--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:52:15 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/3res/ML0131/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1574.50 -1578.73 2 -1574.48 -1577.57 -------------------------------------- TOTAL -1574.49 -1578.31 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.891196 0.092298 0.306645 1.445593 0.861556 1242.51 1363.71 1.000 r(A<->C){all} 0.154712 0.016761 0.000037 0.412553 0.121136 187.08 217.27 1.001 r(A<->G){all} 0.170565 0.019405 0.000144 0.450456 0.133912 165.49 206.08 1.003 r(A<->T){all} 0.168206 0.019955 0.000011 0.454360 0.130920 124.47 209.64 1.002 r(C<->G){all} 0.162247 0.018398 0.000004 0.444997 0.127371 191.20 250.93 1.000 r(C<->T){all} 0.171286 0.019738 0.000067 0.453325 0.134819 229.14 251.73 1.000 r(G<->T){all} 0.172984 0.021226 0.000092 0.461301 0.134608 199.15 242.23 1.001 pi(A){all} 0.193666 0.000133 0.171620 0.216255 0.193490 1258.01 1344.81 1.000 pi(C){all} 0.265035 0.000168 0.240586 0.290471 0.264447 1325.93 1368.03 1.001 pi(G){all} 0.307512 0.000194 0.279216 0.333921 0.307182 1209.04 1272.57 1.000 pi(T){all} 0.233787 0.000152 0.209482 0.257182 0.233645 1339.25 1366.33 1.000 alpha{1,2} 0.431762 0.222051 0.000190 1.344371 0.270514 1081.08 1155.22 1.000 alpha{3} 0.470134 0.245529 0.000103 1.453562 0.316371 1020.81 1162.49 1.003 pinvar{all} 0.998687 0.000002 0.995973 0.999999 0.999156 968.69 974.97 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1532.868983 Model 2: PositiveSelection -1532.869135 Model 0: one-ratio -1532.868983 Model 7: beta -1532.869011 Model 8: beta&w>1 -1532.869113 Model 0 vs 1 0.0 Model 2 vs 1 3.0399999968722113E-4 Model 8 vs 7 2.0399999993969686E-4
>C1 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >C2 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >C3 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >C4 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >C5 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >C6 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=382 C1 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR C2 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR C3 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR C4 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR C5 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR C6 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR ************************************************** C1 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG C2 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG C3 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG C4 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG C5 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG C6 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG ************************************************** C1 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE C2 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE C3 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE C4 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE C5 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE C6 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ************************************************** C1 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR C2 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR C3 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR C4 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR C5 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR C6 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR ************************************************** C1 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR C2 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR C3 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR C4 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR C5 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR C6 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR ************************************************** C1 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD C2 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD C3 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD C4 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD C5 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD C6 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD ************************************************** C1 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL C2 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL C3 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL C4 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL C5 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL C6 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL ************************************************** C1 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL C2 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL C3 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL C4 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL C5 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL C6 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL ******************************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 382 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 382 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [11460] Library Relaxation: Multi_proc [96] Relaxation Summary: [11460]--->[11460] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.529 Mb, Max= 30.959 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR C2 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR C3 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR C4 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR C5 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR C6 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR ************************************************** C1 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG C2 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG C3 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG C4 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG C5 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG C6 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG ************************************************** C1 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE C2 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE C3 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE C4 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE C5 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE C6 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ************************************************** C1 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR C2 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR C3 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR C4 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR C5 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR C6 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR ************************************************** C1 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR C2 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR C3 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR C4 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR C5 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR C6 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR ************************************************** C1 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD C2 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD C3 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD C4 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD C5 