCCATCCGCGCTATTTCGGCCATCTGCGGCGTTTTCTTGGG
CTGCTGCAGTGGCGTCGTCTTCTTGGAGCTCCTGGTTAAACTGGATCCCG
GCGCTGGAAACCTTATAACTGGCGCCCAGTTTGCATTTATTGCCCTCGAG
GGCTTCATCTTCACCTCGAAGTTTGGCCTGGCCCAGAGAGTGATCAGCCT
GCGCGACTATGCGCTCCTCGTGGCCATGTTTTTCCTGACCAGCGTATGCA
ACAACTACGTGTTCAAGTTCAAAGTTCCAATGACACTGCACATGATCATA
CGCGGCGGTTCGCTGATCTCCAACATGTGCCTGTGCACGTTGATCCTGAA
GAGGAGTTACCGGTTGAGTCAGTACATATCGGTGCTCATGATCAGCGTGG
GCATTTTCGTCTGCACATATTTCTCCAGTCCGGATTTGGTGGGTAAGATG
GAGAATTTGGATAGTGGCGCCGAGGCGGATACGTTCTGGTGGCTGTTGGG
CGTGGCACTCTTGGTGCTGGCTCTATTTGTTTCCTCCTACATGGGAATTA
CACAGGAGTTGCTGTATCGACGTCATGGCAAGTGCGCCAGGGAAGCGTTG
TATTACACCCACCTGTTGCCGCTGCCCGCCTTCCTGCTCATGCATGACGA
CATACGGACGCACTGGCTTTTGGCGTTCACGGGCGAGTCCTACCAGTTGC
CCCTCCTGGGCGTGGCAGTGCCCCTAATCCTGCTATACTTATTGGGCAAC
GTGCTTGCGCAGCATTTGTGCATCAGCTCCGTTTACACCCTGACCACGGA
GTGCAGCTCGCTGACGGTGACTCTGATCCTCACACTCCGCAAGTTCATCT
CGCTGGTCTTTTCGATCGTATACTTCCGAAATCCCTTCACCTGGTGGCAC
TGGCTGGGCACCGCGCTAGTCTTTGTGGGCACCTTGATGTTTGCAAATGT
GATCAGAGTTCCGAAA
>C2
ATGAATTTATCCATCCGCGCTATTTCGGCCATCTGCGGCGTTTTCTTGGG
CTGCTGCAGTGGCGTCGTCTTCCTGGAGCTCCTGGTTAAACTGGATCCCG
GCGCTGGAAACCTTATAACTGGCGCCCAGTTTGCATTTATTGCCCTCGAG
GGCTTCATTTTCACCTCGAAGTTTGGCCTGGCTCAGAGAGTGATCAGCCT
GCGCGACTATGGGCTTCTTGTGGCCATGTTTTTCCTGACCAGCGTGTGTA
ACAACTACGTGTTCAAGTTCAATGTTCCAATGACACTGCACATGATCATC
CGCGGCGGTTCGCTGATCTCCAACATGTGCCTGGGCACGTTGATCCTGAA
GAGGAGCTACCGGTTGAGTCAGTACATATCGGTGCTCATGATCAGCGTGG
GTATTTTTGTCTGCACATATTTCTCCAGTCCGGATTTGGTGGGTAAGAGG
GAGAATTTGGACAACGGCGCCGAGACGGATACGTTCTGGTGGCTGTTGGG
CGTGGCACTCTTGGTGCTGGCTCTATTTGTGTCCTCCTACATGGGCATTA
CCCAGGAGTTGCTGTATCGACGTCATGGCAAGTGCGCCAGGGAAGCGTTG
TATTACACCCACCTGTTGCCACTGCCCGCCTTCCTGCTCATGCATGACGA
CATACGGACGCACTGGCTTTTGGCGTTCGCTGGCGATTCCTACCAGTTGC
CACTCCTGGGCGTGGCAGTGCCACTAATGCTGCTGTACTTATTGGGCAAC
GTGCTGGCGCAGCATTTGTGCATCAGCTCCGTTTACACCCTGACCACGGA
ATGCAGCTCACTGACGGTGACTCTGATCCTCACACTCCGCAAGTTCATCT
CGCTGGTCTTTTCGATCATGTACTTCCGTAATTCATTCACCTGGTGGCAC
TGGCTGGGCACCGCGCTGGTCTTTGTGGGCACCTTGATGTTTGCAAATGT
GATCAGAGTTCCGAAA
>C3
ATGTATTTATCCATCCGCGCTATTTCGGCCATCTGCGGCGTTTTCTTGGG
CTGCTGCAGTGGCGTCGTCTTCCTGGAGCTCCTGGTTAAACTGGATCCCG
GCGCTGGAAACCTTATAACTGGCGCCCAGTTTGCATTTATTGCCCTCGAG
GGCTTCATTTTCACCTCGAAGTTTGGCCTGGCTCAGAGAGTGATCAGCTT
GCGCGACTATGCGCTTCTTGTGGCCATGTTTTTTCTGACCAGCGTGTGTA
ACAACTACGTGTTCAAGTTCAATGTTCCAATGACACTGCACATGATCATC
CGCGGCGGTTCGCTGATCTCCAACATGTGCCTGGGCACGTTGATCCTGAA
GAGGAGCTACCGGTTGAGTCAGTACATATCGGTGCTCATGATCAGCGTGG
GCATTTTTGTCTGCACATATTTCTCCAGTCCGGATTTGGTGGGTAAGAGG
GAGAATTTGGACAGTGGCGCCGAGACGGATACGTTCTGGTGGCTGTTGGG
CGTGGCACTCTTGGTGCTGGCTCTATTTGTGTCCTCCTACATGGGCATTA
CCCAGGAGTTGCTGTATCGACGTCATGGCAAGTGCGCCAGGGAAGCGTTG
TATTACACCCACCTGTTGCCACTGCCCGCCTTCCTGCTCATGCATGACGA
CATACGGACGCACTGGCTTTTGGCGTTCGCTGGCGAATCCTACCAGTTGC
CACTCCTGGGCGTGGCAGTGCCACTAATCCTGCTGTACTTATTGGGCAAC
GTGCTGGCGCAGCATTTGTGCATCAGCTCCGTTTACACCCTGACCACGGA
ATGCAGCTCACTGACGGTGACTCTGATCCTCACACTCCGCAAGTTCATCT
CGCTGGTCTTTTCGATCATGTACTTCCGTAATCCATTCACCTGGTGGCAC
TGGCTGGGCACCGCGCTGGTCTTTGTGGGCACCTTGATGTTTGCAAATGT
GATCAGAGTTCCGAAA
>C4
ATGCATTTATCCATCCGCGCTGTTTTGGCCATCTGCGGCGTCTTCTTGGG
CTGCTGCAGTGGCGTCGTTTTTCTGGAGCTTCTGGTCAAACTGGATCCTG
GCGCTGGAAACCTTATAACTGTCGCCCAGTTTGCATTTATTGCTGTGGAG
GGCTTTGTCTTCACCTCGAAGTTCGGGCTGGCCCAGAGATTGATCAGCCT
TCGGGATTATGCGCTCCTAGTGGCCATGTTCTTCCTGACCAGCGTGTGCA
ACAACTACGTGTTCAAGTTCAATGTCCCAATGACGCTGCACATGATCATC
CGCGGCGGTTCGCTGATCTCCAATATGTGCCTGGGCACATTGGTTCTTAA
GAGGAGCTACCGGTTGAGTCAGTACATATCGGTGCTCATGATCAGCGTGG
GCATTTTCGTCTGCACATATTTTTCCAGTCCGGATTTGGTTGGTAAGCAG
GAGAATTTGGATAGCAGGGCCGAGGCTGATAAGTTTTGGTGGCTGTTGGG
CGTGGCACTCTTAGTGCTGGCTCTCTTCATCTCCTCCTACATGGGCATAA
CCCAGGAGTTGCTGTATCGACGTCATGGCAAGTGCGCGAGGGAAGCGTTG
TACTACACCCACCTATTGCCACTGCCCGCCTTTCTGCTCATGCAGGACGA
CATACGGACGCACTGGCTCCTGGCGTTCGCAGGCGAGTCCTACCAGTTGC
CTCTCCTGGGCGTGGCAGTGCCATTAATCCTGCTGTACTTATTGGGCAAC
GTGCTGGCGCAGCATTTGTGCATCAGCTCCGTTTACACTCTGACCACGGA
ATGCAGCTCGCTGACGGTGACTCTGATCCTGACACTTCGCAAGTTCATCT
CGCTGGTCTTTTCGATCATATACTTCCGAAATCCCTTCACCTGGTGGCAC
TGGCTGGGCACCGCGCTCGTCTTTGTGGGCACCTTGATGTTTGCAGATGT
GATTAGAGTTCCGAAA
>C5
ATGCATTTATCCATCCGCGCAGTTTTGGCCATTTGCGGCGTTTTCTTTGG
CTGCTGCAGTGGCGTCGTCTTCCTGGAGCTCCTGGTTAAACTAGATCCCG
GCGCTGGAAACCTTATAACTGCCGCCCAGTTTGCATTTATTGCCCTGGAG
GGCTTTATTTTCACCTCCAAGCTTGGGCTGGCCCAGAGAGTGATCAGCCT
GCGGGACTATGCGCTCCTCGTGGCCATGTTTTTTCTGACCAGCGTGTGCA
ACAACTACGTGTTCAAGTTCAATGTCCCAATGACACTGCACATGATCATT
CGCGGCGGTTCGCTGATCTCCAACATGTGCCTGGGCACATTGATCCTGAA
GAGGAGCTACCGGTTGAGTCAGTACATATCGGTGCTCATGATCAGCGTGG
GCATTTTCGTCTGCACATATTTTTCCAGTCCGGATTTGGTTGGTAAGAGG
GAGAGTTTGGACAGTAGCGCCGAGGAGGATAAGTTCTGGTGGCTGTTGGG
CGTAGCACTCTTGGTGCTGGCTCTGTTTGTATCCTCCTACATGGGCATAA
CCCAGGAGTTGCTGTATCGACGTCATGGCAAGTGCGCGAGGGAAGCGTTG
TATTACACCCACCTATTGCCACTGCCCGCCTTTCTGCTCATGCTGGACGA
CATACGGACGCACTGGCTCCTGGCGTTCGCGGACGAGTCCAACCAGTTGA
CCCTCCTGGGGGTGGCAGTGCCCCTAATCCTGCTGTACTTATTGGGCAAC
GTGCTGGCCCAGCATTTGTGCATCAGCTCCGTTTACACTCTGACCACAGA
ATGCAGCTCGCTGACGGTGACTCTGATCCTAACACTCCGCAAGTTCATCT
CGCTGGTCTTTTCGATCATATACTTCCGAAATCCCTTCACCTGGTGGCAC
TGGCTGGGCACCGCCCTGGTCTTCGTGGGCACCTTGCTGTTTGCTGATGT
GATCAGAGTTCCGAAA
>C6
ATGAGTTTATCCACCCGCGCTGTATTGGCCACTTGCGGCGTCTTTTTGGG
CTGCTGCAGTGGCGTTGTTTTCCTGGAGCTCCTAGTTAAACTGGATCCCG
GCGCTGGAAACCTGATAACTGCCGCCCAGTTTGCATTTATTGCCCTGGAG
GGCTTCGTCTTCACCTCAAGGTTTGGATTGGCCAAGCGGGTGATCAGTCT
GCGCGACTATGCGCTCCTGGTGGCCATGTTCTTCCTGACCAGCGTGTGCA
ACAACTATGTGTTCGAGTTCAATGTTCCGATGACGCTACACATGATCATC
CGCGGCGGCTCCCTTATCTCGAATATGTGCTTAGGCACGTTGATCCTGAA
GAGAAGATACCGGCTGAGTCAGTACATATCGGTGGTCATGATCAGCGTGG
GCATTTTCATCTGCACTTACTTTTCCAGTCCGGATTTAGGTGCTGAGAAG
GAGGATCTTGATAGCACTGCCAAGACGGATATATTCTGGTGGCTAGTGGG
CGTGCTCCTGCTGGTCCTGGCTCTATTTGTATCATCCTACATGGGCGTTA
CCCAGGAATTGCTGTACCGACGTCATGGCAAGTGCGCCAGGGAAGCTTTG
TATTACACCCATCTGCTGCCACTGCCCGCCTTTCTGCTGATGCAGGATAA
CATACGGACGCACTGGCTCCTGGCCTTGGCAGGGGAGTCCTACCAGTTGC
CTCTTCTGGGCGTGGCAGTGCCCCTAATCCTGCTATATTTAATAGGAAAC
GTGCTAGCTCAGCATCTGTGCATCAGTTCTGTTTACACTCTGACCACAGA
ATGCAGCTCACTGACGGTTACTTTGATCTTAACACTCCGGAAGTTCATCT
CGCTGGTCTTTTCGATCATATACTTCCGGAATCCCTTCACCTTGTACCAC
TGGCTTGGTACAGTGCTAGTCTTTGTGGGTACCTTAATGTTTGCAAATGT
GATCAGAGTTCCCAAA
>C1
MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFKVPMTLHMII
RGGSLISNMCLCTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKM
ENLDSGAEADTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFTGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIVYFRNPFTWWH
WLGTALVFVGTLMFANVIRVPK
>C2
MNLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYGLLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ENLDNGAETDTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFAGDSYQLPLLGVAVPLMLLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIMYFRNSFTWWH
WLGTALVFVGTLMFANVIRVPK
>C3
MYLSIRAISAICGVFLGCCSGVVFLELLVKLDPGAGNLITGAQFAFIALE
GFIFTSKFGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ENLDSGAETDTFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMHDDIRTHWLLAFAGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIMYFRNPFTWWH
WLGTALVFVGTLMFANVIRVPK
>C4
MHLSIRAVLAICGVFLGCCSGVVFLELLVKLDPGAGNLITVAQFAFIAVE
GFVFTSKFGLAQRLISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLVLKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKQ
ENLDSRAEADKFWWLLGVALLVLALFISSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMQDDIRTHWLLAFAGESYQLPLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTWWH
WLGTALVFVGTLMFADVIRVPK
>C5
MHLSIRAVLAICGVFFGCCSGVVFLELLVKLDPGAGNLITAAQFAFIALE
GFIFTSKLGLAQRVISLRDYALLVAMFFLTSVCNNYVFKFNVPMTLHMII
RGGSLISNMCLGTLILKRSYRLSQYISVLMISVGIFVCTYFSSPDLVGKR
ESLDSSAEEDKFWWLLGVALLVLALFVSSYMGITQELLYRRHGKCAREAL
YYTHLLPLPAFLLMLDDIRTHWLLAFADESNQLTLLGVAVPLILLYLLGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTWWH
WLGTALVFVGTLLFADVIRVPK
>C6
MSLSTRAVLATCGVFLGCCSGVVFLELLVKLDPGAGNLITAAQFAFIALE
GFVFTSRFGLAKRVISLRDYALLVAMFFLTSVCNNYVFEFNVPMTLHMII
RGGSLISNMCLGTLILKRRYRLSQYISVVMISVGIFICTYFSSPDLGAEK
EDLDSTAKTDIFWWLVGVLLLVLALFVSSYMGVTQELLYRRHGKCAREAL
YYTHLLPLPAFLLMQDNIRTHWLLALAGESYQLPLLGVAVPLILLYLIGN
VLAQHLCISSVYTLTTECSSLTVTLILTLRKFISLVFSIIYFRNPFTLYH
WLGTVLVFVGTLMFANVIRVPK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/74/CG14511-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 966 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480559844
      Setting output file names to "/opt/ADOPS/74/CG14511-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1043959091
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 4097976362
      Seed = 1424844782
      Swapseed = 1480559844
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 37 unique site patterns
      Division 2 has 21 unique site patterns
      Division 3 has 74 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3070.563967 -- -24.965149
         Chain 2 -- -3090.747955 -- -24.965149
         Chain 3 -- -2990.363087 -- -24.965149
         Chain 4 -- -3033.510749 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3030.621043 -- -24.965149
         Chain 2 -- -3039.116673 -- -24.965149
         Chain 3 -- -2958.446629 -- -24.965149
         Chain 4 -- -3026.993667 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3070.564] (-3090.748) (-2990.363) (-3033.511) * [-3030.621] (-3039.117) (-2958.447) (-3026.994) 
        500 -- (-2562.735) (-2572.036) (-2556.104) [-2540.149] * (-2559.556) [-2550.839] (-2557.928) (-2576.351) -- 0:00:00
       1000 -- (-2535.194) (-2557.196) [-2529.486] (-2537.724) * (-2538.965) (-2540.662) [-2524.059] (-2571.310) -- 0:00:00
       1500 -- (-2512.789) (-2552.986) (-2515.963) [-2516.553] * (-2534.253) (-2520.551) [-2515.527] (-2541.655) -- 0:00:00
       2000 -- [-2504.916] (-2556.695) (-2509.610) (-2507.064) * [-2505.528] (-2510.591) (-2510.579) (-2527.685) -- 0:00:00
       2500 -- (-2504.456) (-2527.426) (-2494.891) [-2497.985] * [-2508.068] (-2502.999) (-2507.469) (-2521.666) -- 0:06:39
       3000 -- [-2498.492] (-2510.047) (-2497.943) (-2507.799) * (-2509.904) [-2503.080] (-2503.201) (-2507.829) -- 0:05:32
       3500 -- [-2498.939] (-2503.023) (-2494.484) (-2502.105) * (-2504.536) [-2500.490] (-2500.569) (-2502.648) -- 0:04:44
       4000 -- [-2499.403] (-2498.866) (-2494.066) (-2500.322) * (-2504.773) [-2500.160] (-2496.799) (-2501.804) -- 0:04:09
       4500 -- (-2500.081) [-2497.858] (-2506.521) (-2495.115) * (-2497.784) [-2493.476] (-2508.628) (-2502.442) -- 0:03:41
       5000 -- (-2505.835) (-2498.619) [-2499.005] (-2497.299) * (-2498.637) (-2498.078) (-2504.070) [-2495.808] -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- (-2498.000) (-2502.167) (-2506.730) [-2498.786] * [-2506.548] (-2502.296) (-2498.130) (-2496.764) -- 0:03:00
       6000 -- [-2497.284] (-2507.546) (-2496.656) (-2497.393) * (-2501.281) (-2501.797) [-2505.813] (-2507.437) -- 0:02:45
       6500 -- [-2498.287] (-2511.865) (-2494.808) (-2503.805) * [-2494.538] (-2506.014) (-2498.967) (-2502.574) -- 0:02:32
       7000 -- (-2500.436) (-2494.738) (-2498.106) [-2504.641] * [-2498.058] (-2500.222) (-2505.223) (-2499.694) -- 0:04:43
       7500 -- (-2498.939) [-2495.064] (-2500.950) (-2505.124) * (-2501.594) [-2493.142] (-2497.931) (-2500.800) -- 0:04:24
       8000 -- [-2494.931] (-2496.717) (-2502.439) (-2503.210) * [-2497.630] (-2497.015) (-2503.025) (-2503.833) -- 0:04:08
       8500 -- [-2495.095] (-2501.816) (-2500.334) (-2493.655) * (-2492.944) (-2500.788) (-2493.491) [-2498.049] -- 0:03:53
       9000 -- [-2498.562] (-2495.421) (-2495.055) (-2491.126) * (-2503.619) (-2495.470) [-2499.180] (-2502.974) -- 0:03:40
       9500 -- (-2495.539) [-2497.481] (-2494.803) (-2498.265) * (-2495.542) (-2498.661) [-2500.911] (-2506.750) -- 0:03:28
      10000 -- (-2499.650) [-2494.833] (-2494.905) (-2502.214) * (-2496.696) [-2496.022] (-2502.584) (-2496.886) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      10500 -- [-2492.113] (-2504.371) (-2497.422) (-2499.551) * (-2496.557) [-2493.487] (-2506.091) (-2499.603) -- 0:03:08
      11000 -- [-2499.211] (-2501.970) (-2501.235) (-2501.575) * (-2499.667) (-2495.824) (-2508.118) [-2498.243] -- 0:02:59
      11500 -- (-2502.189) (-2498.588) (-2496.449) [-2498.102] * (-2500.991) [-2493.014] (-2501.547) (-2496.924) -- 0:04:17
      12000 -- (-2505.860) [-2499.956] (-2496.167) (-2501.908) * [-2501.550] (-2495.344) (-2506.131) (-2501.613) -- 0:04:07
      12500 -- (-2503.156) [-2503.481] (-2501.199) (-2503.259) * [-2507.006] (-2500.670) (-2501.677) (-2498.115) -- 0:03:57
      13000 -- (-2502.429) [-2497.901] (-2496.921) (-2499.878) * (-2498.334) [-2497.331] (-2507.646) (-2499.272) -- 0:03:47
      13500 -- (-2507.686) [-2494.377] (-2492.695) (-2495.463) * (-2497.987) (-2495.403) (-2504.989) [-2497.740] -- 0:03:39
      14000 -- [-2498.595] (-2494.443) (-2494.787) (-2502.627) * [-2494.599] (-2502.922) (-2505.644) (-2496.123) -- 0:03:31
      14500 -- (-2502.272) (-2494.633) [-2495.235] (-2492.456) * (-2499.014) [-2494.611] (-2499.616) (-2495.728) -- 0:04:31
      15000 -- [-2497.589] (-2498.334) (-2507.130) (-2499.209) * (-2493.055) [-2492.084] (-2503.198) (-2499.474) -- 0:04:22