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD C6 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD ************************************************** C1 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL C2 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL C3 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL C4 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL C5 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL C6 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL ************************************************** C1 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL C2 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL C3 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL C4 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL C5 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL C6 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL ******************************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT C2 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT C3 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT C4 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT C5 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT C6 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT ************************************************** C1 TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG C2 TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG C3 TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG C4 TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG C5 TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG C6 TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG ************************************************** C1 GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT C2 GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT C3 GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT C4 GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT C5 GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT C6 GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT ************************************************** C1 TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA C2 TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA C3 TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA C4 TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA C5 TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA C6 TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA ************************************************** C1 GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG C2 GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG C3 GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG C4 GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG C5 GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG C6 GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG ************************************************** C1 GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT C2 GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT C3 GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT C4 GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT C5 GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT C6 GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT ************************************************** C1 CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT C2 CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT C3 CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT C4 CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT C5 CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT C6 CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT ************************************************** C1 TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA C2 TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA C3 TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA C4 TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA C5 TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA C6 TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ************************************************** C1 ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA C2 ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA C3 ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA C4 ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA C5 ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA C6 ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA ************************************************** C1 GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC C2 GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC C3 GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC C4 GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC C5 GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC C6 GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC ************************************************** C1 GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC C2 GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC C3 GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC C4 GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC C5 GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC C6 GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC ************************************************** C1 CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG C2 CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG C3 CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG C4 CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG C5 CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG C6 CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ************************************************** C1 ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT C2 ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT C3 ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT C4 ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT C5 ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT C6 ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT ************************************************** C1 GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG C2 GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG C3 GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG C4 GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG C5 GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG C6 GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG ************************************************** C1 CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC C2 CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC C3 CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC C4 CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC C5 CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC C6 CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC ************************************************** C1 GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC C2 GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC C3 GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC C4 GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC C5 GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC C6 GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC ************************************************** C1 TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC C2 TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC C3 TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC C4 TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC C5 TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC C6 TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC ************************************************** C1 GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC C2 GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC C3 GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC C4 GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC C5 GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC C6 GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ************************************************** C1 ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA C2 ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA C3 ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA C4 ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA C5 ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA C6 ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA ************************************************** C1 AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG C2 AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG C3 AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG C4 AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG C5 AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG C6 AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG ************************************************** C1 AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA C2 AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA C3 AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA C4 AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA C5 AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA C6 AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA ************************************************** C1 GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC C2 GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC C3 GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC C4 GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC C5 GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC C6 GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC ************************************************** C1 GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG C2 GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG C3 GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG C4 GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG C5 GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG C6 GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG ********************************************** >C1 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG >C2 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG >C3 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG >C4 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG >C5 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG >C6 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG >C1 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >C2 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >C3 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >C4 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >C5 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >C6 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1146 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579791056 Setting output file names to "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1174683748 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0282519931 Seed = 435663702 Swapseed = 1579791056 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2564.802545 -- -24.965149 Chain 2 -- -2564.802545 -- -24.965149 Chain 3 -- -2564.802935 -- -24.965149 Chain 4 -- -2564.802787 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2564.802935 -- -24.965149 Chain 2 -- -2564.802935 -- -24.965149 Chain 3 -- -2564.802545 -- -24.965149 Chain 4 -- -2564.802545 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2564.803] (-2564.803) (-2564.803) (-2564.803) * [-2564.803] (-2564.803) (-2564.803) (-2564.803) 500 -- (-1587.404) (-1581.922) [-1586.606] (-1587.759) * [-1590.923] (-1594.049) (-1594.302) (-1586.833) -- 0:00:00 1000 -- (-1592.859) (-1588.065) (-1584.673) [-1588.005] * (-1584.306) (-1590.088) [-1590.160] (-1583.209) -- 0:00:00 1500 -- [-1583.204] (-1584.151) (-1586.846) (-1587.934) * (-1585.074) (-1580.418) (-1580.256) [-1579.470] -- 0:00:00 2000 -- (-1583.314) [-1582.278] (-1581.804) (-1585.934) * (-1585.695) [-1583.884] (-1582.585) (-1580.456) -- 0:00:00 2500 -- (-1579.348) (-1585.464) [-1585.138] (-1586.850) * (-1581.091) (-1581.618) (-1581.610) [-1578.937] -- 0:00:00 3000 -- (-1584.645) (-1581.346) [-1586.311] (-1583.721) * (-1592.897) (-1584.190) (-1584.580) [-1585.114] -- 0:00:00 3500 -- [-1586.493] (-1589.178) (-1585.438) (-1586.087) * (-1580.523) (-1580.048) (-1583.915) [-1593.145] -- 0:00:00 4000 -- (-1588.327) (-1582.254) [-1579.696] (-1586.264) * [-1581.820] (-1586.150) (-1583.946) (-1586.846) -- 0:00:00 4500 -- (-1583.316) (-1578.247) [-1580.558] (-1588.381) * (-1583.664) [-1578.891] (-1588.064) (-1585.159) -- 0:00:00 5000 -- (-1579.629) (-1595.096) [-1580.812] (-1600.843) * [-1578.595] (-1584.964) (-1582.283) (-1586.172) -- 0:00:00 Average standard deviation of split frequencies: 0.088815 5500 -- (-1581.212) (-1585.002) (-1595.786) [-1584.509] * (-1594.375) (-1577.490) [-1579.069] (-1587.609) -- 0:00:00 6000 -- (-1586.777) (-1596.550) [-1583.800] (-1588.159) * (-1578.785) (-1590.828) [-1579.238] (-1582.548) -- 0:00:00 6500 -- (-1581.462) (-1581.884) [-1587.004] (-1583.934) * (-1580.737) [-1578.620] (-1582.346) (-1580.794) -- 0:00:00 7000 -- (-1586.744) (-1582.648) [-1583.848] (-1587.067) * (-1584.672) (-1580.302) (-1583.108) [-1578.698] -- 0:00:00 7500 -- (-1580.656) (-1588.810) (-1584.206) [-1587.624] * (-1582.199) (-1582.059) (-1595.131) [-1583.908] -- 0:00:00 8000 -- (-1586.276) (-1583.016) [-1580.135] (-1587.532) * [-1582.469] (-1588.262) (-1584.946) (-1592.125) -- 0:02:04 8500 -- (-1581.884) (-1582.277) [-1588.692] (-1578.986) * (-1583.300) (-1593.212) [-1588.898] (-1583.802) -- 0:01:56 9000 -- (-1581.473) (-1586.149) [-1580.255] (-1577.321) * (-1586.375) [-1583.176] (-1586.950) (-1589.773) -- 0:01:50 9500 -- (-1585.878) [-1584.985] (-1586.394) (-1584.438) * (-1585.545) (-1580.953) [-1579.419] (-1587.367) -- 0:01:44 10000 -- (-1589.392) (-1581.597) (-1583.124) [-1586.080] * (-1580.994) [-1579.912] (-1594.961) (-1580.858) -- 0:01:39 Average standard deviation of split frequencies: 0.067344 10500 -- (-1582.683) (-1584.549) [-1585.535] (-1586.380) * [-1585.413] (-1581.921) (-1584.905) (-1591.474) -- 0:01:34 11000 -- [-1585.152] (-1585.000) (-1583.286) (-1584.817) * (-1588.560) [-1582.984] (-1589.774) (-1584.797) -- 0:01:29 11500 -- [-1587.035] (-1580.690) (-1592.192) (-1584.049) * (-1590.202) [-1582.014] (-1583.916) (-1587.037) -- 0:01:25 12000 -- (-1584.644) [-1581.922] (-1588.206) (-1590.994) * (-1591.845) (-1591.480) [-1578.944] (-1582.760) -- 0:01:22 12500 -- (-1581.079) [-1584.311] (-1592.081) (-1580.950) * [-1579.717] (-1586.387) (-1585.087) (-1585.134) -- 0:01:19 13000 -- [-1579.983] (-1581.764) (-1582.398) (-1582.275) * (-1594.178) (-1581.429) (-1581.542) [-1587.561] -- 0:01:15 13500 -- (-1586.232) (-1583.112) (-1599.491) [-1579.311] * (-1577.788) (-1592.121) (-1586.101) [-1580.481] -- 0:01:13 14000 -- (-1580.105) [-1579.916] (-1586.185) (-1589.060) * (-1582.317) [-1585.589] (-1581.635) (-1586.710) -- 0:01:10 14500 -- (-1581.103) (-1590.099) [-1582.207] (-1584.537) * [-1586.675] (-1582.030) (-1583.034) (-1583.649) -- 0:01:07 15000 -- (-1586.193) [-1587.159] (-1579.401) (-1580.075) * [-1581.954] (-1586.675) (-1580.870) (-1593.532) -- 0:01:05 Average standard deviation of split frequencies: 0.041248 15500 -- (-1585.842) (-1582.871) [-1574.746] (-1580.085) * [-1585.538] (-1583.801) (-1582.936) (-1582.153) -- 0:01:03 16000 -- (-1584.971) [-1581.623] (-1575.189) (-1582.603) * (-1582.463) (-1584.429) [-1582.901] (-1585.723) -- 0:01:01 16500 -- (-1581.898) (-1586.805) [-1574.746] (-1588.788) * (-1587.405) [-1580.529] (-1582.894) (-1584.722) -- 0:00:59 17000 -- (-1590.022) (-1585.383) (-1576.117) [-1584.168] * (-1583.211) (-1583.255) [-1583.550] (-1582.345) -- 0:00:57 17500 -- [-1584.584] (-1583.632) (-1574.373) (-1593.591) * [-1587.793] (-1583.565) (-1580.952) (-1588.581) -- 0:00:56 18000 -- (-1592.372) (-1594.058) (-1572.998) [-1580.347] * [-1585.009] (-1590.234) (-1580.729) (-1591.655) -- 0:00:54 18500 -- (-1588.418) (-1590.029) (-1573.563) [-1587.197] * (-1589.920) (-1586.185) (-1581.279) [-1581.089] -- 0:00:53 19000 -- (-1588.944) [-1588.467] (-1574.555) (-1586.521) * [-1586.422] (-1588.406) (-1590.346) (-1586.815) -- 0:00:51 19500 -- (-1584.843) (-1588.514) [-1575.196] (-1580.709) * [-1583.415] (-1580.500) (-1587.323) (-1580.691) -- 0:00:50 20000 -- (-1581.565) [-1583.563] (-1575.111) (-1583.867) * [-1583.034] (-1588.881) (-1588.192) (-1587.190) -- 0:00:49 Average standard deviation of split frequencies: 0.030013 20500 -- [-1585.762] (-1582.671) (-1573.847) (-1589.332) * (-1580.967) (-1587.592) [-1582.056] (-1583.479) -- 0:00:47 21000 -- [-1579.940] (-1577.867) (-1574.257) (-1590.437) * (-1579.474) (-1585.264) (-1586.651) [-1581.700] -- 0:00:46 21500 -- [-1585.252] (-1586.231) (-1575.743) (-1585.475) * (-1592.493) (-1588.868) [-1582.290] (-1595.037) -- 0:01:31 22000 -- (-1587.826) (-1585.008) [-1574.333] (-1587.280) * [-1582.333] (-1581.170) (-1579.967) (-1577.969) -- 0:01:28 22500 -- [-1583.083] (-1581.165) (-1575.588) (-1581.690) * (-1579.335) (-1580.770) (-1578.338) [-1575.566] -- 0:01:26 23000 -- [-1585.858] (-1579.293) (-1574.281) (-1586.548) * (-1587.182) (-1588.295) [-1579.091] (-1574.391) -- 0:01:24 23500 -- (-1581.861) [-1586.758] (-1573.597) (-1586.089) * (-1583.852) (-1588.320) (-1582.760) [-1574.055] -- 0:01:23 24000 -- (-1581.648) (-1584.417) (-1573.939) [-1585.731] * (-1587.998) (-1584.700) (-1583.419) [-1574.149] -- 0:01:21 24500 -- (-1580.968) (-1586.589) (-1573.939) [-1582.889] * (-1587.761) [-1583.339] (-1581.633) (-1573.686) -- 0:01:19 25000 -- (-1589.866) [-1590.482] (-1575.765) (-1592.458) * (-1585.281) (-1583.761) [-1580.414] (-1573.698) -- 0:01:18 Average standard deviation of split frequencies: 0.028021 25500 -- (-1581.509) (-1581.264) (-1576.248) [-1586.064] * (-1585.122) [-1580.753] (-1583.547) (-1574.668) -- 0:01:16 26000 -- (-1581.623) (-1588.620) (-1573.774) [-1582.450] * (-1583.797) (-1586.623) [-1586.175] (-1576.695) -- 0:01:14 26500 -- (-1583.646) (-1581.180) [-1573.064] (-1581.742) * [-1581.843] (-1586.416) (-1584.447) (-1573.351) -- 0:01:13 27000 -- (-1585.125) (-1581.366) [-1574.108] (-1579.338) * (-1586.847) (-1588.918) (-1589.167) [-1575.633] -- 0:01:12 27500 -- (-1580.721) [-1580.056] (-1574.760) (-1579.801) * (-1583.949) (-1590.892) (-1591.470) [-1573.822] -- 0:01:10 28000 -- [-1581.022] (-1582.167) (-1574.717) (-1586.911) * (-1580.790) [-1583.250] (-1581.974) (-1573.574) -- 0:01:09 28500 -- (-1581.012) [-1579.063] (-1574.427) (-1581.365) * [-1583.602] (-1586.848) (-1588.810) (-1575.513) -- 0:01:08 29000 -- [-1587.900] (-1587.435) (-1574.542) (-1586.682) * (-1582.826) [-1588.085] (-1583.614) (-1577.011) -- 0:01:06 29500 -- (-1588.359) [-1578.376] (-1575.366) (-1585.622) * (-1585.028) (-1588.120) (-1587.000) [-1576.418] -- 0:01:05 30000 -- (-1587.347) [-1583.648] (-1573.506) (-1587.877) * (-1582.911) (-1582.652) [-1583.750] (-1577.227) -- 0:01:04 Average standard deviation of split frequencies: 0.034085 30500 -- [-1581.642] (-1581.376) (-1573.464) (-1585.743) * (-1589.745) [-1584.208] (-1584.634) (-1574.662) -- 0:01:03 31000 -- (-1591.136) [-1579.829] (-1576.713) (-1581.204) * (-1586.055) [-1583.294] (-1583.724) (-1575.650) -- 0:01:02 31500 -- (-1598.179) (-1579.664) (-1576.572) [-1581.498] * [-1586.194] (-1590.540) (-1586.024) (-1574.125) -- 0:01:01 32000 -- (-1591.378) (-1591.225) (-1575.449) [-1579.171] * (-1583.127) [-1585.940] (-1582.995) (-1573.723) -- 0:01:00 32500 -- (-1580.772) [-1586.844] (-1573.574) (-1584.015) * [-1577.582] (-1581.935) (-1585.174) (-1574.760) -- 0:00:59 33000 -- (-1585.128) (-1585.358) [-1573.798] (-1601.224) * (-1587.054) (-1582.870) (-1579.615) [-1578.248] -- 0:00:58 33500 -- (-1579.257) (-1579.593) [-1573.132] (-1586.298) * (-1592.405) (-1580.961) [-1585.263] (-1576.698) -- 0:00:57 34000 -- (-1584.549) (-1588.917) (-1574.731) [-1582.969] * [-1589.295] (-1583.919) (-1582.449) (-1581.167) -- 0:00:56 34500 -- (-1579.240) (-1584.170) (-1575.041) [-1579.014] * (-1589.455) [-1580.611] (-1584.192) (-1579.660) -- 0:00:55 35000 -- (-1584.048) (-1582.112) [-1575.483] (-1592.850) * (-1584.490) [-1579.295] (-1589.291) (-1579.060) -- 0:00:55 Average standard deviation of split frequencies: 0.035298 35500 -- (-1581.730) [-1578.583] (-1575.277) (-1586.450) * (-1588.532) (-1585.195) [-1582.011] (-1576.208) -- 0:00:54 36000 -- [-1587.682] (-1585.830) (-1575.150) (-1583.453) * (-1585.512) (-1582.352) [-1595.326] (-1573.627) -- 0:00:53 36500 -- [-1583.640] (-1582.948) (-1574.441) (-1586.336) * (-1584.774) (-1585.877) [-1580.909] (-1573.239) -- 0:01:19 37000 -- (-1585.722) (-1584.230) (-1577.436) [-1587.315] * (-1589.870) (-1590.539) [-1582.526] (-1573.269) -- 0:01:18 37500 -- (-1582.678) (-1585.503) (-1573.786) [-1578.799] * (-1580.092) [-1579.575] (-1583.896) (-1575.804) -- 0:01:17 38000 -- (-1586.450) (-1589.865) [-1573.793] (-1581.103) * (-1577.504) (-1579.548) [-1584.652] (-1576.848) -- 0:01:15 38500 -- (-1580.970) (-1582.709) (-1575.790) [-1584.532] * (-1575.310) (-1578.201) (-1579.645) [-1576.180] -- 0:01:14 39000 -- (-1584.634) (-1590.533) (-1575.790) [-1578.130] * [-1573.952] (-1575.227) (-1588.392) (-1576.178) -- 0:01:13 39500 -- (-1582.085) (-1581.761) (-1577.711) [-1573.890] * (-1574.804) (-1577.297) [-1580.737] (-1575.456) -- 0:01:12 40000 -- [-1589.390] (-1583.609) (-1577.881) (-1576.717) * [-1574.731] (-1577.046) (-1582.573) (-1577.057) -- 0:01:12 Average standard deviation of split frequencies: 0.036139 40500 -- [-1586.166] (-1578.449) (-1578.409) (-1576.440) * [-1575.432] (-1577.761) (-1589.084) (-1574.582) -- 0:01:11 41000 -- [-1580.015] (-1581.599) (-1573.308) (-1576.874) * (-1574.065) (-1574.245) [-1580.284] (-1575.755) -- 0:01:10 41500 -- (-1584.721) (-1590.218) (-1574.207) [-1576.863] * (-1577.860) (-1573.448) (-1583.564) [-1575.035] -- 0:01:09 42000 -- (-1584.133) [-1583.495] (-1573.214) (-1580.296) * (-1574.863) (-1573.115) [-1584.077] (-1574.304) -- 0:01:08 42500 -- (-1580.090) [-1584.073] (-1575.588) (-1581.681) * (-1575.280) [-1575.235] (-1584.041) (-1574.448) -- 0:01:07 43000 -- (-1582.621) (-1587.596) [-1579.513] (-1578.122) * (-1575.253) [-1575.233] (-1586.612) (-1576.691) -- 0:01:06 43500 -- (-1585.557) (-1585.715) [-1575.017] (-1582.922) * (-1574.314) (-1573.275) [-1581.616] (-1576.147) -- 0:01:05 44000 -- (-1587.279) [-1584.970] (-1575.695) (-1576.446) * (-1576.401) (-1575.099) [-1587.943] (-1574.716) -- 0:01:05 44500 -- [-1583.865] (-1582.782) (-1575.283) (-1576.202) * (-1575.395) [-1575.813] (-1584.618) (-1575.604) -- 0:01:04 45000 -- (-1582.783) [-1586.018] (-1573.333) (-1576.659) * (-1574.144) [-1575.252] (-1580.189) (-1575.936) -- 0:01:03 Average standard deviation of split frequencies: 0.029665 45500 -- (-1583.447) [-1586.681] (-1573.335) (-1574.625) * (-1576.190) (-1575.380) [-1579.705] (-1579.799) -- 0:01:02 46000 -- [-1586.436] (-1587.423) (-1575.191) (-1574.176) * (-1577.252) (-1577.538) (-1592.030) [-1579.676] -- 0:01:02 46500 -- (-1577.883) [-1580.255] (-1577.594) (-1574.830) * (-1575.853) (-1579.939) [-1584.033] (-1577.486) -- 0:01:01 47000 -- (-1581.130) (-1579.864) [-1576.283] (-1577.221) * (-1577.896) (-1574.314) (-1582.537) [-1573.089] -- 0:01:00 47500 -- (-1590.150) [-1582.073] (-1578.758) (-1573.374) * (-1578.754) (-1574.277) (-1585.082) [-1576.493] -- 0:01:00 48000 -- [-1579.750] (-1586.794) (-1576.037) (-1575.560) * (-1581.176) (-1578.433) (-1586.335) [-1574.212] -- 0:00:59 48500 -- [-1584.078] (-1591.483) (-1576.120) (-1576.090) * (-1577.168) (-1578.706) (-1580.715) [-1574.924] -- 0:00:58 49000 -- (-1586.469) [-1586.977] (-1574.409) (-1579.091) * [-1577.105] (-1577.532) (-1580.777) (-1576.980) -- 0:00:58 49500 -- (-1583.729) [-1587.330] (-1574.060) (-1578.582) * (-1576.724) (-1574.999) [-1588.764] (-1574.506) -- 0:00:57 50000 -- (-1587.300) (-1585.740) [-1577.146] (-1577.414) * (-1575.389) (-1581.800) [-1581.989] (-1574.936) -- 0:00:57 Average standard deviation of split frequencies: 0.029554 50500 -- (-1580.420) (-1585.069) [-1578.732] (-1576.118) * (-1574.469) (-1579.848) [-1586.086] (-1573.222) -- 0:00:56 51000 -- (-1590.632) (-1596.264) (-1573.826) [-1579.839] * (-1574.573) [-1576.856] (-1583.159) (-1578.578) -- 0:00:55 51500 -- (-1585.200) [-1583.038] (-1574.742) (-1580.604) * (-1576.100) [-1576.070] (-1594.193) (-1577.570) -- 0:00:55 52000 -- (-1584.230) (-1583.159) [-1574.036] (-1576.565) * (-1577.512) (-1576.526) [-1583.405] (-1578.239) -- 0:01:12 52500 -- (-1579.032) (-1583.518) (-1576.632) [-1575.385] * [-1580.666] (-1574.189) (-1581.383) (-1577.286) -- 0:01:12 53000 -- [-1584.246] (-1583.716) (-1573.480) (-1576.681) * (-1577.283) (-1574.189) [-1578.362] (-1577.095) -- 0:01:11 53500 -- (-1586.290) [-1578.532] (-1573.329) (-1576.267) * [-1579.247] (-1573.836) (-1589.651) (-1577.022) -- 0:01:10 54000 -- [-1589.289] (-1582.684) (-1579.093) (-1580.509) * (-1578.191) [-1574.237] (-1584.674) (-1575.723) -- 0:01:10 54500 -- (-1591.429) (-1581.999) [-1574.766] (-1574.937) * (-1579.047) [-1574.243] (-1584.301) (-1573.483) -- 0:01:09 55000 -- (-1586.652) (-1581.010) (-1574.243) [-1574.531] * (-1578.232) [-1574.421] (-1587.416) (-1578.591) -- 0:01:08 Average standard deviation of split frequencies: 0.027730 55500 -- (-1582.360) [-1581.473] (-1573.308) (-1574.259) * (-1575.573) (-1573.834) [-1581.717] (-1574.695) -- 0:01:08 56000 -- (-1585.548) (-1595.276) (-1573.427) [-1573.486] * (-1576.318) (-1573.954) (-1579.865) [-1575.728] -- 0:01:07 56500 -- [-1584.492] (-1582.619) (-1577.583) (-1576.200) * [-1574.922] (-1577.014) (-1575.313) (-1576.170) -- 0:01:06 57000 -- (-1587.507) [-1581.408] (-1575.935) (-1573.394) * (-1574.818) (-1577.886) (-1574.109) [-1576.223] -- 0:01:06 57500 -- (-1579.792) [-1582.275] (-1577.646) (-1574.500) * (-1574.818) (-1573.821) [-1576.161] (-1577.659) -- 0:01:05 58000 -- (-1590.332) [-1576.982] (-1578.256) (-1573.883) * [-1574.358] (-1573.502) (-1574.710) (-1575.152) -- 0:01:04 58500 -- (-1585.671) (-1581.399) (-1575.885) [-1573.739] * (-1573.305) (-1574.059) [-1575.704] (-1573.886) -- 0:01:04 59000 -- (-1581.385) [-1579.955] (-1576.033) (-1573.577) * [-1574.023] (-1578.768) (-1577.323) (-1573.662) -- 0:01:03 59500 -- (-1586.307) (-1586.645) [-1577.648] (-1574.476) * (-1573.708) [-1576.187] (-1577.846) (-1575.174) -- 0:01:03 60000 -- (-1579.184) [-1582.005] (-1577.315) (-1573.773) * (-1574.744) [-1575.392] (-1575.757) (-1575.126) -- 0:01:02 Average standard deviation of split frequencies: 0.033367 60500 -- (-1584.898) (-1586.212) [-1576.477] (-1573.238) * (-1575.454) [-1577.616] (-1575.608) (-1575.465) -- 0:01:02 61000 -- (-1586.045) (-1582.197) [-1575.181] (-1575.146) * [-1574.026] (-1579.170) (-1573.888) (-1575.200) -- 0:01:01 61500 -- (-1584.065) [-1578.606] (-1576.414) (-1573.749) * (-1574.044) (-1575.282) [-1577.392] (-1576.484) -- 0:01:01 62000 -- (-1587.419) [-1581.368] (-1574.771) (-1575.276) * [-1574.189] (-1577.015) (-1578.419) (-1575.839) -- 0:01:00 62500 -- (-1587.166) [-1585.155] (-1573.696) (-1574.050) * (-1576.439) [-1574.688] (-1575.117) (-1576.966) -- 0:01:00 63000 -- (-1590.219) (-1586.832) [-1575.588] (-1575.612) * (-1573.802) (-1575.598) [-1574.207] (-1576.977) -- 0:00:59 63500 -- (-1587.488) [-1583.021] (-1578.325) (-1576.556) * (-1573.234) [-1576.853] (-1577.849) (-1575.996) -- 0:00:58 64000 -- (-1584.273) (-1587.939) [-1575.641] (-1574.156) * (-1574.235) (-1576.309) (-1577.672) [-1575.015] -- 0:00:58 64500 -- (-1584.777) (-1588.194) [-1575.502] (-1574.162) * [-1573.902] (-1574.614) (-1578.187) (-1575.131) -- 0:00:58 65000 -- (-1580.105) [-1593.290] (-1574.367) (-1574.938) * (-1575.044) (-1574.397) [-1581.622] (-1575.160) -- 0:00:57 Average standard deviation of split frequencies: 0.027818 65500 -- (-1578.600) (-1584.313) [-1577.171] (-1574.042) * (-1575.770) (-1574.642) (-1578.124) [-1574.924] -- 0:00:57 66000 -- (-1588.209) (-1582.208) (-1574.241) [-1573.987] * (-1577.417) (-1573.830) (-1575.822) [-1576.509] -- 0:00:56 66500 -- (-1585.176) (-1590.571) [-1574.860] (-1575.104) * (-1575.862) (-1573.860) [-1574.084] (-1578.474) -- 0:00:56 67000 -- (-1582.930) [-1583.172] (-1574.862) (-1574.855) * (-1574.242) (-1575.479) [-1574.782] (-1575.209) -- 0:01:09 67500 -- (-1584.335) (-1582.573) [-1579.057] (-1573.997) * (-1573.617) [-1573.788] (-1574.783) (-1577.845) -- 0:01:09 68000 -- (-1585.408) (-1597.750) (-1578.423) [-1574.166] * [-1574.540] (-1575.525) (-1574.517) (-1575.923) -- 0:01:08 68500 -- (-1603.056) (-1593.101) (-1574.779) [-1575.206] * (-1573.754) (-1573.991) [-1573.792] (-1576.110) -- 0:01:07 69000 -- (-1578.757) (-1586.067) (-1573.599) [-1576.369] * (-1574.660) (-1573.740) [-1576.129] (-1578.341) -- 0:01:07 69500 -- (-1574.312) (-1582.481) [-1574.982] (-1574.247) * (-1575.168) [-1573.264] (-1574.190) (-1582.871) -- 0:01:06 70000 -- (-1575.489) (-1585.847) (-1573.507) [-1576.830] * [-1575.898] (-1573.108) (-1576.336) (-1575.559) -- 0:01:06 Average standard deviation of split frequencies: 0.023348 70500 -- (-1574.320) (-1588.122) (-1573.309) [-1576.302] * (-1576.232) (-1575.211) (-1575.415) [-1576.204] -- 0:01:05 71000 -- (-1573.783) (-1587.677) [-1574.060] (-1574.408) * (-1574.653) (-1573.974) (-1575.000) [-1575.091] -- 0:01:05 71500 -- (-1573.779) [-1581.989] (-1573.691) (-1575.042) * [-1575.409] (-1574.490) (-1573.564) (-1574.408) -- 0:01:04 72000 -- (-1575.986) (-1585.256) (-1573.976) [-1575.108] * (-1575.266) [-1573.111] (-1575.475) (-1577.557) -- 0:01:04 72500 -- [-1574.412] (-1584.121) (-1573.806) (-1575.147) * (-1574.782) [-1574.677] (-1573.562) (-1573.108) -- 0:01:03 73000 -- (-1573.930) [-1584.495] (-1573.836) (-1576.332) * (-1575.518) [-1573.590] (-1575.843) (-1574.824) -- 0:01:03 73500 -- (-1574.759) (-1583.800) (-1577.729) [-1574.676] * [-1577.740] (-1574.305) (-1576.307) (-1574.028) -- 0:01:03 74000 -- (-1573.317) [-1586.113] (-1576.375) (-1575.409) * (-1577.133) [-1574.417] (-1576.127) (-1578.293) -- 0:01:02 74500 -- [-1575.262] (-1585.746) (-1575.489) (-1577.154) * (-1574.405) (-1574.272) [-1575.317] (-1576.072) -- 0:01:02 75000 -- [-1575.661] (-1586.212) (-1574.347) (-1575.905) * (-1574.425) (-1576.908) [-1574.141] (-1581.928) -- 0:01:01 Average standard deviation of split frequencies: 0.022950 75500 -- [-1578.225] (-1586.762) (-1578.289) (-1573.448) * [-1573.886] (-1576.427) (-1574.120) (-1575.623) -- 0:01:01 76000 -- (-1573.623) [-1581.543] (-1579.818) (-1576.137) * (-1575.941) (-1576.114) [-1575.454] (-1576.681) -- 0:01:00 76500 -- (-1573.436) (-1584.033) [-1573.684] (-1577.324) * (-1578.215) [-1573.978] (-1575.069) (-1575.796) -- 0:01:00 77000 -- (-1578.005) (-1580.327) (-1573.597) [-1576.052] * (-1575.204) (-1577.576) [-1576.778] (-1575.163) -- 0:00:59 77500 -- (-1577.961) (-1583.460) (-1576.695) [-1576.043] * (-1574.762) [-1577.133] (-1576.117) (-1575.349) -- 0:00:59 78000 -- (-1577.139) [-1582.841] (-1574.752) (-1576.851) * (-1576.252) (-1575.448) [-1575.618] (-1574.388) -- 0:00:59 78500 -- (-1574.968) (-1590.477) [-1576.734] (-1575.327) * (-1578.267) (-1575.836) (-1576.967) [-1574.109] -- 