      Average standard deviation of split frequencies: 0.009821

      15500 -- (-2497.451) (-2496.815) (-2499.241) [-2497.473] * (-2502.723) [-2493.158] (-2494.724) (-2498.899) -- 0:04:14
      16000 -- (-2502.094) [-2494.216] (-2496.077) (-2499.375) * [-2495.654] (-2501.111) (-2498.002) (-2506.924) -- 0:04:06
      16500 -- (-2511.226) (-2500.809) [-2497.394] (-2500.414) * (-2499.819) [-2498.529] (-2497.105) (-2499.433) -- 0:03:58
      17000 -- (-2499.580) (-2496.917) [-2499.439] (-2504.283) * [-2495.222] (-2499.654) (-2500.514) (-2505.703) -- 0:03:51
      17500 -- (-2497.121) [-2495.493] (-2499.716) (-2499.429) * [-2496.530] (-2494.642) (-2504.970) (-2509.317) -- 0:03:44
      18000 -- (-2495.831) (-2503.870) [-2499.853] (-2504.230) * (-2493.356) (-2501.434) [-2498.269] (-2501.602) -- 0:03:38
      18500 -- (-2497.366) [-2493.417] (-2503.197) (-2495.024) * (-2498.128) [-2494.963] (-2493.940) (-2495.481) -- 0:03:32
      19000 -- (-2494.073) (-2496.586) [-2500.569] (-2498.821) * (-2498.597) (-2501.429) [-2502.290] (-2499.068) -- 0:04:18
      19500 -- (-2493.543) [-2496.527] (-2498.810) (-2493.312) * (-2500.554) (-2501.684) (-2496.888) [-2495.364] -- 0:04:11
      20000 -- (-2499.460) [-2495.697] (-2499.555) (-2499.731) * (-2498.497) [-2497.543] (-2505.009) (-2499.729) -- 0:04:05

      Average standard deviation of split frequencies: 0.007603

      20500 -- (-2496.054) (-2503.163) [-2496.119] (-2497.417) * (-2498.165) (-2503.268) [-2497.689] (-2502.998) -- 0:03:58
      21000 -- [-2498.458] (-2506.879) (-2503.762) (-2496.861) * (-2495.375) (-2498.670) (-2498.055) [-2494.814] -- 0:03:53
      21500 -- (-2499.255) (-2504.173) (-2506.970) [-2501.068] * (-2498.385) (-2499.116) (-2496.633) [-2497.648] -- 0:03:47
      22000 -- [-2502.431] (-2498.915) (-2503.728) (-2501.947) * (-2500.242) [-2501.839] (-2498.605) (-2496.643) -- 0:03:42
      22500 -- (-2505.868) (-2495.380) (-2498.775) [-2492.929] * [-2497.144] (-2502.505) (-2503.415) (-2495.263) -- 0:03:37
      23000 -- [-2496.172] (-2502.397) (-2501.744) (-2496.713) * (-2498.746) (-2494.651) [-2502.166] (-2498.302) -- 0:03:32
      23500 -- [-2499.806] (-2494.558) (-2498.595) (-2502.371) * (-2502.916) (-2497.110) [-2501.490] (-2498.752) -- 0:04:09
      24000 -- (-2500.581) (-2503.038) (-2496.572) [-2504.494] * (-2498.113) (-2500.013) (-2493.168) [-2498.332] -- 0:04:04
      24500 -- (-2500.378) (-2497.078) (-2497.256) [-2503.679] * (-2504.223) (-2496.851) (-2498.823) [-2499.762] -- 0:03:58
      25000 -- (-2494.401) [-2498.593] (-2502.047) (-2497.281) * (-2508.139) [-2493.962] (-2499.248) (-2502.816) -- 0:03:54

      Average standard deviation of split frequencies: 0.012087

      25500 -- (-2496.284) (-2501.375) (-2504.043) [-2511.347] * (-2501.347) [-2496.938] (-2497.056) (-2502.047) -- 0:03:49
      26000 -- [-2503.572] (-2501.225) (-2496.967) (-2501.953) * (-2502.949) (-2500.427) (-2498.733) [-2498.926] -- 0:03:44
      26500 -- [-2498.630] (-2491.429) (-2499.315) (-2499.021) * (-2497.075) [-2500.389] (-2497.660) (-2500.591) -- 0:03:40
      27000 -- (-2502.603) [-2498.802] (-2495.228) (-2499.116) * (-2503.764) (-2498.875) [-2495.723] (-2501.270) -- 0:03:36
      27500 -- (-2498.275) (-2508.536) (-2491.755) [-2505.863] * [-2506.879] (-2500.798) (-2497.514) (-2494.659) -- 0:03:32
      28000 -- [-2500.148] (-2496.443) (-2495.975) (-2494.668) * (-2495.448) (-2495.516) (-2503.271) [-2496.820] -- 0:04:03
      28500 -- (-2499.343) (-2500.528) [-2492.064] (-2509.373) * (-2497.772) (-2506.244) (-2501.750) [-2502.300] -- 0:03:58
      29000 -- [-2500.560] (-2499.557) (-2495.060) (-2498.521) * (-2500.526) (-2502.533) [-2495.264] (-2503.394) -- 0:03:54
      29500 -- (-2501.204) (-2504.757) (-2501.401) [-2496.659] * (-2497.279) (-2500.957) (-2498.651) [-2497.356] -- 0:03:50
      30000 -- [-2492.902] (-2506.321) (-2498.855) (-2500.112) * (-2502.335) (-2507.322) [-2494.118] (-2496.913) -- 0:03:46

      Average standard deviation of split frequencies: 0.005124

      30500 -- (-2505.192) (-2495.892) (-2507.582) [-2498.643] * (-2495.150) (-2511.111) (-2506.775) [-2498.930] -- 0:03:42
      31000 -- (-2500.946) (-2495.143) [-2496.238] (-2493.723) * (-2499.729) [-2499.899] (-2500.589) (-2505.148) -- 0:03:38
      31500 -- (-2503.276) [-2502.250] (-2503.166) (-2509.623) * (-2498.748) [-2506.268] (-2499.365) (-2499.986) -- 0:03:35
      32000 -- (-2493.829) (-2498.385) [-2500.212] (-2500.222) * (-2502.765) (-2502.989) (-2494.082) [-2500.571] -- 0:04:02
      32500 -- (-2493.327) (-2501.765) [-2500.254] (-2503.109) * (-2498.962) [-2499.855] (-2493.683) (-2505.180) -- 0:03:58
      33000 -- [-2495.291] (-2504.389) (-2504.429) (-2501.764) * (-2499.160) (-2505.680) [-2497.225] (-2502.077) -- 0:03:54
      33500 -- (-2498.940) [-2504.128] (-2500.962) (-2494.186) * [-2499.041] (-2504.134) (-2501.335) (-2498.768) -- 0:03:50
      34000 -- (-2502.232) [-2495.311] (-2497.036) (-2495.909) * (-2499.898) (-2500.987) [-2505.623] (-2498.928) -- 0:03:47
      34500 -- (-2499.517) (-2500.053) [-2493.103] (-2505.010) * [-2496.066] (-2497.074) (-2497.269) (-2502.930) -- 0:03:43
      35000 -- (-2500.839) (-2501.544) (-2501.239) [-2505.535] * (-2498.288) (-2498.334) [-2500.059] (-2500.560) -- 0:03:40

      Average standard deviation of split frequencies: 0.004365

      35500 -- (-2500.809) (-2501.601) (-2498.483) [-2503.049] * (-2500.098) (-2502.150) [-2497.303] (-2500.543) -- 0:04:04
      36000 -- (-2506.145) (-2496.187) [-2502.199] (-2508.033) * [-2495.462] (-2498.661) (-2495.249) (-2498.823) -- 0:04:01
      36500 -- (-2502.333) [-2495.919] (-2495.123) (-2499.482) * (-2498.875) (-2501.448) (-2495.712) [-2497.741] -- 0:03:57
      37000 -- (-2494.343) [-2499.375] (-2497.970) (-2499.133) * (-2500.550) (-2500.874) (-2498.389) [-2501.484] -- 0:03:54
      37500 -- (-2495.624) (-2497.647) [-2491.495] (-2495.851) * (-2503.360) (-2497.524) (-2497.659) [-2498.480] -- 0:03:51
      38000 -- (-2497.598) (-2501.759) (-2494.219) [-2498.969] * (-2507.657) (-2498.577) [-2498.900] (-2500.223) -- 0:03:47
      38500 -- (-2494.830) [-2501.593] (-2498.758) (-2497.625) * (-2498.147) (-2498.560) [-2499.433] (-2503.701) -- 0:03:44
      39000 -- [-2494.599] (-2499.988) (-2497.716) (-2496.470) * [-2497.185] (-2500.523) (-2495.484) (-2501.010) -- 0:03:41
      39500 -- [-2494.264] (-2506.047) (-2499.564) (-2501.156) * (-2505.839) (-2499.948) [-2505.132] (-2502.020) -- 0:04:03
      40000 -- (-2498.693) (-2501.337) (-2510.778) [-2499.666] * (-2516.038) (-2496.607) [-2495.401] (-2495.466) -- 0:04:00

      Average standard deviation of split frequencies: 0.007728

      40500 -- (-2502.795) (-2496.414) (-2499.682) [-2496.720] * [-2498.116] (-2505.045) (-2499.291) (-2501.573) -- 0:03:56
      41000 -- (-2500.475) (-2499.693) (-2500.293) [-2492.026] * (-2500.111) [-2501.381] (-2502.275) (-2496.616) -- 0:03:53
      41500 -- (-2498.088) [-2503.404] (-2504.600) (-2497.693) * (-2501.545) [-2498.634] (-2503.639) (-2498.774) -- 0:03:50
      42000 -- (-2494.489) (-2499.475) (-2493.091) [-2501.338] * [-2501.212] (-2502.008) (-2503.239) (-2502.114) -- 0:03:48
      42500 -- [-2493.344] (-2494.013) (-2505.046) (-2500.799) * [-2496.294] (-2500.190) (-2496.048) (-2496.853) -- 0:03:45
      43000 -- (-2497.148) (-2494.710) [-2493.872] (-2504.926) * (-2499.993) (-2497.976) [-2493.051] (-2496.567) -- 0:04:04
      43500 -- [-2497.736] (-2501.603) (-2499.858) (-2501.157) * (-2497.389) [-2500.697] (-2501.099) (-2498.500) -- 0:04:01
      44000 -- [-2497.218] (-2491.826) (-2510.371) (-2508.824) * (-2499.189) (-2496.260) (-2501.193) [-2502.977] -- 0:03:59
      44500 -- (-2506.402) (-2505.129) [-2500.602] (-2497.600) * (-2496.935) (-2503.125) [-2494.931] (-2503.312) -- 0:03:56
      45000 -- (-2502.914) [-2496.113] (-2500.958) (-2499.601) * (-2497.265) (-2503.681) (-2501.406) [-2495.228] -- 0:03:53

      Average standard deviation of split frequencies: 0.010248

      45500 -- (-2501.885) (-2497.948) [-2502.001] (-2502.033) * (-2498.590) [-2499.237] (-2498.432) (-2499.564) -- 0:03:50
      46000 -- (-2504.880) [-2500.276] (-2499.112) (-2507.718) * (-2497.779) (-2499.973) (-2497.558) [-2496.635] -- 0:03:48
      46500 -- [-2503.770] (-2498.715) (-2502.884) (-2498.427) * (-2505.714) (-2497.872) (-2501.061) [-2495.058] -- 0:03:45
      47000 -- [-2493.578] (-2503.768) (-2496.014) (-2496.796) * [-2497.643] (-2506.005) (-2496.102) (-2494.668) -- 0:03:43
      47500 -- [-2500.618] (-2495.057) (-2498.152) (-2497.550) * (-2504.701) (-2506.731) (-2505.465) [-2495.034] -- 0:04:00
      48000 -- (-2490.846) [-2498.224] (-2502.799) (-2503.265) * (-2506.855) [-2500.747] (-2499.859) (-2502.714) -- 0:03:58
      48500 -- [-2498.998] (-2494.284) (-2498.485) (-2499.324) * (-2493.494) [-2496.048] (-2499.993) (-2498.943) -- 0:03:55
      49000 -- (-2497.431) (-2496.287) [-2496.294] (-2492.904) * (-2499.393) (-2502.017) (-2502.215) [-2497.089] -- 0:03:52
      49500 -- (-2492.475) [-2498.420] (-2496.039) (-2495.224) * (-2494.987) (-2506.560) [-2496.274] (-2499.310) -- 0:03:50
      50000 -- [-2495.284] (-2502.060) (-2495.920) (-2496.249) * (-2499.173) [-2499.696] (-2500.159) (-2497.728) -- 0:03:48

      Average standard deviation of split frequencies: 0.006203

      50500 -- (-2496.931) (-2497.981) (-2502.791) [-2497.869] * [-2496.399] (-2498.722) (-2512.320) (-2498.708) -- 0:03:45
      51000 -- (-2502.517) [-2503.610] (-2498.689) (-2495.626) * (-2496.314) (-2494.964) [-2493.691] (-2497.673) -- 0:03:43
      51500 -- (-2499.802) (-2496.682) (-2497.277) [-2496.107] * [-2498.216] (-2502.356) (-2502.479) (-2500.580) -- 0:03:59
      52000 -- (-2501.231) [-2498.715] (-2502.775) (-2498.589) * (-2499.365) (-2497.717) [-2495.248] (-2496.594) -- 0:03:57
      52500 -- [-2498.260] (-2501.482) (-2517.579) (-2494.643) * (-2494.464) [-2495.096] (-2495.365) (-2495.880) -- 0:03:54
      53000 -- (-2498.099) [-2495.902] (-2505.978) (-2493.948) * [-2501.217] (-2497.260) (-2496.660) (-2506.901) -- 0:03:52
      53500 -- (-2496.789) (-2501.649) (-2508.563) [-2498.935] * (-2500.032) (-2492.237) [-2491.405] (-2499.777) -- 0:03:49
      54000 -- [-2494.824] (-2500.556) (-2503.878) (-2499.660) * [-2499.211] (-2499.552) (-2501.223) (-2497.272) -- 0:03:47
      54500 -- [-2495.086] (-2495.594) (-2507.698) (-2503.575) * (-2499.574) (-2492.956) [-2495.083] (-2498.639) -- 0:03:45
      55000 -- (-2498.722) [-2493.296] (-2508.653) (-2495.229) * (-2499.722) (-2499.744) (-2501.530) [-2502.152] -- 0:03:43

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-2498.038) (-2502.806) [-2493.098] (-2498.290) * (-2500.443) (-2504.992) [-2497.755] (-2498.861) -- 0:03:41
      56000 -- (-2500.502) [-2501.901] (-2496.796) (-2503.031) * (-2494.981) (-2504.332) (-2500.990) [-2493.177] -- 0:03:56
      56500 -- [-2494.668] (-2501.423) (-2498.824) (-2500.676) * (-2496.404) (-2508.001) [-2501.468] (-2497.020) -- 0:03:53
      57000 -- (-2498.566) (-2494.506) [-2495.612] (-2497.822) * (-2501.550) [-2499.894] (-2495.245) (-2495.540) -- 0:03:51
      57500 -- (-2496.138) [-2498.069] (-2500.025) (-2493.216) * [-2495.479] (-2503.158) (-2497.106) (-2496.584) -- 0:03:49
      58000 -- (-2508.111) (-2502.335) [-2495.038] (-2495.808) * (-2493.422) [-2496.254] (-2496.073) (-2501.676) -- 0:03:47
      58500 -- (-2500.217) (-2500.538) (-2502.774) [-2500.256] * (-2499.479) [-2496.504] (-2501.006) (-2503.105) -- 0:03:45
      59000 -- (-2504.222) (-2500.912) (-2498.146) [-2496.299] * [-2494.988] (-2497.575) (-2498.301) (-2498.888) -- 0:03:43
      59500 -- (-2497.817) [-2500.509] (-2497.546) (-2503.507) * (-2498.009) (-2503.058) (-2507.519) [-2504.380] -- 0:03:41
      60000 -- (-2501.153) [-2497.125] (-2502.143) (-2495.529) * (-2497.779) (-2504.052) [-2497.429] (-2502.802) -- 0:03:55

      Average standard deviation of split frequencies: 0.002590

      60500 -- [-2496.698] (-2497.221) (-2503.792) (-2498.437) * [-2501.244] (-2498.954) (-2493.899) (-2508.001) -- 0:03:52
      61000 -- (-2506.829) [-2493.826] (-2498.172) (-2496.918) * (-2500.071) (-2501.482) (-2505.674) [-2498.767] -- 0:03:50
      61500 -- [-2497.712] (-2501.280) (-2492.357) (-2498.874) * (-2499.447) (-2501.897) [-2498.675] (-2497.280) -- 0:03:48
      62000 -- (-2503.377) [-2501.695] (-2500.148) (-2500.348) * (-2501.878) (-2491.975) [-2497.567] (-2495.836) -- 0:03:46
      62500 -- (-2501.642) [-2502.242] (-2494.347) (-2497.017) * (-2500.108) [-2494.097] (-2493.368) (-2506.196) -- 0:03:45
      63000 -- (-2503.575) (-2501.334) [-2494.778] (-2500.303) * [-2502.539] (-2492.478) (-2495.877) (-2499.993) -- 0:03:43
      63500 -- (-2504.975) (-2501.134) (-2499.514) [-2497.979] * (-2503.056) [-2501.447] (-2493.210) (-2497.133) -- 0:03:55
      64000 -- [-2507.685] (-2504.013) (-2500.537) (-2506.083) * (-2498.130) (-2503.574) (-2501.050) [-2506.325] -- 0:03:54
      64500 -- (-2512.572) (-2500.117) [-2496.871] (-2497.362) * (-2499.681) (-2498.130) (-2501.487) [-2508.995] -- 0:03:52
      65000 -- (-2512.440) (-2499.549) [-2498.813] (-2500.163) * (-2500.643) (-2500.485) (-2496.936) [-2501.724] -- 0:03:50

      Average standard deviation of split frequencies: 0.002381

      65500 -- (-2504.376) (-2498.938) (-2496.317) [-2496.610] * (-2504.201) (-2497.150) [-2493.577] (-2500.781) -- 0:03:48
      66000 -- (-2502.695) (-2500.181) (-2493.865) [-2499.753] * (-2499.837) (-2499.811) (-2502.871) [-2497.079] -- 0:03:46
      66500 -- [-2496.354] (-2496.390) (-2503.020) (-2498.003) * [-2495.257] (-2497.641) (-2497.902) (-2500.850) -- 0:03:44
      67000 -- (-2498.676) (-2496.443) [-2493.612] (-2500.543) * (-2498.804) [-2498.270] (-2504.827) (-2500.481) -- 0:03:42
      67500 -- (-2494.191) (-2498.365) [-2495.152] (-2501.180) * (-2498.431) (-2500.418) (-2505.689) [-2495.373] -- 0:03:41
      68000 -- (-2498.127) [-2497.818] (-2503.595) (-2502.378) * [-2499.674] (-2499.737) (-2496.817) (-2504.756) -- 0:03:53
      68500 -- (-2500.316) [-2495.212] (-2503.329) (-2499.826) * (-2497.722) (-2496.141) [-2496.038] (-2500.028) -- 0:03:51
      69000 -- (-2500.503) (-2499.970) (-2499.255) [-2496.982] * (-2495.217) (-2497.404) (-2500.096) [-2498.543] -- 0:03:49
      69500 -- (-2502.415) (-2492.647) (-2497.496) [-2503.444] * (-2494.445) (-2496.020) [-2494.892] (-2505.912) -- 0:03:47
      70000 -- [-2496.036] (-2498.970) (-2510.420) (-2496.558) * [-2494.601] (-2501.011) (-2495.615) (-2497.820) -- 0:03:45

      Average standard deviation of split frequencies: 0.002224

      70500 -- (-2496.083) (-2500.420) (-2499.772) [-2494.475] * [-2495.892] (-2498.635) (-2502.427) (-2498.867) -- 0:03:44
      71000 -- [-2499.914] (-2506.400) (-2496.859) (-2497.547) * (-2502.257) [-2505.939] (-2500.396) (-2494.794) -- 0:03:42
      71500 -- (-2496.905) (-2502.150) (-2503.800) [-2498.575] * (-2497.788) (-2509.680) [-2497.793] (-2497.950) -- 0:03:40
      72000 -- (-2501.734) (-2493.317) [-2499.891] (-2501.451) * [-2497.199] (-2504.578) (-2496.220) (-2497.292) -- 0:03:52
      72500 -- (-2498.336) [-2493.167] (-2495.136) (-2507.432) * [-2498.349] (-2500.472) (-2499.129) (-2493.599) -- 0:03:50
      73000 -- [-2499.775] (-2495.395) (-2493.458) (-2497.977) * (-2500.947) [-2499.122] (-2492.201) (-2496.656) -- 0:03:48
      73500 -- (-2505.287) (-2504.475) [-2496.127] (-2501.481) * [-2501.069] (-2505.328) (-2501.416) (-2498.749) -- 0:03:46
      74000 -- (-2498.657) [-2491.945] (-2509.228) (-2502.888) * [-2495.682] (-2507.866) (-2497.797) (-2499.412) -- 0:03:45
      74500 -- (-2497.024) [-2495.983] (-2500.868) (-2502.627) * (-2498.955) (-2506.189) [-2499.860] (-2496.640) -- 0:03:43
      75000 -- (-2496.382) (-2507.921) [-2500.395] (-2499.305) * (-2498.323) (-2497.313) (-2494.210) [-2493.140] -- 0:03:42

      Average standard deviation of split frequencies: 0.002068

      75500 -- [-2496.033] (-2504.377) (-2499.414) (-2510.938) * (-2503.104) (-2495.577) (-2497.429) [-2496.328] -- 0:03:40
      76000 -- [-2500.463] (-2505.165) (-2507.231) (-2505.366) * (-2505.953) (-2502.733) [-2501.251] (-2497.391) -- 0:03:38
      76500 -- [-2501.917] (-2497.253) (-2503.357) (-2497.131) * (-2498.564) [-2502.683] (-2506.669) (-2498.110) -- 0:03:49
      77000 -- (-2500.595) (-2500.006) (-2497.276) [-2495.372] * (-2496.239) (-2506.828) [-2502.480] (-2507.055) -- 0:03:47
      77500 -- (-2509.094) (-2502.508) [-2499.722] (-2503.160) * (-2503.100) [-2497.581] (-2507.606) (-2496.591) -- 0:03:46
      78000 -- (-2510.696) (-2509.510) [-2495.778] (-2502.155) * (-2501.010) (-2504.441) [-2504.387] (-2502.441) -- 0:03:44
      78500 -- [-2511.487] (-2514.981) (-2513.506) (-2501.609) * (-2499.529) [-2501.006] (-2496.778) (-2495.880) -- 0:03:43
      79000 -- (-2498.528) (-2500.929) [-2506.112] (-2496.336) * (-2499.203) (-2500.103) (-2498.788) [-2502.918] -- 0:03:41
      79500 -- (-2499.306) (-2505.709) (-2501.896) [-2497.752] * [-2494.820] (-2494.122) (-2501.024) (-2497.561) -- 0:03:39
      80000 -- (-2500.701) (-2500.049) (-2503.289) [-2499.429] * (-2499.881) [-2499.157] (-2506.434) (-2495.349) -- 0:03:38

      Average standard deviation of split frequencies: 0.001948

      80500 -- (-2507.314) (-2498.710) (-2500.091) [-2502.733] * (-2503.740) [-2496.458] (-2497.574) (-2504.423) -- 0:03:37
      81000 -- (-2505.089) (-2498.484) [-2497.611] (-2494.226) * [-2499.250] (-2497.537) (-2502.021) (-2497.345) -- 0:03:46
      81500 -- (-2499.025) (-2499.910) (-2498.358) [-2493.672] * (-2508.502) (-2498.830) [-2494.125] (-2508.148) -- 0:03:45
      82000 -- (-2499.140) (-2499.769) [-2494.206] (-2503.521) * (-2504.801) [-2497.873] (-2499.777) (-2503.975) -- 0:03:43
      82500 -- (-2504.382) (-2496.656) [-2492.503] (-2496.247) * (-2501.846) (-2505.069) [-2498.103] (-2502.334) -- 0:03:42
      83000 -- (-2493.833) (-2496.846) [-2499.399] (-2494.250) * (-2512.452) (-2498.591) [-2500.459] (-2498.083) -- 0:03:40
      83500 -- (-2502.721) (-2500.394) [-2498.401] (-2501.480) * (-2499.548) (-2503.827) (-2497.073) [-2500.495] -- 0:03:39
      84000 -- (-2503.672) (-2501.496) (-2497.836) [-2498.562] * (-2503.895) [-2498.666] (-2495.896) (-2498.736) -- 0:03:38
      84500 -- (-2503.979) [-2493.975] (-2500.479) (-2498.639) * (-2499.407) (-2496.724) [-2500.485] (-2494.901) -- 0:03:36
      85000 -- (-2504.111) (-2492.501) [-2497.961] (-2497.834) * (-2495.413) [-2494.193] (-2502.932) (-2497.898) -- 0:03:35

      Average standard deviation of split frequencies: 0.001827

      85500 -- (-2505.116) (-2497.815) (-2492.374) [-2499.529] * [-2494.314] (-2498.441) (-2498.945) (-2498.563) -- 0:03:44
      86000 -- (-2504.690) (-2502.240) [-2495.291] (-2502.797) * [-2492.598] (-2503.170) (-2496.459) (-2512.816) -- 0:03:43
      86500 -- [-2504.013] (-2499.928) (-2497.151) (-2497.984) * (-2499.402) (-2499.518) [-2502.981] (-2505.260) -- 0:03:41
      87000 -- (-2501.900) [-2493.203] (-2503.441) (-2498.395) * [-2492.436] (-2498.848) (-2512.364) (-2495.942) -- 0:03:40
      87500 -- (-2499.017) (-2496.952) (-2495.088) [-2495.556] * [-2500.444] (-2499.522) (-2506.443) (-2494.882) -- 0:03:39
      88000 -- [-2504.758] (-2493.929) (-2497.277) (-2495.260) * (-2502.982) [-2493.551] (-2508.462) (-2493.295) -- 0:03:37
      88500 -- (-2496.157) (-2502.872) (-2493.690) [-2499.902] * (-2503.267) (-2500.697) (-2502.453) [-2497.242] -- 0:03:36
      89000 -- (-2493.830) (-2501.681) (-2495.788) [-2497.369] * (-2501.207) (-2500.821) (-2499.897) [-2495.645] -- 0:03:34
      89500 -- (-2500.365) (-2502.330) [-2502.006] (-2495.932) * [-2501.083] (-2497.182) (-2493.978) (-2497.644) -- 0:03:33
      90000 -- [-2500.464] (-2499.497) (-2500.867) (-2493.272) * (-2498.704) (-2500.229) [-2496.846] (-2497.588) -- 0:03:42