0:00:58 79000 -- [-1574.616] (-1592.907) (-1577.173) (-1575.095) * [-1575.965] (-1577.862) (-1579.415) (-1573.728) -- 0:00:58 79500 -- (-1576.163) (-1585.523) [-1575.940] (-1575.299) * [-1574.481] (-1578.237) (-1579.910) (-1573.697) -- 0:00:57 80000 -- [-1576.161] (-1582.395) (-1577.988) (-1579.371) * [-1574.748] (-1578.108) (-1579.731) (-1573.140) -- 0:00:57 Average standard deviation of split frequencies: 0.020778 80500 -- (-1575.014) (-1587.723) (-1578.938) [-1575.534] * (-1574.217) [-1573.849] (-1579.539) (-1575.748) -- 0:00:57 81000 -- (-1576.160) (-1580.772) [-1575.121] (-1575.612) * (-1576.374) [-1574.874] (-1581.501) (-1575.452) -- 0:00:56 81500 -- [-1578.063] (-1593.048) (-1577.265) (-1574.499) * (-1575.218) [-1574.063] (-1578.800) (-1573.994) -- 0:00:56 82000 -- (-1573.433) (-1594.900) [-1578.655] (-1576.462) * (-1574.692) (-1576.198) [-1575.115] (-1575.106) -- 0:00:55 82500 -- (-1575.693) (-1593.888) (-1575.194) [-1576.696] * (-1576.434) (-1573.379) (-1575.018) [-1573.691] -- 0:00:55 83000 -- [-1573.418] (-1576.088) (-1573.854) (-1577.310) * [-1575.681] (-1578.788) (-1573.585) (-1577.112) -- 0:01:06 83500 -- [-1574.627] (-1575.886) (-1573.819) (-1576.994) * [-1574.429] (-1587.508) (-1574.934) (-1573.956) -- 0:01:05 84000 -- (-1576.097) (-1576.061) [-1574.707] (-1576.250) * (-1578.885) (-1577.565) [-1576.525] (-1574.971) -- 0:01:05 84500 -- (-1575.983) [-1576.951] (-1573.674) (-1577.063) * (-1574.705) (-1574.974) [-1577.393] (-1576.344) -- 0:01:05 85000 -- [-1574.693] (-1577.918) (-1577.881) (-1578.552) * (-1575.252) [-1573.484] (-1576.993) (-1576.442) -- 0:01:04 Average standard deviation of split frequencies: 0.020496 85500 -- (-1574.619) (-1578.627) [-1575.792] (-1579.888) * (-1573.331) (-1574.137) (-1575.726) [-1581.093] -- 0:01:04 86000 -- (-1576.112) [-1576.336] (-1579.248) (-1574.241) * (-1574.648) (-1573.896) (-1578.281) [-1575.817] -- 0:01:03 86500 -- [-1578.800] (-1573.317) (-1578.241) (-1574.194) * (-1573.886) [-1573.755] (-1576.951) (-1574.929) -- 0:01:03 87000 -- [-1573.546] (-1573.907) (-1574.107) (-1574.584) * (-1574.060) (-1577.102) [-1574.807] (-1573.056) -- 0:01:02 87500 -- [-1573.455] (-1575.306) (-1574.691) (-1576.286) * (-1573.674) (-1575.780) (-1575.255) [-1574.372] -- 0:01:02 88000 -- (-1573.180) [-1574.519] (-1578.134) (-1575.387) * (-1573.389) (-1575.982) [-1577.067] (-1576.022) -- 0:01:02 88500 -- (-1574.129) [-1574.733] (-1578.787) (-1575.630) * (-1573.263) (-1577.956) [-1575.831] (-1573.388) -- 0:01:01 89000 -- [-1576.506] (-1574.300) (-1581.017) (-1578.548) * (-1573.900) (-1576.279) [-1578.408] (-1573.388) -- 0:01:01 89500 -- (-1573.860) [-1575.330] (-1578.081) (-1577.082) * (-1574.162) (-1577.480) (-1576.204) [-1573.375] -- 0:01:01 90000 -- (-1577.815) [-1575.289] (-1581.315) (-1575.618) * (-1574.839) (-1574.306) (-1576.590) [-1573.767] -- 0:01:00 Average standard deviation of split frequencies: 0.024177 90500 -- (-1578.358) (-1574.874) [-1576.654] (-1576.593) * (-1576.640) [-1574.297] (-1573.890) (-1573.733) -- 0:01:00 91000 -- (-1579.025) (-1575.298) [-1576.230] (-1576.241) * (-1573.804) (-1573.596) [-1574.611] (-1575.345) -- 0:00:59 91500 -- (-1573.570) (-1576.613) (-1579.146) [-1578.151] * (-1573.914) [-1573.787] (-1573.861) (-1575.658) -- 0:00:59 92000 -- (-1574.144) [-1576.062] (-1575.289) (-1578.152) * [-1574.892] (-1573.768) (-1573.858) (-1575.778) -- 0:00:59 92500 -- (-1577.330) [-1577.065] (-1573.858) (-1576.151) * [-1575.091] (-1575.854) (-1577.564) (-1574.200) -- 0:00:58 93000 -- [-1576.116] (-1575.443) (-1575.459) (-1573.989) * (-1575.114) (-1576.447) (-1576.920) [-1576.010] -- 0:00:58 93500 -- (-1574.937) (-1576.329) (-1574.971) [-1573.631] * [-1574.204] (-1576.291) (-1576.590) (-1573.327) -- 0:00:58 94000 -- [-1574.653] (-1575.485) (-1574.386) (-1573.632) * [-1575.117] (-1575.622) (-1572.998) (-1573.966) -- 0:00:57 94500 -- (-1578.118) (-1575.158) [-1576.966] (-1575.278) * (-1574.611) (-1574.050) (-1574.160) [-1573.838] -- 0:00:57 95000 -- (-1580.184) (-1574.978) (-1575.745) [-1573.929] * (-1576.805) (-1574.092) (-1573.737) [-1573.156] -- 0:00:57 Average standard deviation of split frequencies: 0.023851 95500 -- (-1574.418) [-1574.035] (-1578.323) (-1573.370) * (-1577.074) [-1573.524] (-1576.428) (-1576.936) -- 0:00:56 96000 -- (-1573.484) (-1575.590) (-1575.871) [-1573.401] * (-1583.816) (-1576.479) (-1574.500) [-1576.065] -- 0:00:56 96500 -- (-1573.689) (-1575.878) (-1574.745) [-1575.757] * (-1582.554) (-1579.419) (-1574.643) [-1575.633] -- 0:00:56 97000 -- (-1572.867) (-1575.852) (-1575.568) [-1574.512] * (-1573.846) (-1576.895) [-1574.901] (-1575.073) -- 0:00:55 97500 -- (-1572.789) (-1576.488) (-1573.240) [-1573.423] * [-1574.706] (-1577.699) (-1573.203) (-1576.140) -- 0:00:55 98000 -- (-1573.010) [-1573.256] (-1573.244) (-1579.279) * [-1574.771] (-1575.985) (-1576.442) (-1576.050) -- 0:00:55 98500 -- (-1574.757) [-1574.434] (-1575.817) (-1575.078) * (-1574.480) (-1578.237) (-1574.121) [-1576.485] -- 0:00:54 99000 -- (-1578.095) (-1577.326) (-1576.417) [-1573.856] * (-1574.401) (-1575.121) [-1575.261] (-1577.236) -- 0:01:03 99500 -- (-1579.695) (-1577.652) [-1574.614] (-1576.276) * [-1573.758] (-1577.737) (-1581.427) (-1574.310) -- 0:01:03 100000 -- [-1581.769] (-1577.893) (-1575.064) (-1573.541) * (-1573.859) (-1577.285) (-1575.137) [-1574.489] -- 0:01:02 Average standard deviation of split frequencies: 0.022894 100500 -- (-1576.986) [-1576.018] (-1574.163) (-1577.092) * [-1573.933] (-1576.899) (-1575.946) (-1576.317) -- 0:01:02 101000 -- (-1574.962) (-1575.601) [-1574.642] (-1573.750) * [-1577.578] (-1577.891) (-1575.278) (-1575.189) -- 0:01:02 101500 -- (-1574.828) [-1575.012] (-1574.548) (-1574.569) * [-1576.305] (-1573.999) (-1575.590) (-1576.065) -- 0:01:01 102000 -- [-1576.251] (-1574.512) (-1574.674) (-1575.489) * (-1576.265) (-1574.009) [-1574.100] (-1576.436) -- 0:01:01 102500 -- (-1576.390) (-1574.077) (-1575.987) [-1574.197] * [-1575.038] (-1574.954) (-1573.706) (-1575.163) -- 0:01:01 103000 -- (-1575.853) (-1574.077) (-1584.083) [-1575.167] * (-1575.726) (-1575.497) [-1575.198] (-1577.064) -- 0:01:00 103500 -- (-1574.760) (-1575.507) (-1582.637) [-1574.090] * (-1575.770) (-1575.378) [-1575.197] (-1575.826) -- 0:01:00 104000 -- (-1574.969) [-1573.856] (-1577.072) (-1576.565) * [-1573.522] (-1573.985) (-1574.854) (-1574.523) -- 0:01:00 104500 -- (-1577.104) [-1577.097] (-1578.349) (-1580.323) * [-1573.704] (-1574.107) (-1575.107) (-1574.730) -- 0:00:59 105000 -- (-1576.180) (-1579.054) (-1574.347) [-1574.092] * (-1573.964) (-1578.986) [-1574.384] (-1573.787) -- 0:00:59 Average standard deviation of split frequencies: 0.022024 105500 -- (-1575.205) (-1579.962) [-1574.236] (-1576.534) * (-1573.964) [-1574.031] (-1575.308) (-1577.703) -- 0:00:59 106000 -- [-1574.904] (-1577.420) (-1574.331) (-1578.346) * (-1573.279) [-1573.869] (-1577.621) (-1574.705) -- 0:00:59 106500 -- (-1574.717) (-1575.406) [-1579.119] (-1578.718) * (-1573.523) [-1573.766] (-1575.634) (-1575.976) -- 0:00:58 107000 -- (-1574.531) (-1577.362) [-1574.185] (-1580.696) * (-1577.221) (-1574.282) (-1577.323) [-1574.725] -- 0:00:58 107500 -- (-1573.597) [-1577.423] (-1576.207) (-1579.572) * (-1575.201) (-1576.505) [-1576.828] (-1573.642) -- 0:00:58 108000 -- [-1573.502] (-1574.241) (-1574.213) (-1578.584) * (-1575.158) (-1576.570) [-1575.231] (-1575.104) -- 0:00:57 108500 -- (-1573.720) (-1575.893) (-1574.081) [-1573.060] * (-1576.276) [-1573.368] (-1575.015) (-1574.527) -- 0:00:57 109000 -- (-1575.329) (-1574.846) (-1574.958) [-1575.464] * (-1575.052) (-1573.228) (-1574.828) [-1573.417] -- 0:00:57 109500 -- (-1575.271) (-1577.659) (-1575.524) [-1575.172] * (-1573.242) (-1574.681) [-1573.768] (-1573.464) -- 0:00:56 110000 -- (-1576.227) [-1576.837] (-1576.159) (-1575.293) * (-1577.837) (-1574.786) [-1573.226] (-1573.480) -- 