      Average standard deviation of split frequencies: 0.001733

      90500 -- (-2494.712) [-2499.467] (-2498.819) (-2499.969) * (-2495.406) (-2497.782) [-2504.100] (-2499.283) -- 0:03:41
      91000 -- (-2501.537) (-2492.973) [-2496.649] (-2504.585) * (-2494.284) (-2502.913) (-2499.204) [-2494.829] -- 0:03:39
      91500 -- (-2504.765) (-2501.971) (-2499.740) [-2501.901] * (-2500.891) (-2497.006) [-2498.371] (-2503.506) -- 0:03:38
      92000 -- (-2503.985) (-2499.689) (-2499.148) [-2498.677] * (-2496.840) (-2499.544) [-2495.820] (-2501.947) -- 0:03:37
      92500 -- (-2504.241) (-2496.044) (-2497.786) [-2494.344] * (-2495.638) (-2506.356) (-2501.111) [-2492.370] -- 0:03:35
      93000 -- (-2503.295) (-2503.697) (-2494.647) [-2497.159] * (-2495.010) (-2497.670) [-2492.584] (-2504.861) -- 0:03:34
      93500 -- (-2502.379) [-2502.045] (-2505.306) (-2498.292) * (-2500.110) (-2499.611) [-2494.748] (-2501.587) -- 0:03:33
      94000 -- (-2493.385) [-2494.124] (-2493.061) (-2499.897) * (-2506.248) (-2499.608) [-2497.247] (-2496.571) -- 0:03:32
      94500 -- (-2502.861) [-2497.228] (-2501.527) (-2499.180) * (-2495.362) (-2492.928) (-2502.407) [-2497.571] -- 0:03:40
      95000 -- (-2498.108) [-2494.911] (-2499.143) (-2503.081) * (-2500.961) (-2498.744) (-2496.830) [-2495.454] -- 0:03:39

      Average standard deviation of split frequencies: 0.001637

      95500 -- (-2500.440) [-2496.586] (-2504.820) (-2507.736) * (-2497.805) (-2501.781) (-2509.556) [-2495.222] -- 0:03:37
      96000 -- (-2502.942) [-2495.020] (-2499.298) (-2505.065) * [-2493.959] (-2503.560) (-2497.451) (-2499.537) -- 0:03:36
      96500 -- (-2504.539) (-2499.248) [-2500.500] (-2499.025) * (-2495.675) (-2502.493) (-2494.877) [-2497.106] -- 0:03:35
      97000 -- [-2492.515] (-2503.726) (-2500.539) (-2497.349) * [-2494.369] (-2500.631) (-2501.474) (-2498.437) -- 0:03:34
      97500 -- [-2497.414] (-2494.764) (-2504.874) (-2504.476) * (-2492.733) (-2503.297) [-2503.113] (-2499.977) -- 0:03:32
      98000 -- [-2497.806] (-2496.518) (-2503.623) (-2504.686) * [-2499.096] (-2501.930) (-2498.098) (-2499.251) -- 0:03:31
      98500 -- [-2499.092] (-2504.878) (-2503.710) (-2501.598) * (-2497.107) (-2503.596) (-2496.781) [-2499.371] -- 0:03:30
      99000 -- (-2497.106) (-2501.125) [-2494.425] (-2505.277) * [-2494.254] (-2505.832) (-2497.392) (-2502.365) -- 0:03:38
      99500 -- (-2501.132) (-2507.184) (-2500.529) [-2493.145] * (-2491.642) (-2498.953) (-2509.231) [-2499.619] -- 0:03:37
      100000 -- (-2498.453) [-2506.543] (-2499.819) (-2494.282) * (-2500.006) (-2502.202) [-2495.018] (-2508.287) -- 0:03:36

      Average standard deviation of split frequencies: 0.003122

      100500 -- (-2514.244) [-2497.422] (-2502.820) (-2512.327) * [-2500.518] (-2497.831) (-2513.477) (-2509.111) -- 0:03:34
      101000 -- (-2506.315) (-2494.352) [-2496.588] (-2501.408) * (-2496.432) (-2495.042) [-2501.254] (-2516.301) -- 0:03:33
      101500 -- (-2494.117) [-2499.477] (-2496.948) (-2502.944) * (-2498.691) [-2497.548] (-2497.640) (-2507.403) -- 0:03:32
      102000 -- (-2501.701) (-2495.179) [-2501.876] (-2511.989) * [-2496.048] (-2505.789) (-2499.960) (-2505.039) -- 0:03:31
      102500 -- (-2496.111) [-2502.082] (-2506.028) (-2499.653) * (-2499.153) (-2499.919) [-2493.157] (-2501.694) -- 0:03:30
      103000 -- (-2498.036) (-2503.528) [-2499.837] (-2501.637) * (-2495.125) (-2496.878) [-2494.516] (-2500.936) -- 0:03:29
      103500 -- (-2498.490) (-2494.080) [-2494.810] (-2500.998) * (-2499.695) (-2499.952) [-2495.265] (-2500.725) -- 0:03:36
      104000 -- [-2492.600] (-2501.520) (-2501.932) (-2513.313) * [-2495.667] (-2500.159) (-2505.245) (-2499.212) -- 0:03:35
      104500 -- (-2497.245) [-2503.036] (-2494.407) (-2494.583) * (-2493.238) (-2497.201) (-2504.139) [-2501.785] -- 0:03:34
      105000 -- (-2499.142) (-2497.698) (-2497.550) [-2500.966] * (-2497.079) (-2496.028) (-2498.422) [-2505.578] -- 0:03:33

      Average standard deviation of split frequencies: 0.001482

      105500 -- (-2504.981) [-2501.600] (-2505.301) (-2499.661) * (-2497.303) (-2502.954) (-2500.519) [-2498.088] -- 0:03:31
      106000 -- (-2506.254) (-2500.269) (-2503.317) [-2493.635] * (-2494.003) [-2504.653] (-2499.142) (-2501.069) -- 0:03:30
      106500 -- (-2506.144) (-2502.145) [-2500.054] (-2502.038) * (-2492.926) [-2502.796] (-2501.020) (-2499.917) -- 0:03:29
      107000 -- (-2501.326) [-2496.852] (-2500.528) (-2498.813) * [-2499.296] (-2498.481) (-2498.759) (-2501.635) -- 0:03:28
      107500 -- (-2503.324) [-2494.825] (-2496.427) (-2506.431) * (-2493.655) [-2497.216] (-2498.783) (-2504.230) -- 0:03:27
      108000 -- (-2496.837) [-2499.484] (-2502.471) (-2501.839) * (-2496.880) [-2500.914] (-2497.609) (-2511.228) -- 0:03:34
      108500 -- (-2497.928) (-2502.591) [-2498.327] (-2503.543) * (-2495.750) [-2501.674] (-2491.245) (-2504.095) -- 0:03:33
      109000 -- (-2499.503) (-2506.791) (-2498.204) [-2503.302] * (-2497.366) (-2497.988) [-2496.526] (-2500.078) -- 0:03:32
      109500 -- (-2493.677) (-2500.068) (-2500.996) [-2492.568] * [-2493.435] (-2498.492) (-2505.894) (-2501.690) -- 0:03:31
      110000 -- [-2494.438] (-2502.113) (-2503.074) (-2499.251) * (-2495.594) [-2499.556] (-2495.594) (-2498.924) -- 0:03:30

      Average standard deviation of split frequencies: 0.000000

      110500 -- [-2501.072] (-2504.792) (-2501.524) (-2509.572) * (-2496.235) (-2498.046) [-2501.061] (-2495.428) -- 0:03:29
      111000 -- [-2500.133] (-2499.910) (-2492.402) (-2501.815) * (-2493.765) [-2492.330] (-2496.480) (-2498.267) -- 0:03:28
      111500 -- (-2496.005) [-2498.203] (-2497.625) (-2502.847) * [-2496.857] (-2497.216) (-2500.468) (-2497.538) -- 0:03:27
      112000 -- (-2492.835) [-2492.929] (-2498.155) (-2497.863) * (-2503.637) (-2505.469) (-2499.518) [-2495.135] -- 0:03:26
      112500 -- [-2497.808] (-2501.014) (-2494.464) (-2506.580) * (-2498.459) (-2509.688) [-2507.723] (-2513.902) -- 0:03:33
      113000 -- (-2498.176) (-2505.413) [-2494.515] (-2504.530) * (-2498.552) (-2508.255) (-2494.795) [-2502.071] -- 0:03:31
      113500 -- (-2495.701) (-2501.805) (-2496.418) [-2498.785] * (-2498.809) (-2504.225) (-2499.570) [-2496.420] -- 0:03:30
      114000 -- (-2504.362) (-2501.632) (-2505.189) [-2497.470] * (-2496.710) [-2500.641] (-2499.487) (-2501.396) -- 0:03:29
      114500 -- (-2499.591) (-2497.464) [-2505.592] (-2501.618) * (-2499.105) [-2501.793] (-2510.414) (-2495.622) -- 0:03:28
      115000 -- [-2499.118] (-2494.409) (-2502.777) (-2510.952) * [-2492.808] (-2494.354) (-2496.675) (-2498.031) -- 0:03:27

      Average standard deviation of split frequencies: 0.000000

      115500 -- [-2493.116] (-2497.897) (-2498.328) (-2499.233) * [-2493.916] (-2497.398) (-2496.949) (-2503.459) -- 0:03:26
      116000 -- [-2495.017] (-2502.657) (-2502.253) (-2498.541) * (-2497.860) (-2503.317) [-2492.158] (-2504.459) -- 0:03:25
      116500 -- (-2504.913) (-2505.690) (-2498.564) [-2499.582] * (-2503.403) [-2497.362] (-2500.433) (-2502.276) -- 0:03:32
      117000 -- (-2497.058) (-2501.148) (-2502.387) [-2494.772] * [-2498.360] (-2492.775) (-2496.761) (-2499.803) -- 0:03:31
      117500 -- [-2497.611] (-2494.446) (-2503.530) (-2498.969) * (-2496.183) (-2499.476) (-2503.209) [-2497.899] -- 0:03:30
      118000 -- (-2498.343) (-2498.056) (-2500.706) [-2500.337] * (-2502.523) (-2493.050) (-2501.001) [-2502.754] -- 0:03:29
      118500 -- (-2496.579) [-2495.016] (-2504.448) (-2502.251) * (-2496.619) [-2498.563] (-2497.566) (-2495.264) -- 0:03:28
      119000 -- (-2501.773) (-2497.557) [-2500.458] (-2499.495) * (-2497.251) (-2502.323) [-2499.294] (-2495.812) -- 0:03:27
      119500 -- (-2500.686) [-2495.344] (-2499.461) (-2509.300) * [-2492.163] (-2495.970) (-2505.812) (-2496.665) -- 0:03:26
      120000 -- [-2497.909] (-2498.744) (-2500.454) (-2495.693) * [-2498.045] (-2497.310) (-2502.920) (-2494.500) -- 0:03:25

      Average standard deviation of split frequencies: 0.000000

      120500 -- [-2501.052] (-2505.588) (-2497.141) (-2500.945) * (-2504.129) (-2501.430) (-2501.625) [-2502.892] -- 0:03:31
      121000 -- (-2503.043) (-2492.876) [-2499.273] (-2498.654) * [-2498.168] (-2499.621) (-2503.251) (-2503.086) -- 0:03:30
      121500 -- (-2499.916) (-2495.038) (-2501.305) [-2500.347] * (-2502.746) [-2500.298] (-2506.104) (-2495.167) -- 0:03:29
      122000 -- (-2498.776) [-2494.272] (-2503.755) (-2495.552) * (-2499.257) [-2499.299] (-2498.859) (-2499.555) -- 0:03:28
      122500 -- (-2500.489) [-2496.676] (-2499.435) (-2509.237) * (-2497.936) (-2496.675) [-2503.509] (-2501.354) -- 0:03:27
      123000 -- [-2503.545] (-2495.686) (-2496.595) (-2500.664) * [-2494.216] (-2499.800) (-2510.254) (-2500.530) -- 0:03:26
      123500 -- [-2494.664] (-2498.329) (-2502.600) (-2497.392) * (-2501.380) (-2501.213) [-2496.593] (-2495.222) -- 0:03:25
      124000 -- [-2494.217] (-2507.080) (-2500.458) (-2499.133) * (-2499.098) (-2500.114) (-2499.082) [-2491.454] -- 0:03:24
      124500 -- (-2498.350) [-2502.302] (-2494.148) (-2499.954) * (-2502.905) (-2505.941) (-2496.862) [-2494.200] -- 0:03:30
      125000 -- (-2498.150) (-2500.062) (-2497.214) [-2497.276] * (-2497.648) (-2513.953) (-2498.897) [-2502.227] -- 0:03:30

      Average standard deviation of split frequencies: 0.002494

      125500 -- [-2500.272] (-2499.928) (-2493.608) (-2502.065) * [-2503.960] (-2496.932) (-2499.870) (-2504.243) -- 0:03:29
      126000 -- (-2502.810) (-2498.088) (-2504.976) [-2506.281] * (-2505.565) [-2498.533] (-2502.321) (-2498.268) -- 0:03:28
      126500 -- (-2496.394) [-2495.416] (-2494.640) (-2496.747) * (-2502.177) (-2500.472) (-2508.354) [-2498.039] -- 0:03:27
      127000 -- [-2495.856] (-2492.266) (-2497.351) (-2501.222) * (-2499.059) [-2495.728] (-2494.169) (-2501.485) -- 0:03:26
      127500 -- (-2497.810) [-2494.894] (-2500.570) (-2501.528) * (-2497.170) (-2504.519) (-2499.383) [-2499.387] -- 0:03:25
      128000 -- [-2495.819] (-2502.004) (-2498.182) (-2505.140) * (-2496.006) (-2502.632) (-2498.184) [-2498.505] -- 0:03:24
      128500 -- [-2499.041] (-2493.425) (-2499.178) (-2496.824) * [-2498.041] (-2503.861) (-2501.555) (-2498.499) -- 0:03:30
      129000 -- (-2505.037) [-2493.688] (-2501.502) (-2496.852) * (-2495.368) (-2505.234) (-2495.652) [-2496.899] -- 0:03:29
      129500 -- (-2499.081) (-2495.704) [-2500.472] (-2513.249) * (-2506.172) (-2505.436) [-2498.708] (-2502.080) -- 0:03:28
      130000 -- (-2500.524) (-2497.170) [-2502.424] (-2501.831) * (-2503.911) [-2498.922] (-2492.591) (-2498.606) -- 0:03:27

      Average standard deviation of split frequencies: 0.003608

      130500 -- (-2497.267) [-2494.483] (-2501.617) (-2501.918) * (-2500.427) (-2495.252) (-2494.177) [-2500.609] -- 0:03:26
      131000 -- (-2502.868) [-2496.993] (-2498.068) (-2501.457) * (-2502.811) (-2507.585) [-2497.056] (-2504.424) -- 0:03:25
      131500 -- (-2503.327) [-2492.762] (-2500.461) (-2506.325) * [-2500.872] (-2504.036) (-2500.185) (-2499.811) -- 0:03:31
      132000 -- (-2499.972) (-2495.910) (-2501.621) [-2505.462] * (-2494.431) (-2503.121) [-2496.670] (-2503.967) -- 0:03:30
      132500 -- [-2494.670] (-2498.512) (-2497.801) (-2499.670) * (-2499.193) (-2503.661) [-2502.416] (-2501.856) -- 0:03:29
      133000 -- (-2508.599) (-2505.504) [-2498.432] (-2498.595) * (-2497.849) (-2501.613) (-2502.396) [-2500.315] -- 0:03:28
      133500 -- (-2506.108) [-2501.940] (-2493.346) (-2501.613) * (-2501.332) [-2495.278] (-2494.488) (-2498.271) -- 0:03:27
      134000 -- (-2496.235) [-2494.901] (-2505.936) (-2497.910) * (-2494.645) (-2502.285) (-2497.098) [-2498.276] -- 0:03:26
      134500 -- (-2497.376) [-2498.372] (-2498.760) (-2499.961) * (-2498.009) [-2499.887] (-2491.661) (-2499.610) -- 0:03:25
      135000 -- (-2495.356) (-2508.953) (-2498.343) [-2502.170] * (-2496.874) [-2493.437] (-2495.755) (-2505.406) -- 0:03:31

      Average standard deviation of split frequencies: 0.004622

      135500 -- [-2496.860] (-2500.097) (-2494.538) (-2502.236) * (-2498.432) [-2495.738] (-2499.479) (-2501.330) -- 0:03:30
      136000 -- (-2501.880) (-2504.114) [-2494.869] (-2501.722) * (-2498.609) [-2495.793] (-2496.925) (-2494.697) -- 0:03:29
      136500 -- (-2500.375) [-2497.502] (-2494.973) (-2502.450) * (-2498.000) (-2500.872) [-2499.778] (-2502.098) -- 0:03:28
      137000 -- [-2497.018] (-2504.064) (-2496.312) (-2505.465) * [-2501.443] (-2498.514) (-2503.052) (-2502.749) -- 0:03:27
      137500 -- (-2492.927) (-2496.895) [-2501.176] (-2509.839) * (-2502.093) (-2504.648) [-2496.900] (-2499.558) -- 0:03:27
      138000 -- (-2499.085) (-2502.304) (-2496.449) [-2493.511] * (-2506.097) (-2498.784) [-2497.510] (-2501.736) -- 0:03:26
      138500 -- [-2494.432] (-2503.961) (-2494.865) (-2500.448) * (-2507.911) (-2499.997) [-2495.202] (-2504.410) -- 0:03:25
      139000 -- [-2500.654] (-2495.604) (-2503.598) (-2495.011) * (-2502.843) (-2498.116) [-2498.320] (-2512.846) -- 0:03:24
      139500 -- [-2496.219] (-2503.349) (-2497.464) (-2496.955) * (-2501.750) [-2495.492] (-2496.485) (-2500.150) -- 0:03:29
      140000 -- (-2497.475) (-2493.963) (-2498.433) [-2498.965] * (-2506.535) [-2502.754] (-2495.669) (-2499.094) -- 0:03:28

      Average standard deviation of split frequencies: 0.004468

      140500 -- (-2502.073) (-2501.852) [-2498.946] (-2503.144) * (-2505.500) (-2502.669) (-2493.531) [-2497.386] -- 0:03:27
      141000 -- [-2501.492] (-2498.527) (-2501.803) (-2494.862) * (-2500.341) [-2495.255] (-2499.293) (-2497.914) -- 0:03:27
      141500 -- (-2507.920) [-2498.732] (-2501.702) (-2498.879) * (-2499.589) (-2497.254) [-2491.111] (-2498.364) -- 0:03:26
      142000 -- (-2501.969) [-2494.813] (-2498.941) (-2504.235) * (-2502.969) (-2498.859) (-2502.351) [-2503.326] -- 0:03:25
      142500 -- (-2499.433) (-2497.566) [-2501.452] (-2507.659) * (-2498.510) [-2498.129] (-2497.512) (-2506.812) -- 0:03:24
      143000 -- (-2499.587) (-2503.139) [-2499.043] (-2504.273) * (-2495.376) [-2500.076] (-2499.699) (-2498.034) -- 0:03:23
      143500 -- (-2501.073) (-2496.753) [-2499.291] (-2508.657) * (-2498.731) [-2495.005] (-2505.735) (-2504.140) -- 0:03:22
      144000 -- [-2497.088] (-2499.619) (-2502.399) (-2506.617) * (-2502.989) (-2502.655) [-2496.681] (-2494.368) -- 0:03:28
      144500 -- (-2497.395) [-2498.396] (-2497.840) (-2502.337) * (-2499.109) (-2505.807) [-2495.581] (-2499.604) -- 0:03:27
      145000 -- [-2497.342] (-2504.952) (-2504.828) (-2501.525) * (-2501.988) (-2500.876) [-2495.703] (-2496.287) -- 0:03:26

      Average standard deviation of split frequencies: 0.004305

      145500 -- [-2502.754] (-2500.799) (-2497.472) (-2504.651) * (-2497.958) (-2497.838) [-2497.094] (-2498.048) -- 0:03:25
      146000 -- [-2496.920] (-2501.300) (-2499.155) (-2502.147) * (-2496.164) (-2500.694) (-2498.647) [-2494.735] -- 0:03:24
      146500 -- (-2497.874) (-2496.515) [-2503.445] (-2500.431) * (-2502.845) (-2500.027) (-2495.018) [-2493.758] -- 0:03:23
      147000 -- (-2494.796) (-2493.308) (-2503.136) [-2492.092] * (-2496.153) (-2498.115) (-2497.416) [-2501.643] -- 0:03:23
      147500 -- (-2501.286) (-2499.152) [-2496.163] (-2498.040) * (-2495.745) (-2494.197) [-2493.295] (-2510.499) -- 0:03:22
      148000 -- [-2493.926] (-2508.304) (-2499.659) (-2497.379) * (-2497.286) (-2499.801) (-2500.139) [-2505.101] -- 0:03:27
      148500 -- (-2498.642) (-2502.643) [-2503.395] (-2503.572) * [-2506.448] (-2493.346) (-2496.697) (-2506.754) -- 0:03:26
      149000 -- (-2497.317) [-2499.740] (-2499.351) (-2499.579) * (-2495.552) (-2493.447) [-2498.033] (-2503.041) -- 0:03:25
      149500 -- (-2498.383) (-2501.267) [-2504.580] (-2497.747) * (-2499.037) (-2503.051) (-2500.613) [-2506.487] -- 0:03:24
      150000 -- (-2500.705) (-2498.722) [-2499.658] (-2494.715) * (-2500.869) [-2505.706] (-2500.056) (-2503.409) -- 0:03:24

      Average standard deviation of split frequencies: 0.005215

      150500 -- (-2498.490) (-2502.329) (-2498.413) [-2494.353] * (-2498.556) (-2503.451) [-2496.858] (-2516.009) -- 0:03:23
      151000 -- (-2501.203) (-2498.524) (-2496.747) [-2503.196] * (-2502.395) (-2494.159) [-2497.412] (-2503.906) -- 0:03:22
      151500 -- (-2498.730) (-2499.699) [-2495.303] (-2497.097) * [-2498.513] (-2498.846) (-2502.017) (-2498.341) -- 0:03:21
      152000 -- (-2502.873) (-2498.532) (-2499.500) [-2499.385] * [-2502.673] (-2499.030) (-2498.421) (-2502.257) -- 0:03:20
      152500 -- [-2498.067] (-2496.607) (-2502.517) (-2500.799) * (-2497.794) (-2498.937) (-2494.004) [-2500.187] -- 0:03:25
      153000 -- (-2498.857) (-2495.776) (-2503.878) [-2500.648] * [-2496.343] (-2505.377) (-2505.997) (-2498.805) -- 0:03:24
      153500 -- (-2515.203) [-2497.841] (-2500.836) (-2495.617) * (-2496.289) [-2499.360] (-2504.977) (-2500.969) -- 0:03:24
      154000 -- [-2495.949] (-2510.277) (-2491.687) (-2500.522) * [-2493.567] (-2499.456) (-2497.158) (-2502.018) -- 0:03:23
      154500 -- [-2495.079] (-2498.959) (-2496.026) (-2495.571) * (-2494.053) [-2498.347] (-2497.181) (-2504.895) -- 0:03:22
      155000 -- (-2502.798) (-2511.229) [-2498.733] (-2496.903) * (-2501.077) [-2495.897] (-2504.195) (-2494.804) -- 0:03:21

      Average standard deviation of split frequencies: 0.005036

      155500 -- (-2502.320) [-2497.029] (-2506.540) (-2502.021) * (-2505.973) (-2498.091) [-2496.197] (-2502.710) -- 0:03:20
      156000 -- (-2505.523) [-2496.249] (-2495.138) (-2500.722) * (-2499.145) [-2494.034] (-2493.904) (-2496.987) -- 0:03:20
      156500 -- [-2500.652] (-2499.398) (-2501.131) (-2499.353) * (-2508.954) (-2500.056) [-2496.928] (-2495.929) -- 0:03:24
      157000 -- [-2501.546] (-2499.131) (-2496.772) (-2500.391) * (-2501.141) (-2504.257) [-2495.743] (-2495.266) -- 0:03:24
      157500 -- (-2495.715) (-2497.971) (-2496.516) [-2503.073] * [-2503.293] (-2499.155) (-2503.993) (-2502.707) -- 0:03:23
      158000 -- (-2498.755) [-2497.673] (-2505.542) (-2503.422) * (-2503.011) [-2500.415] (-2500.953) (-2501.659) -- 0:03:22
      158500 -- [-2500.555] (-2500.176) (-2497.053) (-2502.714) * [-2501.305] (-2504.039) (-2493.896) (-2505.825) -- 0:03:21
      159000 -- [-2502.165] (-2505.077) (-2497.979) (-2502.662) * [-2501.618] (-2505.819) (-2509.432) (-2500.273) -- 0:03:20
      159500 -- [-2498.119] (-2498.786) (-2496.857) (-2499.380) * (-2509.814) [-2505.251] (-2499.863) (-2500.869) -- 0:03:20
      160000 -- [-2496.788] (-2500.466) (-2494.394) (-2504.961) * (-2495.448) (-2494.311) (-2506.739) [-2496.833] -- 0:03:19

      Average standard deviation of split frequencies: 0.002934

      160500 -- (-2505.783) [-2497.824] (-2498.550) (-2499.707) * (-2496.683) (-2497.494) [-2499.818] (-2501.294) -- 0:03:18
      161000 -- [-2498.553] (-2493.145) (-2501.031) (-2506.328) * (-2498.890) (-2501.774) [-2500.359] (-2501.252) -- 0:03:23
      161500 -- (-2509.921) (-2493.961) (-2502.927) [-2499.061] * (-2500.403) (-2508.162) (-2498.032) [-2500.355] -- 0:03:22
      162000 -- (-2511.451) (-2497.961) (-2496.761) [-2500.072] * [-2495.684] (-2504.781) (-2507.738) (-2502.959) -- 0:03:21
      162500 -- (-2508.302) (-2503.877) [-2499.666] (-2495.011) * (-2507.541) (-2495.763) (-2496.456) [-2496.040] -- 0:03:21
      163000 -- (-2502.926) (-2498.462) (-2499.674) [-2496.967] * (-2502.634) [-2496.980] (-2495.046) (-2502.669) -- 0:03:20
      163500 -- [-2499.933] (-2499.950) (-2495.730) (-2500.641) * [-2495.488] (-2496.410) (-2495.673) (-2496.369) -- 0:03:19
      164000 -- [-2493.794] (-2500.766) (-2498.260) (-2495.272) * (-2498.129) (-2496.279) (-2498.613) [-2495.163] -- 0:03:18
      164500 -- (-2504.840) (-2507.400) [-2496.568] (-2497.238) * (-2497.091) (-2495.143) [-2501.586] (-2496.933) -- 0:03:18
      165000 -- (-2494.472) [-2499.491] (-2501.892) (-2502.701) * (-2491.499) [-2507.141] (-2495.412) (-2501.623) -- 0:03:22

      Average standard deviation of split frequencies: 0.000947

      165500 -- (-2495.085) [-2497.379] (-2497.997) (-2502.561) * (-2493.363) [-2498.147] (-2500.473) (-2504.476) -- 0:03:21
      166000 -- [-2495.147] (-2495.004) (-2496.611) (-2499.480) * [-2494.020] (-2500.388) (-2494.864) (-2499.870) -- 0:03:20
      166500 -- (-2497.817) [-2496.896] (-2497.362) (-2500.010) * (-2495.250) (-2502.603) (-2501.087) [-2503.443] -- 0:03:20
      167000 -- (-2497.809) (-2494.947) (-2501.001) [-2496.892] * (-2505.845) [-2500.987] (-2499.760) (-2497.315) -- 0:03:19
      167500 -- (-2500.527) (-2500.688) [-2499.543] (-2496.723) * (-2501.339) [-2503.519] (-2500.115) (-2498.332) -- 0:03:18
      168000 -- (-2497.610) [-2495.134] (-2500.460) (-2495.902) * (-2498.264) (-2503.155) (-2499.522) [-2499.482] -- 0:03:18
      168500 -- (-2497.373) (-2502.639) (-2495.837) [-2493.886] * (-2497.668) (-2504.048) (-2498.453) [-2496.018] -- 0:03:17
      169000 -- [-2509.129] (-2493.763) (-2499.572) (-2501.064) * (-2500.750) [-2498.069] (-2501.755) (-2495.148) -- 0:03:16
      169500 -- [-2496.878] (-2501.166) (-2492.537) (-2497.994) * [-2497.793] (-2504.725) (-2492.603) (-2500.232) -- 0:03:20
      170000 -- [-2494.621] (-2495.948) (-2502.485) (-2497.497) * (-2504.096) (-2498.209) (-2499.813) [-2493.461] -- 0:03:20

      Average standard deviation of split frequencies: 0.001841

      170500 -- (-2497.910) (-2501.252) (-2498.377) [-2497.248] * (-2504.381) (-2496.898) (-2496.411) [-2497.644] -- 0:03:19
      171000 -- (-2508.212) (-2494.867) [-2502.354] (-2499.657) * (-2500.405) [-2499.403] (-2499.011) (-2497.553) -- 0:03:18
      171500 -- (-2494.217) [-2502.444] (-2498.481) (-2496.968) * (-2505.141) [-2496.721] (-2500.630) (-2496.372) -- 0:03:18
      172000 -- (-2498.849) (-2503.594) [-2499.483] (-2500.200) * (-2500.233) (-2497.853) (-2493.726) [-2496.747] -- 0:03:17
      172500 -- [-2499.710] (-2500.219) (-2501.218) (-2494.523) * (-2504.315) (-2509.341) [-2497.633] (-2507.473) -- 0:03:16
      173000 -- (-2499.486) (-2495.970) (-2498.604) [-2497.077] * [-2494.605] (-2499.732) (-2507.102) (-2494.544) -- 0:03:15
      173500 -- (-2510.690) (-2493.830) [-2496.092] (-2499.614) * [-2502.132] (-2495.462) (-2502.460) (-2500.134) -- 0:03:15
      174000 -- (-2505.785) (-2499.042) [-2499.471] (-2495.218) * [-2497.503] (-2500.596) (-2499.208) (-2496.449) -- 0:03:19
      174500 -- (-2504.391) (-2507.872) [-2502.301] (-2494.955) * (-2507.399) (-2498.235) (-2498.103) [-2498.871] -- 0:03:18
      175000 -- (-2491.021) (-2514.327) [-2497.449] (-2498.422) * (-2497.518) (-2500.327) [-2501.014] (-2497.745) -- 0:03:18

      Average standard deviation of split frequencies: 0.001786

      175500 -- [-2497.497] (-2504.480) (-2501.196) (-2507.040) * (-2501.031) (-2500.566) [-2492.692] (-2502.474) -- 0:03:17
      176000 -- [-2501.136] (-2499.121) (-2493.110) (-2499.151) * (-2503.594) (-2497.227) (-2497.486) [-2494.794] -- 0:03:16
      176500 -- [-2504.396] (-2503.461) (-2497.575) (-2502.539) * (-2500.938) [-2497.525] (-2498.723) (-2498.749) -- 0:03:15
      177000 -- (-2503.013) [-2503.196] (-2494.971) (-2492.878) * (-2498.949) (-2502.866) [-2493.703] (-2500.281) -- 0:03:15
      177500 -- [-2500.834] (-2501.056) (-2495.726) (-2501.930) * [-2495.344] (-2498.258) (-2494.839) (-2499.529) -- 0:03:14
      178000 -- (-2504.078) (-2499.129) [-2501.103] (-2500.091) * (-2500.070) (-2503.838) (-2493.612) [-2502.015] -- 0:03:18
      178500 -- (-2498.075) [-2497.199] (-2503.957) (-2503.510) * (-2498.498) (-2495.371) [-2496.088] (-2503.300) -- 0:03:17
      179000 -- (-2504.550) [-2492.776] (-2497.335) (-2501.820) * [-2495.437] (-2498.530) (-2497.591) (-2498.182) -- 0:03:17
      179500 -- (-2506.439) (-2494.530) [-2504.755] (-2498.835) * (-2499.659) [-2497.915] (-2492.675) (-2500.202) -- 0:03:16
      180000 -- (-2498.509) [-2494.744] (-2500.996) (-2501.231) * (-2500.469) [-2497.970] (-2500.833) (-2495.090) -- 0:03:15

      Average standard deviation of split frequencies: 0.001740

      180500 -- (-2497.253) (-2498.662) [-2499.023] (-2496.982) * [-2499.646] (-2494.795) (-2508.166) (-2506.292) -- 0:03:15
      181000 -- (-2497.222) (-2497.503) [-2497.358] (-2495.848) * [-2505.420] (-2501.274) (-2501.144) (-2499.551) -- 0:03:14
      181500 -- (-2498.927) (-2500.970) (-2496.352) [-2499.933] * (-2499.772) (-2496.798) (-2502.303) [-2496.839] -- 0:03:13
      182000 -- (-2507.458) (-2507.048) (-2504.280) [-2499.183] * (-2494.828) [-2497.217] (-2495.981) (-2501.436) -- 0:03:13
      182500 -- (-2505.158) [-2497.075] (-2495.552) (-2499.426) * (-2494.407) [-2492.372] (-2500.179) (-2500.319) -- 0:03:17
      183000 -- [-2495.699] (-2504.590) (-2498.261) (-2498.367) * (-2496.355) (-2496.822) [-2495.163] (-2498.630) -- 0:03:16
      183500 -- (-2495.944) [-2504.905] (-2497.130) (-2503.774) * (-2497.222) (-2498.960) [-2499.071] (-2503.107) -- 0:03:15
      184000 -- (-2498.291) (-2499.999) [-2494.475] (-2497.952) * (-2501.257) [-2501.640] (-2499.366) (-2496.317) -- 0:03:15
      184500 -- (-2493.243) (-2505.423) [-2500.987] (-2499.081) * (-2498.866) [-2493.889] (-2498.392) (-2493.984) -- 0:03:14
      185000 -- (-2494.285) (-2497.538) [-2500.114] (-2503.173) * [-2503.657] (-2503.797) (-2502.940) (-2499.904) -- 0:03:13

      Average standard deviation of split frequencies: 0.001690

      185500 -- (-2494.997) [-2504.422] (-2494.020) (-2501.141) * (-2501.140) (-2497.762) (-2499.683) [-2503.314] -- 0:03:13
      186000 -- (-2497.393) [-2499.724] (-2498.953) (-2497.937) * [-2494.977] (-2492.171) (-2501.011) (-2503.451) -- 0:03:12
      186500 -- (-2492.309) (-2499.079) (-2494.979) [-2504.241] * (-2497.950) (-2507.708) (-2498.697) [-2502.315] -- 0:03:16
      187000 -- (-2496.756) [-2494.769] (-2500.210) (-2504.237) * [-2496.817] (-2509.109) (-2497.899) (-2495.288) -- 0:03:15
      187500 -- (-2501.385) [-2495.568] (-2505.022) (-2499.980) * [-2502.350] (-2511.547) (-2501.287) (-2498.584) -- 0:03:15
      188000 -- (-2505.763) (-2496.706) (-2497.454) [-2497.978] * (-2510.644) (-2500.119) (-2497.595) [-2495.674] -- 0:03:14
      188500 -- (-2500.958) (-2497.713) (-2500.565) [-2495.652] * (-2497.097) [-2501.260] (-2491.924) (-2498.004) -- 0:03:13
      189000 -- [-2498.262] (-2500.485) (-2498.335) (-2505.263) * (-2504.238) (-2498.851) (-2501.972) [-2503.818] -- 0:03:13
      189500 -- (-2499.623) (-2495.973) (-2496.597) [-2504.390] * (-2495.318) (-2495.888) [-2498.519] (-2500.618) -- 0:03:12
      190000 -- [-2501.844] (-2496.472) (-2497.121) (-2499.022) * [-2496.547] (-2502.984) (-2496.379) (-2498.203) -- 0:03:11

      Average standard deviation of split frequencies: 0.001648

      190500 -- (-2499.504) (-2498.438) (-2500.227) [-2501.825] * (-2494.556) (-2501.613) [-2497.612] (-2492.075) -- 0:03:11
      191000 -- [-2495.546] (-2493.915) (-2495.057) (-2494.708) * (-2496.350) (-2496.777) [-2499.321] (-2494.793) -- 0:03:14
      191500 -- (-2499.957) [-2494.501] (-2498.185) (-2506.537) * (-2504.797) (-2494.885) (-2498.116) [-2498.999] -- 0:03:14
      192000 -- [-2500.309] (-2505.433) (-2501.991) (-2504.961) * (-2510.820) (-2497.958) (-2502.005) [-2499.160] -- 0:03:13
      192500 -- [-2507.109] (-2503.519) (-2503.226) (-2501.077) * (-2508.562) (-2499.066) [-2497.628] (-2498.289) -- 0:03:12
      193000 -- [-2503.775] (-2499.496) (-2497.266) (-2502.009) * (-2507.304) (-2498.197) [-2492.461] (-2495.508) -- 0:03:12
      193500 -- (-2506.058) (-2499.128) (-2498.362) [-2496.882] * [-2498.298] (-2498.559) (-2498.484) (-2494.487) -- 0:03:11
      194000 -- [-2500.597] (-2501.172) (-2507.746) (-2495.036) * (-2501.158) [-2500.047] (-2495.591) (-2493.340) -- 0:03:11
      194500 -- (-2498.217) [-2496.043] (-2502.433) (-2497.729) * (-2493.855) [-2497.423] (-2497.546) (-2497.570) -- 0:03:10
      195000 -- [-2495.503] (-2493.914) (-2500.663) (-2498.957) * (-2495.295) (-2495.643) [-2492.025] (-2502.346) -- 0:03:14

      Average standard deviation of split frequencies: 0.000802

      195500 -- (-2496.994) [-2495.567] (-2499.086) (-2502.169) * (-2495.859) [-2493.850] (-2493.301) (-2499.893) -- 0:03:13
      196000 -- [-2495.313] (-2499.401) (-2494.406) (-2510.155) * (-2500.270) (-2497.470) [-2493.753] (-2501.464) -- 0:03:12
      196500 -- (-2499.776) [-2496.152] (-2497.809) (-2501.849) * (-2498.160) (-2494.740) (-2496.533) [-2497.778] -- 0:03:12
      197000 -- [-2497.882] (-2504.862) (-2501.072) (-2497.281) * (-2503.931) (-2494.969) [-2506.568] (-2499.000) -- 0:03:11
      197500 -- (-2500.365) (-2505.700) (-2496.092) [-2500.405] * (-2505.720) (-2496.285) [-2502.420] (-2502.780) -- 0:03:10
      198000 -- [-2496.993] (-2508.391) (-2493.549) (-2495.330) * (-2506.697) (-2503.219) [-2498.919] (-2497.867) -- 0:03:10
      198500 -- (-2495.483) (-2502.944) (-2500.001) [-2498.171] * (-2501.587) (-2503.893) (-2499.586) [-2495.165] -- 0:03:13
      199000 -- (-2499.630) (-2505.082) (-2500.728) [-2494.642] * [-2497.227] (-2495.141) (-2496.624) (-2497.054) -- 0:03:13
      199500 -- (-2499.002) (-2505.717) [-2498.128] (-2502.802) * (-2504.426) [-2498.041] (-2510.157) (-2497.456) -- 0:03:12
      200000 -- [-2501.635] (-2500.907) (-2500.665) (-2503.800) * (-2502.265) (-2499.141) [-2494.982] (-2500.349) -- 0:03:12

      Average standard deviation of split frequencies: 0.000783

      200500 -- [-2504.302] (-2502.689) (-2499.472) (-2505.980) * (-2497.244) (-2496.205) [-2494.705] (-2497.730) -- 0:03:11
      201000 -- (-2496.125) (-2507.055) [-2494.897] (-2506.453) * (-2502.898) (-2494.484) [-2494.643] (-2505.225) -- 0:03:10
      201500 -- (-2503.724) [-2502.981] (-2505.789) (-2498.639) * (-2501.804) [-2494.465] (-2502.281) (-2504.988) -- 0:03:10
      202000 -- (-2498.596) (-2495.869) (-2496.337) [-2498.255] * (-2497.921) (-2505.633) [-2500.670] (-2500.775) -- 0:03:13
      202500 -- (-2508.910) (-2495.477) (-2506.930) [-2495.071] * (-2498.147) (-2502.005) (-2500.055) [-2494.871] -- 0:03:12
      203000 -- [-2500.285] (-2509.661) (-2502.110) (-2501.862) * [-2499.089] (-2500.185) (-2493.885) (-2503.853) -- 0:03:12
      203500 -- [-2494.123] (-2501.139) (-2512.233) (-2497.847) * (-2507.487) [-2497.071] (-2502.897) (-2496.244) -- 0:03:11
      204000 -- (-2498.104) (-2501.959) (-2507.028) [-2500.146] * (-2494.487) [-2498.982] (-2497.884) (-2493.763) -- 0:03:11
      204500 -- (-2498.547) (-2495.325) (-2503.410) [-2493.696] * (-2496.599) [-2496.020] (-2496.471) (-2507.130) -- 0:03:14
      205000 -- (-2495.924) (-2497.083) (-2504.725) [-2494.674] * (-2500.064) (-2500.398) (-2496.776) [-2493.766] -- 0:03:13

      Average standard deviation of split frequencies: 0.000763

      205500 -- [-2494.714] (-2495.485) (-2504.626) (-2494.299) * (-2498.081) (-2506.809) [-2496.770] (-2493.910) -- 0:03:13
      206000 -- [-2495.013] (-2493.272) (-2495.869) (-2500.838) * (-2504.551) (-2507.941) [-2496.852] (-2497.699) -- 0:03:12
      206500 -- (-2500.852) [-2496.501] (-2506.507) (-2500.933) * [-2500.212] (-2504.211) (-2497.990) (-2494.581) -- 0:03:12
      207000 -- (-2495.850) [-2496.367] (-2498.730) (-2494.499) * (-2499.177) (-2505.588) [-2496.191] (-2494.290) -- 0:03:11
      207500 -- (-2503.053) (-2500.721) [-2493.448] (-2505.094) * (-2500.826) (-2500.240) (-2499.733) [-2506.264] -- 0:03:10
      208000 -- (-2506.667) (-2495.546) [-2493.784] (-2497.690) * (-2504.301) (-2498.062) (-2510.265) [-2498.712] -- 0:03:10
      208500 -- (-2504.634) (-2498.269) [-2501.494] (-2495.584) * [-2497.062] (-2497.788) (-2493.711) (-2497.630) -- 0:03:09
      209000 -- (-2493.376) (-2503.050) (-2492.382) [-2498.281] * (-2500.389) (-2494.146) [-2495.659] (-2497.753) -- 0:03:13
      209500 -- [-2494.266] (-2509.211) (-2501.923) (-2496.311) * (-2495.177) (-2492.526) [-2504.319] (-2502.594) -- 0:03:12
      210000 -- (-2499.563) (-2504.984) [-2498.222] (-2496.995) * (-2501.446) (-2495.681) (-2507.527) [-2494.759] -- 0:03:11

      Average standard deviation of split frequencies: 0.001492

      210500 -- [-2497.495] (-2500.582) (-2501.795) (-2505.744) * (-2501.413) (-2496.079) (-2499.779) [-2500.052] -- 0:03:11
      211000 -- (-2496.738) (-2496.778) [-2500.838] (-2500.501) * (-2499.693) (-2504.732) (-2497.990) [-2503.050] -- 0:03:10
      211500 -- (-2496.454) (-2498.661) (-2500.896) [-2504.822] * (-2505.615) (-2496.682) (-2499.064) [-2502.606] -- 0:03:10
      212000 -- [-2498.469] (-2490.806) (-2496.113) (-2503.464) * (-2501.380) (-2501.162) (-2496.299) [-2501.202] -- 0:03:09
      212500 -- (-2498.124) (-2509.872) [-2494.980] (-2502.448) * (-2498.320) (-2499.131) [-2504.160] (-2508.925) -- 0:03:09
      213000 -- [-2496.967] (-2500.004) (-2494.937) (-2501.425) * (-2494.028) (-2504.170) (-2501.193) [-2512.014] -- 0:03:12
      213500 -- [-2498.321] (-2500.237) (-2497.007) (-2498.327) * (-2492.701) (-2502.140) (-2502.922) [-2501.072] -- 0:03:11
      214000 -- [-2497.883] (-2501.227) (-2504.595) (-2499.919) * (-2501.051) (-2505.296) [-2499.232] (-2498.342) -- 0:03:10
      214500 -- [-2498.309] (-2494.532) (-2498.163) (-2500.167) * (-2497.652) (-2501.152) [-2492.653] (-2500.692) -- 0:03:10
      215000 -- (-2506.221) (-2502.872) (-2500.345) [-2497.206] * [-2499.575] (-2502.376) (-2502.883) (-2496.927) -- 0:03:09

      Average standard deviation of split frequencies: 0.001455

      215500 -- (-2505.042) (-2505.469) (-2504.156) [-2500.307] * (-2499.904) (-2496.174) [-2497.096] (-2502.757) -- 0:03:09
      216000 -- [-2502.417] (-2497.066) (-2494.123) (-2495.670) * (-2499.027) (-2507.001) (-2494.477) [-2499.718] -- 0:03:08
      216500 -- [-2495.997] (-2497.335) (-2499.415) (-2495.199) * (-2496.617) [-2501.933] (-2499.320) (-2498.745) -- 0:03:08
      217000 -- (-2505.322) [-2498.676] (-2501.249) (-2498.409) * (-2498.605) (-2505.896) (-2501.174) [-2495.876] -- 0:03:11
      217500 -- (-2495.151) (-2495.012) (-2496.880) [-2505.380] * (-2500.060) (-2495.558) [-2496.960] (-2494.326) -- 0:03:10
      218000 -- (-2501.032) [-2495.321] (-2495.109) (-2504.397) * (-2497.722) (-2500.377) (-2500.359) [-2497.865] -- 0:03:10
      218500 -- [-2498.866] (-2500.324) (-2500.883) (-2503.299) * (-2507.081) (-2500.210) [-2502.069] (-2496.504) -- 0:03:09
      219000 -- [-2506.304] (-2498.297) (-2499.395) (-2509.057) * [-2492.553] (-2501.916) (-2505.589) (-2495.907) -- 0:03:09
      219500 -- (-2498.022) [-2496.570] (-2495.199) (-2494.573) * [-2491.856] (-2496.870) (-2496.258) (-2494.347) -- 0:03:08
      220000 -- (-2498.502) [-2495.259] (-2496.100) (-2515.079) * [-2495.546] (-2497.450) (-2503.656) (-2497.715) -- 0:03:11

      Average standard deviation of split frequencies: 0.000712

      220500 -- (-2497.801) (-2499.570) [-2495.414] (-2498.580) * (-2500.326) (-2497.866) (-2492.085) [-2505.596] -- 0:03:10
      221000 -- (-2498.821) [-2496.900] (-2497.755) (-2495.350) * (-2499.566) (-2499.989) [-2494.994] (-2500.824) -- 0:03:10
      221500 -- [-2503.455] (-2499.776) (-2504.405) (-2504.604) * [-2499.372] (-2496.142) (-2492.433) (-2496.298) -- 0:03:09
      222000 -- (-2504.151) (-2507.420) [-2496.181] (-2498.768) * (-2496.204) (-2497.633) [-2495.473] (-2496.350) -- 0:03:09
      222500 -- (-2496.097) [-2500.320] (-2508.428) (-2501.244) * (-2498.770) [-2499.665] (-2504.261) (-2498.680) -- 0:03:08
      223000 -- (-2494.258) (-2503.179) [-2494.026] (-2499.434) * (-2505.592) (-2504.754) [-2502.597] (-2500.825) -- 0:03:11
      223500 -- (-2496.488) (-2508.410) (-2500.962) [-2498.689] * (-2507.547) [-2497.561] (-2497.470) (-2503.789) -- 0:03:11
      224000 -- [-2495.948] (-2500.748) (-2500.375) (-2496.450) * (-2508.986) [-2498.596] (-2500.147) (-2497.500) -- 0:03:10
      224500 -- [-2497.226] (-2501.350) (-2502.858) (-2495.261) * [-2500.690] (-2501.640) (-2499.131) (-2506.294) -- 0:03:09
      225000 -- (-2497.376) (-2500.318) (-2503.525) [-2495.349] * (-2500.896) [-2498.094] (-2495.998) (-2496.865) -- 0:03:09

      Average standard deviation of split frequencies: 0.000695

      225500 -- (-2503.521) (-2497.607) [-2495.615] (-2497.249) * [-2496.740] (-2495.053) (-2493.264) (-2501.709) -- 0:03:08
      226000 -- (-2501.165) (-2495.737) (-2498.251) [-2499.397] * [-2493.887] (-2507.973) (-2495.888) (-2494.063) -- 0:03:08
      226500 -- (-2499.336) (-2500.712) (-2498.872) [-2496.298] * (-2495.876) (-2502.370) (-2494.744) [-2499.394] -- 0:03:07
      227000 -- (-2497.727) (-2500.207) [-2494.073] (-2498.530) * (-2500.993) (-2495.879) (-2513.347) [-2496.899] -- 0:03:10
      227500 -- (-2495.554) (-2499.940) [-2496.380] (-2497.823) * (-2493.611) (-2501.309) (-2504.502) [-2496.107] -- 0:03:10
      228000 -- (-2496.434) [-2496.736] (-2498.599) (-2500.330) * (-2494.929) (-2499.120) [-2499.065] (-2498.152) -- 0:03:09
      228500 -- (-2501.038) [-2502.284] (-2497.043) (-2501.763) * (-2500.072) [-2501.793] (-2494.266) (-2497.040) -- 0:03:09
      229000 -- (-2497.808) (-2496.610) [-2496.722] (-2496.690) * [-2495.411] (-2501.713) (-2500.777) (-2498.519) -- 0:03:08
      229500 -- (-2504.825) (-2501.795) [-2497.071] (-2496.030) * (-2493.477) (-2504.779) [-2494.876] (-2500.985) -- 0:03:08
      230000 -- [-2496.597] (-2495.839) (-2494.861) (-2502.634) * (-2493.869) [-2500.652] (-2502.830) (-2498.989) -- 0:03:07

      Average standard deviation of split frequencies: 0.000000

      230500 -- [-2498.917] (-2496.804) (-2505.675) (-2501.743) * [-2495.411] (-2495.841) (-2500.432) (-2498.246) -- 0:03:06
      231000 -- (-2501.525) (-2502.150) (-2502.435) [-2498.974] * (-2495.635) [-2495.340] (-2505.470) (-2496.031) -- 0:03:09
      231500 -- (-2499.614) (-2496.692) (-2503.425) [-2499.410] * (-2503.299) (-2498.795) [-2500.885] (-2497.188) -- 0:03:09
      232000 -- (-2498.954) (-2502.667) (-2501.319) [-2500.817] * (-2495.700) [-2502.986] (-2499.121) (-2498.068) -- 0:03:08
      232500 -- (-2496.755) [-2492.329] (-2497.871) (-2504.176) * [-2496.592] (-2500.032) (-2495.960) (-2504.620) -- 0:03:08
      233000 -- (-2509.620) (-2499.846) [-2500.260] (-2507.714) * (-2501.156) (-2495.202) [-2500.622] (-2502.516) -- 0:03:07
      233500 -- [-2501.393] (-2497.693) (-2495.611) (-2501.981) * (-2505.480) (-2499.442) (-2503.011) [-2505.075] -- 0:03:07
      234000 -- (-2493.716) [-2500.894] (-2499.469) (-2501.393) * (-2499.883) (-2501.615) [-2496.398] (-2496.405) -- 0:03:06
      234500 -- (-2499.146) (-2502.926) (-2505.600) [-2495.866] * (-2499.795) (-2500.905) [-2504.319] (-2495.254) -- 0:03:09
      235000 -- (-2504.549) (-2509.900) (-2503.879) [-2497.834] * (-2494.586) [-2499.774] (-2501.569) (-2504.016) -- 0:03:08

      Average standard deviation of split frequencies: 0.000000

      235500 -- [-2498.313] (-2504.213) (-2508.448) (-2498.064) * [-2497.969] (-2503.361) (-2499.151) (-2502.176) -- 0:03:08
      236000 -- (-2503.110) (-2495.793) [-2499.714] (-2501.891) * (-2497.670) (-2499.108) (-2502.566) [-2493.480] -- 0:03:07
      236500 -- [-2500.375] (-2499.915) (-2501.139) (-2498.241) * [-2497.007] (-2497.772) (-2498.133) (-2497.856) -- 0:03:07
      237000 -- [-2499.090] (-2497.543) (-2501.255) (-2497.299) * [-2499.307] (-2496.305) (-2500.817) (-2499.182) -- 0:03:06
      237500 -- (-2499.740) (-2492.264) [-2497.753] (-2502.510) * (-2500.973) [-2497.984] (-2497.580) (-2500.847) -- 0:03:06
      238000 -- (-2497.938) (-2500.971) (-2495.646) [-2497.483] * [-2497.686] (-2502.377) (-2502.843) (-2502.044) -- 0:03:05
      238500 -- (-2495.398) (-2498.832) [-2492.579] (-2496.851) * (-2493.652) (-2509.028) [-2500.288] (-2496.483) -- 0:03:08
      239000 -- (-2498.330) [-2497.416] (-2498.785) (-2496.532) * (-2497.363) (-2499.807) [-2495.328] (-2494.164) -- 0:03:07
      239500 -- (-2503.933) [-2498.485] (-2499.638) (-2500.079) * (-2501.954) (-2500.846) (-2492.203) [-2499.039] -- 0:03:07
      240000 -- (-2505.451) [-2495.380] (-2495.180) (-2492.735) * (-2495.399) (-2493.562) (-2498.320) [-2496.546] -- 0:03:06

      Average standard deviation of split frequencies: 0.000000

      240500 -- (-2506.401) (-2496.448) (-2499.763) [-2495.782] * (-2498.877) (-2501.168) [-2495.457] (-2499.703) -- 0:03:06
      241000 -- (-2502.037) (-2500.341) [-2492.448] (-2496.508) * [-2503.555] (-2502.282) (-2508.577) (-2494.185) -- 0:03:05
      241500 -- [-2495.723] (-2503.934) (-2497.905) (-2500.588) * [-2492.652] (-2499.059) (-2495.375) (-2503.659) -- 0:03:05
      242000 -- [-2494.044] (-2505.176) (-2499.471) (-2500.846) * (-2494.687) (-2500.771) (-2497.365) [-2500.438] -- 0:03:04
      242500 -- (-2495.124) (-2496.992) [-2498.429] (-2501.100) * (-2498.365) (-2498.698) (-2495.235) [-2499.045] -- 0:03:04
      243000 -- (-2502.028) [-2494.961] (-2500.656) (-2503.940) * (-2492.556) [-2495.467] (-2498.334) (-2496.246) -- 0:03:06
      243500 -- (-2498.116) (-2499.799) (-2504.231) [-2501.402] * (-2500.033) [-2495.733] (-2502.568) (-2496.125) -- 0:03:06
      244000 -- (-2497.650) (-2495.755) (-2506.864) [-2495.141] * (-2500.783) (-2499.994) [-2496.160] (-2497.892) -- 0:03:05
      244500 -- [-2497.879] (-2510.470) (-2504.393) (-2498.080) * [-2501.123] (-2504.425) (-2506.715) (-2502.767) -- 0:03:05
      245000 -- [-2499.741] (-2498.992) (-2504.849) (-2497.554) * [-2497.464] (-2499.038) (-2503.027) (-2501.133) -- 0:03:04

      Average standard deviation of split frequencies: 0.000639

      245500 -- (-2493.056) (-2495.766) (-2495.264) [-2498.591] * (-2500.026) (-2494.705) [-2506.891] (-2498.974) -- 0:03:04
      246000 -- (-2500.696) [-2504.993] (-2497.867) (-2499.320) * (-2498.549) (-2496.144) [-2501.729] (-2507.625) -- 0:03:03
      246500 -- (-2493.995) (-2506.166) (-2501.690) [-2500.061] * (-2503.178) [-2496.480] (-2504.231) (-2502.599) -- 0:03:03
      247000 -- (-2493.574) (-2500.911) (-2494.023) [-2500.731] * (-2499.901) [-2495.702] (-2495.515) (-2507.466) -- 0:03:02
      247500 -- (-2493.176) (-2501.938) [-2495.064] (-2494.094) * (-2503.241) (-2500.356) (-2496.547) [-2498.443] -- 0:03:05
      248000 -- [-2493.045] (-2499.922) (-2494.219) (-2496.806) * (-2498.338) [-2501.622] (-2500.837) (-2498.927) -- 0:03:04
      248500 -- (-2495.168) (-2497.077) [-2497.722] (-2499.254) * [-2494.857] (-2498.628) (-2501.063) (-2501.394) -- 0:03:04
      249000 -- (-2501.215) (-2501.878) (-2496.774) [-2497.780] * (-2494.562) [-2496.093] (-2500.965) (-2498.862) -- 0:03:03
      249500 -- (-2497.760) (-2494.567) [-2494.887] (-2501.082) * (-2504.319) [-2491.899] (-2498.582) (-2495.298) -- 0:03:03
      250000 -- (-2498.589) (-2497.004) [-2496.566] (-2495.517) * [-2503.372] (-2500.322) (-2496.203) (-2505.631) -- 0:03:03

      Average standard deviation of split frequencies: 0.000627

      250500 -- (-2500.311) (-2503.028) (-2498.444) [-2493.972] * (-2495.331) [-2501.187] (-2504.770) (-2494.687) -- 0:03:02
      251000 -- (-2498.837) (-2497.026) [-2500.871] (-2502.512) * (-2495.823) [-2494.290] (-2503.437) (-2495.267) -- 0:03:02
      251500 -- (-2495.542) [-2501.642] (-2502.111) (-2506.486) * (-2502.510) (-2501.939) (-2504.569) [-2495.201] -- 0:03:01
      252000 -- (-2499.774) (-2496.452) [-2499.040] (-2504.129) * (-2497.899) (-2495.901) [-2493.780] (-2500.101) -- 0:03:04
      252500 -- (-2496.657) [-2500.435] (-2498.127) (-2506.226) * [-2503.058] (-2496.721) (-2499.088) (-2498.654) -- 0:03:03
      253000 -- [-2495.192] (-2511.275) (-2496.878) (-2511.158) * (-2503.626) (-2499.651) (-2500.438) [-2502.476] -- 0:03:03
      253500 -- (-2499.345) [-2501.715] (-2499.543) (-2508.989) * (-2499.230) [-2499.779] (-2501.326) (-2492.759) -- 0:03:02
      254000 -- [-2498.600] (-2497.033) (-2502.492) (-2508.089) * [-2494.332] (-2503.039) (-2502.318) (-2502.286) -- 0:03:02
      254500 -- (-2501.055) [-2495.219] (-2497.062) (-2507.730) * (-2497.241) [-2494.022] (-2504.610) (-2494.721) -- 0:03:01
      255000 -- (-2508.427) [-2496.628] (-2500.522) (-2499.266) * (-2499.498) (-2496.602) (-2499.728) [-2504.566] -- 0:03:01

      Average standard deviation of split frequencies: 0.000614

      255500 -- (-2508.029) [-2497.310] (-2497.058) (-2502.557) * (-2496.852) [-2501.002] (-2503.231) (-2505.633) -- 0:03:00
      256000 -- (-2501.531) (-2503.049) (-2496.735) [-2498.330] * (-2501.434) (-2503.856) [-2502.101] (-2498.811) -- 0:03:00
      256500 -- (-2505.814) (-2502.221) (-2502.421) [-2496.191] * (-2500.149) (-2506.764) (-2497.206) [-2501.336] -- 0:03:02
      257000 -- [-2499.558] (-2502.571) (-2499.515) (-2501.248) * (-2496.027) (-2498.146) [-2494.308] (-2502.831) -- 0:03:02
      257500 -- (-2496.408) [-2502.021] (-2503.650) (-2499.376) * (-2500.202) [-2492.824] (-2496.925) (-2494.801) -- 0:03:01
      258000 -- (-2499.332) [-2498.453] (-2496.613) (-2499.069) * (-2501.712) (-2499.864) (-2499.370) [-2495.222] -- 0:03:01
      258500 -- [-2503.534] (-2500.247) (-2497.124) (-2494.094) * (-2493.821) (-2496.590) [-2500.549] (-2506.810) -- 0:03:00
      259000 -- (-2505.547) (-2502.892) [-2499.467] (-2496.765) * (-2494.480) (-2499.511) [-2496.365] (-2506.345) -- 0:03:00
      259500 -- (-2503.646) (-2500.685) [-2497.448] (-2498.945) * (-2495.401) (-2498.352) [-2501.887] (-2504.530) -- 0:02:59
      260000 -- (-2502.244) (-2504.779) [-2494.902] (-2501.687) * (-2494.769) (-2498.535) [-2495.384] (-2497.309) -- 0:02:59

      Average standard deviation of split frequencies: 0.000603

      260500 -- (-2501.277) (-2496.216) (-2494.297) [-2497.306] * [-2494.759] (-2496.270) (-2497.218) (-2500.463) -- 0:02:58
      261000 -- (-2503.324) (-2501.020) [-2497.227] (-2497.379) * (-2505.367) (-2497.842) [-2499.083] (-2499.675) -- 0:03:01
      261500 -- (-2494.251) [-2493.534] (-2495.835) (-2496.280) * (-2497.325) [-2492.565] (-2499.417) (-2500.924) -- 0:03:00
      262000 -- (-2503.872) (-2502.649) [-2496.181] (-2496.912) * [-2502.255] (-2494.539) (-2502.923) (-2506.291) -- 0:03:00
      262500 -- (-2497.230) (-2505.710) (-2496.466) [-2497.749] * (-2502.387) [-2495.178] (-2497.484) (-2500.286) -- 0:02:59
      263000 -- (-2501.679) [-2499.491] (-2496.285) (-2498.089) * (-2501.324) (-2501.636) [-2491.545] (-2507.027) -- 0:02:59
      263500 -- (-2502.056) (-2499.432) [-2494.830] (-2493.304) * (-2500.137) (-2496.850) (-2494.826) [-2508.342] -- 0:02:58
      264000 -- (-2496.883) (-2503.218) (-2494.752) [-2493.518] * (-2498.986) [-2499.093] (-2502.515) (-2506.194) -- 0:02:58
      264500 -- [-2493.168] (-2501.771) (-2505.805) (-2499.683) * (-2495.145) [-2496.573] (-2497.794) (-2500.915) -- 0:02:57
      265000 -- (-2493.320) (-2502.233) [-2496.613] (-2497.006) * (-2493.900) (-2498.506) (-2492.554) [-2494.257] -- 0:03:00

      Average standard deviation of split frequencies: 0.000591

      265500 -- (-2495.053) (-2498.556) (-2496.741) [-2501.400] * (-2496.517) [-2496.297] (-2496.529) (-2498.462) -- 0:02:59
      266000 -- [-2499.207] (-2497.546) (-2499.859) (-2504.247) * (-2499.629) (-2493.256) [-2496.960] (-2494.530) -- 0:02:59
      266500 -- (-2506.202) [-2503.171] (-2497.133) (-2499.788) * (-2496.857) [-2492.770] (-2498.676) (-2493.218) -- 0:02:58
      267000 -- (-2504.789) [-2497.256] (-2501.495) (-2499.540) * (-2509.013) (-2495.297) [-2497.509] (-2495.046) -- 0:02:58
      267500 -- (-2497.255) (-2497.888) [-2502.055] (-2517.407) * [-2501.727] (-2500.171) (-2505.177) (-2497.459) -- 0:02:57
      268000 -- (-2503.485) [-2494.172] (-2498.579) (-2509.484) * (-2500.495) (-2501.195) (-2498.832) [-2501.761] -- 0:02:57
      268500 -- (-2504.838) [-2497.608] (-2504.523) (-2512.414) * (-2498.892) [-2495.471] (-2495.582) (-2500.245) -- 0:02:59
      269000 -- (-2500.202) [-2496.219] (-2502.984) (-2506.528) * (-2497.442) (-2496.629) (-2496.085) [-2495.996] -- 0:02:59
      269500 -- [-2496.679] (-2495.920) (-2502.962) (-2506.951) * (-2497.964) (-2498.146) [-2502.454] (-2501.765) -- 0:02:58
      270000 -- (-2497.863) (-2505.141) (-2502.953) [-2492.008] * [-2502.268] (-2502.135) (-2505.440) (-2497.892) -- 0:02:58

      Average standard deviation of split frequencies: 0.001742

      270500 -- (-2506.588) [-2499.905] (-2497.528) (-2497.918) * (-2498.128) [-2498.273] (-2502.206) (-2493.996) -- 0:02:57
      271000 -- (-2501.135) (-2495.882) [-2494.681] (-2501.037) * (-2501.863) [-2499.163] (-2494.962) (-2495.230) -- 0:02:57
      271500 -- (-2498.615) (-2494.136) [-2498.069] (-2496.489) * (-2501.496) (-2497.352) [-2490.877] (-2503.021) -- 0:02:57
      272000 -- (-2503.319) (-2502.526) [-2497.923] (-2494.924) * (-2500.232) (-2498.786) [-2492.874] (-2506.076) -- 0:02:56
      272500 -- (-2502.982) (-2505.699) (-2496.709) [-2496.744] * (-2498.413) (-2505.662) [-2499.232] (-2504.514) -- 0:02:56
      273000 -- (-2496.252) [-2496.939] (-2494.249) (-2499.824) * [-2496.828] (-2496.734) (-2500.511) (-2505.172) -- 0:02:58
      273500 -- (-2494.203) (-2504.160) (-2505.908) [-2500.434] * (-2500.252) (-2493.979) (-2494.174) [-2496.379] -- 0:02:57
      274000 -- (-2505.588) [-2493.378] (-2503.975) (-2495.390) * (-2496.590) [-2502.270] (-2490.432) (-2490.150) -- 0:02:57
      274500 -- (-2497.450) (-2498.703) (-2507.808) [-2495.246] * (-2501.698) [-2501.178] (-2498.334) (-2501.878) -- 0:02:57
      275000 -- (-2498.559) [-2502.469] (-2501.869) (-2496.388) * (-2501.597) [-2494.178] (-2498.190) (-2499.168) -- 0:02:56

      Average standard deviation of split frequencies: 0.002277

      275500 -- (-2504.963) (-2502.983) (-2507.352) [-2493.448] * (-2500.422) (-2496.499) [-2499.886] (-2500.002) -- 0:02:56
      276000 -- (-2500.426) [-2500.624] (-2495.109) (-2498.565) * (-2504.178) (-2499.277) (-2502.860) [-2500.252] -- 0:02:55
      276500 -- (-2498.631) (-2510.240) [-2499.447] (-2505.520) * (-2504.103) [-2499.442] (-2500.327) (-2502.294) -- 0:02:55
      277000 -- (-2491.657) (-2499.974) (-2495.640) [-2500.336] * (-2506.001) [-2500.284] (-2502.505) (-2496.652) -- 0:02:57
      277500 -- [-2501.941] (-2508.497) (-2495.840) (-2498.592) * (-2496.180) (-2497.432) [-2500.455] (-2503.289) -- 0:02:57
      278000 -- (-2494.644) (-2501.335) [-2500.718] (-2498.748) * [-2493.753] (-2506.002) (-2498.213) (-2497.169) -- 0:02:56
      278500 -- [-2498.379] (-2499.803) (-2497.725) (-2499.639) * (-2497.358) (-2504.579) [-2495.973] (-2499.088) -- 0:02:56
      279000 -- [-2491.393] (-2498.287) (-2504.133) (-2496.160) * (-2500.722) (-2507.250) [-2496.208] (-2499.580) -- 0:02:55
      279500 -- [-2491.490] (-2497.882) (-2495.265) (-2498.263) * (-2498.357) [-2495.189] (-2495.657) (-2497.475) -- 0:02:55
      280000 -- (-2497.797) [-2495.865] (-2493.392) (-2495.955) * [-2501.458] (-2502.786) (-2496.665) (-2505.210) -- 0:02:54

      Average standard deviation of split frequencies: 0.002799

      280500 -- (-2498.258) [-2497.896] (-2495.896) (-2499.197) * (-2492.959) (-2496.296) [-2494.453] (-2501.019) -- 0:02:54
      281000 -- (-2497.627) (-2503.157) [-2495.482] (-2504.335) * (-2501.310) [-2492.751] (-2493.561) (-2497.860) -- 0:02:53
      281500 -- (-2502.886) (-2497.522) [-2497.154] (-2498.364) * (-2500.731) (-2501.625) (-2499.265) [-2497.705] -- 0:02:56
      282000 -- (-2497.300) (-2499.438) (-2497.139) [-2493.631] * (-2501.191) [-2497.502] (-2496.628) (-2499.702) -- 0:02:55
      282500 -- (-2495.962) [-2498.444] (-2496.810) (-2502.310) * (-2499.553) [-2496.480] (-2496.862) (-2499.632) -- 0:02:55
      283000 -- (-2496.971) (-2501.034) (-2498.346) [-2496.878] * (-2504.793) (-2511.424) (-2495.190) [-2497.087] -- 0:02:54
      283500 -- [-2496.414] (-2493.466) (-2508.961) (-2497.470) * [-2497.438] (-2493.430) (-2504.310) (-2495.849) -- 0:02:54
      284000 -- (-2502.229) (-2501.048) [-2493.692] (-2498.905) * (-2499.414) (-2505.869) [-2495.607] (-2500.942) -- 0:02:53
      284500 -- (-2503.258) [-2499.741] (-2500.937) (-2494.683) * (-2505.122) [-2498.439] (-2509.682) (-2504.015) -- 0:02:53
      285000 -- [-2504.431] (-2497.541) (-2497.872) (-2501.498) * (-2497.276) (-2502.166) [-2497.907] (-2499.274) -- 0:02:53

      Average standard deviation of split frequencies: 0.002747

      285500 -- (-2510.668) (-2494.801) [-2499.016] (-2496.748) * (-2499.187) (-2500.122) [-2499.179] (-2496.494) -- 0:02:52
      286000 -- (-2506.724) [-2504.449] (-2499.050) (-2500.107) * (-2495.736) (-2502.774) [-2498.062] (-2498.741) -- 0:02:54
      286500 -- [-2500.063] (-2497.253) (-2496.184) (-2498.285) * [-2502.739] (-2501.480) (-2493.268) (-2498.037) -- 0:02:54
      287000 -- (-2496.860) [-2494.428] (-2499.550) (-2497.986) * (-2499.759) [-2501.891] (-2500.859) (-2505.444) -- 0:02:53
      287500 -- [-2500.134] (-2499.884) (-2500.279) (-2499.355) * [-2499.598] (-2503.446) (-2506.067) (-2500.044) -- 0:02:53
      288000 -- [-2505.254] (-2501.960) (-2497.069) (-2505.940) * (-2501.639) (-2497.543) [-2494.510] (-2494.728) -- 0:02:53
      288500 -- (-2497.619) (-2500.124) [-2497.362] (-2503.403) * (-2499.767) (-2496.331) (-2498.101) [-2497.498] -- 0:02:52
      289000 -- (-2500.626) [-2496.699] (-2502.635) (-2507.791) * (-2505.188) (-2499.465) (-2501.630) [-2492.890] -- 0:02:52
      289500 -- (-2499.025) (-2495.810) (-2498.673) [-2496.590] * (-2506.489) (-2495.692) (-2500.368) [-2494.021] -- 0:02:51
      290000 -- (-2499.835) [-2493.327] (-2504.963) (-2496.001) * (-2493.778) (-2497.773) [-2501.044] (-2497.721) -- 0:02:51

      Average standard deviation of split frequencies: 0.003244

      290500 -- (-2492.939) [-2496.003] (-2493.463) (-2495.330) * (-2501.802) (-2500.151) [-2498.098] (-2492.638) -- 0:02:53
      291000 -- (-2492.030) [-2495.121] (-2509.606) (-2500.871) * (-2493.492) [-2496.303] (-2499.966) (-2496.706) -- 0:02:52
      291500 -- [-2498.527] (-2500.930) (-2496.468) (-2496.399) * (-2496.154) (-2500.275) (-2493.744) [-2493.916] -- 0:02:52
      292000 -- [-2498.516] (-2505.108) (-2501.160) (-2501.277) * [-2494.619] (-2497.737) (-2499.725) (-2497.381) -- 0:02:52
      292500 -- (-2503.708) (-2506.621) (-2499.753) [-2493.081] * (-2498.302) (-2493.069) (-2498.860) [-2502.164] -- 0:02:51
      293000 -- [-2495.357] (-2496.081) (-2499.753) (-2493.572) * [-2492.281] (-2498.210) (-2502.206) (-2501.011) -- 0:02:51
      293500 -- (-2499.534) [-2496.736] (-2501.399) (-2504.638) * (-2497.588) (-2498.473) (-2496.204) [-2495.092] -- 0:02:50
      294000 -- (-2498.565) (-2497.857) (-2500.047) [-2498.267] * (-2504.223) [-2493.715] (-2497.983) (-2498.201) -- 0:02:50
      294500 -- (-2501.460) (-2498.979) (-2497.541) [-2494.586] * (-2493.976) (-2499.381) (-2496.884) [-2494.603] -- 0:02:50
      295000 -- (-2503.375) (-2497.090) (-2496.977) [-2498.590] * (-2502.464) [-2496.407] (-2503.749) (-2496.392) -- 0:02:52

      Average standard deviation of split frequencies: 0.003185

      295500 -- (-2498.824) (-2494.007) [-2492.390] (-2501.232) * (-2508.447) (-2499.046) (-2503.864) [-2496.134] -- 0:02:51
      296000 -- [-2499.698] (-2494.268) (-2490.474) (-2501.178) * (-2501.445) [-2497.971] (-2507.522) (-2507.876) -- 0:02:51
      296500 -- [-2495.919] (-2499.878) (-2499.236) (-2498.923) * (-2502.514) [-2494.378] (-2508.799) (-2498.129) -- 0:02:50
      297000 -- (-2497.804) (-2497.108) (-2503.552) [-2498.451] * [-2495.827] (-2500.954) (-2503.754) (-2494.959) -- 0:02:50
      297500 -- [-2495.545] (-2499.987) (-2498.016) (-2499.142) * (-2499.644) (-2496.974) (-2501.318) [-2495.483] -- 0:02:50
      298000 -- (-2497.404) [-2496.720] (-2499.739) (-2496.295) * (-2497.974) (-2494.788) (-2502.889) [-2495.973] -- 0:02:49
      298500 -- [-2493.504] (-2494.735) (-2497.996) (-2500.350) * (-2496.998) (-2498.593) (-2501.685) [-2497.969] -- 0:02:49
      299000 -- [-2495.388] (-2504.566) (-2493.274) (-2497.895) * (-2502.405) [-2498.837] (-2508.115) (-2505.737) -- 0:02:51
      299500 -- (-2498.700) (-2500.266) [-2494.295] (-2496.161) * (-2504.792) [-2502.126] (-2503.362) (-2500.328) -- 0:02:50
      300000 -- (-2496.807) (-2500.253) [-2498.361] (-2500.588) * (-2500.438) (-2495.126) (-2496.870) [-2499.207] -- 0:02:50

      Average standard deviation of split frequencies: 0.003136

      300500 -- (-2499.976) (-2503.777) [-2507.252] (-2496.166) * [-2494.958] (-2499.334) (-2497.498) (-2500.913) -- 0:02:49
      301000 -- (-2495.606) (-2500.881) [-2496.983] (-2502.932) * (-2498.340) (-2497.698) (-2493.416) [-2498.667] -- 0:02:49
      301500 -- [-2503.178] (-2496.276) (-2491.826) (-2508.324) * (-2497.163) (-2501.322) (-2498.585) [-2495.380] -- 0:02:49
      302000 -- (-2501.325) (-2496.576) (-2493.660) [-2491.274] * (-2499.150) (-2499.164) (-2497.033) [-2502.600] -- 0:02:48
      302500 -- (-2497.521) (-2500.106) (-2496.442) [-2492.547] * (-2501.367) (-2497.735) (-2499.470) [-2498.735] -- 0:02:48
      303000 -- (-2502.239) [-2500.755] (-2493.290) (-2502.492) * (-2501.503) (-2500.090) [-2499.658] (-2497.831) -- 0:02:47
      303500 -- (-2497.996) (-2494.830) [-2496.936] (-2503.488) * [-2494.564] (-2497.724) (-2498.708) (-2498.952) -- 0:02:49
      304000 -- (-2501.555) [-2498.774] (-2499.980) (-2508.017) * (-2500.899) (-2503.635) (-2496.148) [-2496.515] -- 0:02:49
      304500 -- [-2502.543] (-2512.299) (-2503.651) (-2495.710) * (-2501.944) (-2500.667) (-2495.162) [-2494.390] -- 0:02:49
      305000 -- (-2506.053) (-2506.385) (-2495.556) [-2497.680] * (-2500.402) [-2504.024] (-2499.540) (-2502.163) -- 0:02:48

      Average standard deviation of split frequencies: 0.003081

      305500 -- (-2496.010) (-2498.935) [-2496.603] (-2500.568) * [-2492.777] (-2496.845) (-2498.949) (-2493.557) -- 0:02:48
      306000 -- (-2500.651) (-2510.385) (-2497.695) [-2497.793] * (-2497.959) [-2496.928] (-2503.487) (-2497.307) -- 0:02:47
      306500 -- (-2497.195) (-2496.132) (-2495.204) [-2497.612] * (-2497.082) (-2502.251) (-2494.287) [-2496.466] -- 0:02:47
      307000 -- (-2498.982) (-2501.514) (-2495.528) [-2495.642] * (-2502.241) (-2497.375) [-2495.758] (-2496.106) -- 0:02:47
      307500 -- (-2498.549) [-2496.183] (-2495.646) (-2496.797) * (-2496.275) [-2501.815] (-2504.672) (-2502.482) -- 0:02:46
      308000 -- [-2500.827] (-2505.121) (-2498.538) (-2499.820) * [-2501.869] (-2499.164) (-2497.023) (-2501.165) -- 0:02:46
      308500 -- (-2498.810) (-2498.371) (-2497.796) [-2499.693] * (-2502.650) [-2499.911] (-2497.548) (-2500.249) -- 0:02:48
      309000 -- [-2498.009] (-2498.755) (-2494.584) (-2495.719) * (-2500.344) (-2503.852) [-2500.203] (-2498.639) -- 0:02:47
      309500 -- (-2497.058) (-2496.623) [-2492.012] (-2502.087) * [-2495.126] (-2511.232) (-2499.625) (-2500.544) -- 0:02:47
      310000 -- (-2500.033) (-2504.298) (-2503.901) [-2503.591] * [-2495.504] (-2499.346) (-2498.400) (-2500.539) -- 0:02:46

      Average standard deviation of split frequencies: 0.002529

      310500 -- (-2495.705) [-2510.193] (-2500.902) (-2496.660) * (-2500.060) (-2500.774) [-2498.614] (-2494.219) -- 0:02:46
      311000 -- [-2495.579] (-2505.132) (-2508.747) (-2494.507) * [-2497.124] (-2501.943) (-2506.103) (-2503.477) -- 0:02:46
      311500 -- [-2495.300] (-2504.450) (-2503.430) (-2500.491) * (-2498.024) (-2493.741) (-2497.859) [-2499.800] -- 0:02:45
      312000 -- (-2496.659) (-2502.225) (-2514.069) [-2497.722] * (-2504.055) (-2494.564) [-2495.617] (-2500.235) -- 0:02:45
      312500 -- (-2498.991) (-2499.276) [-2497.365] (-2504.804) * (-2505.885) [-2496.846] (-2501.379) (-2500.125) -- 0:02:47
      313000 -- (-2499.925) (-2498.954) [-2497.658] (-2500.733) * (-2509.181) (-2504.514) [-2498.371] (-2504.406) -- 0:02:46
      313500 -- (-2498.590) (-2497.367) (-2495.883) [-2498.831] * (-2504.307) (-2499.036) (-2499.976) [-2499.278] -- 0:02:46
      314000 -- (-2501.469) (-2500.430) [-2496.180] (-2496.998) * (-2500.017) [-2495.555] (-2504.441) (-2497.229) -- 0:02:46
      314500 -- (-2499.868) (-2494.590) (-2497.967) [-2498.703] * (-2501.703) (-2499.445) [-2504.495] (-2500.476) -- 0:02:45
      315000 -- (-2503.431) [-2495.293] (-2503.677) (-2499.783) * [-2496.634] (-2498.379) (-2501.102) (-2496.652) -- 0:02:45

      Average standard deviation of split frequencies: 0.001989

      315500 -- (-2509.325) (-2500.476) (-2498.681) [-2497.286] * (-2496.494) (-2499.580) [-2500.462] (-2498.065) -- 0:02:44
      316000 -- (-2496.346) [-2496.993] (-2501.833) (-2492.052) * [-2500.003] (-2504.905) (-2494.171) (-2499.001) -- 0:02:44
      316500 -- [-2501.333] (-2500.875) (-2506.743) (-2500.245) * (-2495.844) (-2498.812) (-2500.640) [-2497.123] -- 0:02:44
      317000 -- [-2497.862] (-2499.965) (-2500.258) (-2495.206) * [-2502.542] (-2495.739) (-2500.580) (-2502.637) -- 0:02:45
      317500 -- (-2501.230) (-2498.031) (-2495.817) [-2496.772] * (-2496.871) [-2495.539] (-2500.056) (-2502.578) -- 0:02:45
      318000 -- [-2500.457] (-2499.601) (-2502.054) (-2499.500) * [-2509.075] (-2498.875)