0:00:56 Average standard deviation of split frequencies: 0.021879 110500 -- (-1577.895) [-1574.622] (-1575.104) (-1575.083) * (-1574.257) (-1574.221) [-1573.790] (-1573.480) -- 0:00:56 111000 -- (-1576.525) (-1578.982) [-1575.218] (-1574.440) * (-1574.367) (-1577.361) (-1574.305) [-1574.621] -- 0:00:56 111500 -- (-1576.608) (-1575.477) [-1573.556] (-1577.473) * (-1575.914) (-1579.646) [-1575.143] (-1573.777) -- 0:00:55 112000 -- [-1575.257] (-1574.184) (-1573.704) (-1576.692) * (-1577.474) (-1574.517) (-1574.484) [-1575.377] -- 0:00:55 112500 -- [-1574.285] (-1574.877) (-1573.601) (-1578.622) * [-1573.817] (-1575.057) (-1573.531) (-1575.102) -- 0:00:55 113000 -- [-1577.445] (-1574.572) (-1576.838) (-1582.787) * (-1576.096) (-1574.996) [-1573.503] (-1575.806) -- 0:00:54 113500 -- [-1575.252] (-1573.499) (-1577.393) (-1576.519) * (-1577.746) [-1576.484] (-1573.725) (-1578.318) -- 0:00:54 114000 -- (-1574.701) [-1574.544] (-1576.537) (-1576.647) * (-1575.926) [-1575.921] (-1574.490) (-1578.154) -- 0:00:54 114500 -- [-1576.696] (-1575.183) (-1577.233) (-1576.585) * (-1577.930) (-1575.077) [-1573.777] (-1575.682) -- 0:01:01 115000 -- [-1573.474] (-1576.584) (-1578.307) (-1575.718) * (-1574.590) (-1576.765) [-1573.616] (-1574.775) -- 0:01:01 Average standard deviation of split frequencies: 0.019710 115500 -- (-1574.378) (-1575.882) [-1578.529] (-1574.918) * (-1575.262) (-1577.586) (-1573.587) [-1574.586] -- 0:01:01 116000 -- (-1573.337) [-1575.988] (-1578.538) (-1575.752) * (-1576.846) (-1575.346) [-1575.668] (-1574.471) -- 0:01:00 116500 -- (-1577.395) (-1577.202) [-1577.479] (-1576.383) * [-1573.924] (-1574.270) (-1573.009) (-1574.150) -- 0:01:00 117000 -- (-1575.976) [-1577.000] (-1577.888) (-1572.827) * [-1573.887] (-1579.411) (-1573.308) (-1573.924) -- 0:01:00 117500 -- (-1574.820) [-1578.117] (-1575.848) (-1572.834) * (-1573.792) [-1580.718] (-1574.764) (-1579.422) -- 0:01:00 118000 -- (-1574.022) (-1576.991) (-1575.402) [-1572.834] * [-1573.877] (-1574.196) (-1581.707) (-1579.074) -- 0:00:59 118500 -- (-1574.723) (-1575.254) (-1576.025) [-1572.859] * (-1573.869) [-1574.739] (-1580.484) (-1576.275) -- 0:00:59 119000 -- (-1574.280) (-1574.792) (-1573.575) [-1574.377] * (-1574.797) (-1574.762) (-1579.928) [-1576.359] -- 0:00:59 119500 -- (-1574.396) (-1574.010) [-1573.731] (-1576.381) * (-1574.307) [-1575.337] (-1578.524) (-1574.703) -- 0:00:58 120000 -- (-1576.026) [-1574.010] (-1573.479) (-1574.675) * [-1575.373] (-1574.392) (-1576.474) (-1578.394) -- 0:00:58 Average standard deviation of split frequencies: 0.018094 120500 -- (-1576.017) (-1575.812) [-1573.726] (-1573.884) * (-1573.291) (-1574.843) [-1573.870] (-1580.603) -- 0:00:58 121000 -- (-1575.402) (-1575.918) [-1573.514] (-1573.598) * (-1574.661) [-1573.812] (-1579.134) (-1575.990) -- 0:00:58 121500 -- (-1575.479) (-1575.809) (-1573.851) [-1573.986] * (-1577.701) [-1573.959] (-1577.790) (-1574.321) -- 0:00:57 122000 -- (-1577.164) (-1575.080) (-1575.215) [-1576.031] * (-1575.822) [-1573.926] (-1575.460) (-1574.878) -- 0:00:57 122500 -- (-1579.159) (-1574.758) (-1575.215) [-1575.928] * (-1573.899) (-1574.802) [-1575.390] (-1573.870) -- 0:00:57 123000 -- [-1577.126] (-1574.233) (-1575.439) (-1576.547) * (-1574.761) [-1574.801] (-1575.503) (-1573.663) -- 0:00:57 123500 -- [-1574.763] (-1574.454) (-1574.406) (-1578.350) * [-1573.400] (-1576.022) (-1574.686) (-1573.783) -- 0:00:56 124000 -- [-1574.910] (-1576.738) (-1580.575) (-1573.977) * (-1574.508) (-1578.553) (-1574.422) [-1574.356] -- 0:00:56 124500 -- (-1574.056) (-1575.783) (-1577.886) [-1574.159] * [-1575.229] (-1576.119) (-1578.831) (-1578.575) -- 0:00:56 125000 -- [-1574.600] (-1579.532) (-1577.639) (-1575.210) * [-1574.218] (-1574.027) (-1577.121) (-1575.006) -- 0:00:56 Average standard deviation of split frequencies: 0.018519 125500 -- (-1578.560) (-1574.773) (-1579.072) [-1576.250] * [-1575.136] (-1574.087) (-1575.945) (-1576.429) -- 0:00:55 126000 -- (-1578.916) (-1574.501) [-1577.709] (-1576.382) * [-1573.793] (-1574.015) (-1575.488) (-1576.617) -- 0:00:55 126500 -- (-1579.985) [-1576.035] (-1577.402) (-1575.959) * (-1573.747) (-1573.112) (-1577.306) [-1575.954] -- 0:00:55 127000 -- (-1579.997) (-1575.674) (-1575.437) [-1574.125] * (-1573.378) (-1573.363) [-1576.427] (-1576.112) -- 0:00:54 127500 -- (-1577.569) (-1574.063) (-1575.778) [-1576.000] * [-1573.521] (-1575.739) (-1577.095) (-1574.908) -- 0:00:54 128000 -- (-1574.949) (-1573.288) (-1575.894) [-1577.112] * (-1573.317) (-1576.786) (-1574.071) [-1573.318] -- 0:00:54 128500 -- (-1573.563) (-1573.040) (-1574.713) [-1580.126] * (-1573.184) (-1579.202) (-1574.052) [-1573.448] -- 0:00:54 129000 -- (-1573.460) (-1574.726) [-1575.989] (-1581.205) * (-1573.436) (-1579.930) [-1574.299] (-1573.409) -- 0:00:54 129500 -- (-1574.600) [-1574.757] (-1576.425) (-1574.236) * (-1573.458) [-1574.884] (-1574.235) (-1573.755) -- 0:00:53 130000 -- [-1573.535] (-1575.025) (-1578.890) (-1574.305) * (-1574.312) (-1572.928) [-1574.575] (-1573.755) -- 0:01:00 Average standard deviation of split frequencies: 0.021105 130500 -- (-1576.823) [-1576.125] (-1582.485) (-1575.040) * [-1574.214] (-1574.496) (-1574.561) (-1575.303) -- 0:00:59 131000 -- (-1576.775) (-1577.666) [-1579.368] (-1576.925) * (-1576.923) (-1573.619) [-1575.333] (-1574.344) -- 0:00:59 131500 -- (-1577.260) (-1574.627) (-1577.537) [-1577.087] * [-1576.179] (-1575.953) (-1574.711) (-1574.195) -- 0:00:59 132000 -- [-1574.063] (-1574.129) (-1574.867) (-1577.940) * (-1573.370) (-1574.251) [-1574.211] (-1574.403) -- 0:00:59 132500 -- (-1574.591) (-1573.921) [-1573.217] (-1575.599) * (-1573.006) (-1580.112) (-1574.192) [-1573.895] -- 0:00:58 133000 -- (-1572.942) [-1573.624] (-1576.509) (-1574.639) * (-1574.868) (-1580.145) (-1573.840) [-1577.555] -- 0:00:58 133500 -- (-1572.945) (-1573.971) [-1578.125] (-1576.927) * (-1574.218) (-1574.477) (-1573.472) [-1573.878] -- 0:00:58 134000 -- [-1572.991] (-1576.088) (-1575.383) (-1574.103) * (-1574.299) [-1574.613] (-1577.350) (-1574.616) -- 0:00:58 134500 -- [-1575.377] (-1574.696) (-1575.385) (-1574.365) * (-1577.534) [-1574.832] (-1577.426) (-1574.180) -- 0:00:57 135000 -- [-1573.974] (-1574.826) (-1575.897) (-1583.966) * (-1574.373) (-1576.074) (-1573.719) [-1574.209] -- 0:00:57 Average standard deviation of split frequencies: 0.021144 135500 -- (-1573.629) (-1579.334) [-1576.518] (-1580.891) * (-1573.954) (-1574.003) [-1573.443] (-1577.648) -- 0:00:57 136000 -- (-1573.742) (-1578.723) [-1575.185] (-1578.715) * (-1574.095) [-1574.531] (-1573.518) (-1573.436) -- 0:00:57 136500 -- [-1572.858] (-1576.490) (-1575.452) (-1577.873) * (-1573.693) [-1573.990] (-1574.974) (-1574.356) -- 0:00:56 137000 -- (-1574.981) (-1574.812) [-1575.090] (-1576.636) * (-1573.766) [-1573.082] (-1573.441) (-1579.962) -- 0:00:56 137500 -- (-1581.904) (-1576.387) (-1574.706) [-1573.564] * (-1575.890) (-1575.288) (-1576.159) [-1573.293] -- 0:00:56 138000 -- (-1584.856) (-1576.008) (-1574.325) [-1573.622] * [-1574.233] (-1575.192) (-1575.769) (-1573.678) -- 0:00:56 138500 -- (-1579.596) (-1577.191) (-1574.737) [-1574.338] * (-1576.093) [-1574.469] (-1575.655) (-1573.913) -- 0:00:55 139000 -- (-1573.105) (-1578.992) (-1574.492) [-1574.711] * (-1576.422) (-1573.914) [-1574.545] (-1575.512) -- 0:00:55 139500 -- (-1574.672) [-1577.702] (-1574.354) (-1574.776) * (-1575.809) (-1576.083) [-1574.787] (-1575.695) -- 0:00:55 140000 -- [-1573.580] (-1574.432) (-1579.625) (-1573.884) * (-1573.766) (-1576.083) [-1576.269] (-1575.983) -- 0:00:55 Average standard deviation of split frequencies: 0.018344 140500 -- (-1573.684) (-1575.683) (-1579.377) [-1573.868] * (-1574.396) (-1575.292) (-1575.154) [-1575.799] -- 0:00:55 141000 -- (-1573.570) (-1575.691) (-1575.405) [-1574.922] * (-1576.473) (-1573.417) (-1574.623) [-1575.005] -- 0:00:54 141500 -- [-1574.405] (-1575.858) (-1579.589) (-1577.332) * (-1576.508) (-1573.403) (-1573.533) [-1575.773] -- 0:00:54 142000 -- (-1575.715) (-1575.119) [-1577.276] (-1575.025) * (-1576.508) [-1574.222] (-1574.168) (-1575.066) -- 0:00:54 142500 -- [-1573.850] (-1574.140) (-1578.682) (-1574.758) * (-1580.346) (-1573.149) (-1573.518) [-1574.410] -- 0:00:54 143000 -- (-1581.415) (-1573.855) [-1579.559] (-1573.780) * (-1574.194) [-1573.432] (-1575.889) (-1574.611) -- 0:00:53 143500 -- (-1574.489) [-1573.879] (-1578.560) (-1574.802) * (-1575.870) (-1576.230) [-1574.199] (-1576.866) -- 0:00:53 144000 -- [-1576.770] (-1575.697) (-1581.241) (-1575.864) * (-1575.460) [-1578.752] (-1575.162) (-1574.066) -- 0:00:53 144500 -- (-1578.534) (-1576.473) [-1575.506] (-1576.703) * (-1576.691) (-1575.960) [-1573.243] (-1574.062) -- 0:00:53 145000 -- (-1578.483) (-1573.728) (-1576.506) [-1576.104] * (-1577.606) (-1574.834) [-1573.978] (-1575.749) -- 0:00:53 Average standard deviation of split frequencies: 0.018183 145500 -- (-1573.286) [-1575.966] (-1574.633) (-1576.145) * (-1580.552) [-1576.940] (-1572.945) (-1577.396) -- 0:00:52 146000 -- (-1573.676) (-1576.061) (-1576.471) [-1575.155] * (-1574.319) (-1578.779) (-1573.226) [-1575.885] -- 0:00:58 146500 -- (-1573.615) (-1573.801) [-1573.397] (-1575.145) * (-1573.024) [-1578.327] (-1573.279) (-1574.566) -- 0:00:58 147000 -- [-1574.876] (-1575.770) (-1574.303) (-1575.693) * (-1573.461) (-1577.766) (-1575.112) [-1574.283] -- 0:00:58 147500 -- (-1576.106) [-1575.418] (-1574.540) (-1575.752) * (-1573.808) (-1575.938) (-1575.392) [-1574.624] -- 0:00:57 148000 -- (-1573.934) [-1574.010] (-1573.891) (-1576.347) * (-1575.251) (-1578.273) [-1576.101] (-1575.087) -- 0:00:57 148500 -- (-1574.390) [-1575.265] (-1574.709) (-1575.635) * (-1579.411) [-1580.530] (-1574.556) (-1574.567) -- 0:00:57 149000 -- (-1573.803) (-1575.482) [-1576.931] (-1578.117) * [-1574.624] (-1576.821) (-1574.474) (-1574.105) -- 0:00:57 149500 -- (-1573.821) (-1578.748) [-1576.453] (-1574.010) * (-1575.237) [-1574.532] (-1575.508) (-1575.577) -- 0:00:56 150000 -- (-1575.951) (-1578.355) [-1576.539] (-1575.019) * (-1573.869) (-1576.416) (-1576.902) [-1576.227] -- 0:00:56 Average standard deviation of split frequencies: 0.017620 150500 -- (-1576.281) (-1576.899) (-1575.275) [-1575.326] * [-1578.045] (-1575.051) (-1574.480) (-1576.378) -- 0:00:56 151000 -- (-1576.487) [-1574.438] (-1576.356) (-1577.302) * [-1577.759] (-1575.509) (-1575.127) (-1578.868) -- 0:00:56 151500 -- [-1575.081] (-1573.613) (-1578.044) (-1576.999) * (-1581.433) (-1576.038) [-1578.991] (-1574.368) -- 0:00:56 152000 -- [-1574.022] (-1577.511) (-1578.681) (-1577.411) * (-1574.782) (-1573.626) [-1574.739] (-1574.568) -- 0:00:55 152500 -- (-1574.065) (-1575.479) (-1574.565) [-1575.301] * (-1574.998) [-1573.627] (-1575.280) (-1576.009) -- 0:00:55 153000 -- (-1577.028) (-1573.629) (-1573.491) [-1574.990] * (-1575.212) (-1574.169) (-1573.974) [-1574.767] -- 0:00:55 153500 -- (-1578.742) (-1573.684) (-1577.727) [-1574.604] * (-1573.518) (-1574.223) (-1574.616) [-1575.129] -- 0:00:55 154000 -- (-1576.345) (-1573.625) (-1575.913) [-1577.546] * [-1573.805] (-1575.003) (-1575.272) (-1574.312) -- 0:00:54 154500 -- (-1577.928) (-1573.688) (-1578.646) [-1576.356] * [-1573.972] (-1575.130) (-1574.738) (-1574.282) -- 0:00:54 155000 -- (-1578.322) (-1573.513) (-1579.210) [-1576.436] * (-1573.973) (-1577.154) [-1573.304] (-1575.219) -- 0:00:54 Average standard deviation of split frequencies: 0.017654 155500 -- (-1574.256) (-1573.560) [-1575.747] (-1575.057) * (-1574.686) (-1577.805) [-1574.905] (-1580.730) -- 0:00:54 156000 -- (-1573.885) [-1574.647] (-1576.863) (-1574.268) * [-1574.513] (-1576.590) (-1575.086) (-1578.124) -- 0:00:54 156500 -- (-1575.323) (-1577.435) [-1576.837] (-1574.966) * [-1575.062] (-1574.480) (-1574.425) (-1576.431) -- 0:00:53 157000 -- (-1575.362) [-1575.800] (-1574.619) (-1575.528) * (-1574.718) [-1575.007] (-1574.174) (-1575.799) -- 0:00:53 157500 -- (-1575.833) [-1576.882] (-1575.059) (-1576.373) * (-1575.307) (-1578.227) (-1574.044) [-1575.399] -- 0:00:53 158000 -- [-1575.771] (-1575.098) (-1577.942) (-1577.218) * [-1575.861] (-1575.009) (-1577.021) (-1579.730) -- 0:00:53 158500 -- (-1573.822) (-1575.276) [-1574.657] (-1577.482) * (-1574.527) [-1574.920] (-1574.335) (-1575.721) -- 0:00:53 159000 -- (-1575.828) [-1574.225] (-1576.122) (-1575.828) * (-1575.105) [-1573.635] (-1573.972) (-1575.604) -- 0:00:52 159500 -- (-1574.608) (-1578.081) [-1576.703] (-1582.491) * (-1574.583) (-1576.106) (-1575.508) [-1575.058] -- 0:00:52 160000 -- (-1576.433) [-1574.710] (-1576.158) (-1575.837) * (-1577.145) [-1575.430] (-1573.394) (-1573.405) -- 0:00:52 Average standard deviation of split frequencies: 0.017141 160500 -- (-1576.953) [-1576.573] (-1579.003) (-1577.304) * [-1579.374] (-1574.992) (-1575.762) (-1576.018) -- 0:00:52 161000 -- (-1578.234) (-1574.455) (-1577.837) [-1573.200] * (-1576.485) (-1577.227) (-1572.992) [-1574.118] -- 0:00:52 161500 -- (-1574.399) (-1577.471) (-1576.550) [-1580.257] * (-1580.144) [-1574.698] (-1576.013) (-1576.894) -- 0:00:57 162000 -- [-1574.872] (-1577.717) (-1577.139) (-1576.277) * [-1576.672] (-1574.886) (-1573.644) (-1576.863) -- 0:00:56 162500 -- [-1574.808] (-1577.507) (-1576.694) (-1575.653) * (-1575.973) (-1573.646) [-1575.125] (-1576.620) -- 0:00:56 163000 -- (-1574.505) (-1576.824) [-1575.087] (-1574.657) * [-1573.438] (-1575.375) (-1573.796) (-1574.270) -- 0:00:56 163500 -- (-1577.690) (-1576.827) [-1574.512] (-1574.095) * (-1575.452) (-1575.396) [-1573.443] (-1573.890) -- 0:00:56 164000 -- [-1575.844] (-1576.997) (-1577.967) (-1574.431) * (-1576.472) [-1575.615] (-1573.443) (-1574.249) -- 0:00:56 164500 -- [-1574.638] (-1576.570) (-1573.403) (-1575.861) * [-1576.320] (-1575.248) (-1575.274) (-1574.831) -- 0:00:55 165000 -- (-1575.194) (-1577.293) [-1573.113] (-1575.601) * (-1577.088) (-1576.241) (-1573.279) [-1575.738] -- 0:00:55 Average standard deviation of split frequencies: 0.015395 165500 -- [-1577.980] (-1574.542) (-1575.232) (-1575.676) * (-1576.188) [-1576.952] (-1573.811) (-1575.749) -- 0:00:55 166000 -- (-1576.205) (-1574.442) [-1573.980] (-1576.610) * [-1577.305] (-1574.912) (-1574.339) (-1574.480) -- 0:00:55 166500 -- (-1576.261) (-1576.337) (-1573.787) [-1576.350] * (-1574.926) [-1577.803] (-1574.169) (-1576.545) -- 0:00:55 167000 -- (-1574.355) (-1574.593) [-1573.585] (-1575.167) * (-1578.972) [-1573.165] (-1577.738) (-1574.651) -- 0:00:54 167500 -- (-1578.099) [-1574.335] (-1577.018) (-1574.798) * (-1573.790) [-1573.961] (-1574.634) (-1574.242) -- 0:00:54 168000 -- [-1576.116] (-1574.968) (-1575.211) (-1575.176) * (-1576.182) (-1573.105) (-1578.145) [-1574.849] -- 0:00:54 168500 -- [-1575.160] (-1575.413) (-1575.392) (-1576.180) * [-1575.636] (-1573.300) (-1579.227) (-1574.913) -- 0:00:54 169000 -- (-1574.972) [-1575.322] (-1578.906) (-1575.975) * (-1576.904) (-1576.464) [-1573.249] (-1573.854) -- 0:00:54 169500 -- (-1578.732) (-1574.280) (-1574.332) [-1575.544] * (-1573.993) (-1575.767) (-1577.729) [-1573.892] -- 0:00:53 170000 -- (-1578.758) (-1575.034) [-1573.636] (-1575.861) * [-1573.766] (-1573.775) (-1577.155) (-1574.065) -- 0:00:53 Average standard deviation of split frequencies: 0.018506 170500 -- (-1574.596) (-1573.946) [-1573.802] (-1578.027) * (-1574.020) (-1575.206) (-1576.299) [-1573.995] -- 0:00:53 171000 -- (-1578.578) (-1574.050) [-1573.860] (-1574.223) * (-1573.925) (-1573.488) [-1575.500] (-1575.978) -- 0:00:53 171500 -- (-1577.320) [-1574.113] (-1575.296) (-1573.708) * (-1576.391) (-1582.040) (-1576.402) [-1576.631] -- 0:00:53 172000 -- (-1573.381) (-1578.282) (-1574.185) [-1577.790] * (-1574.656) (-1577.576) (-1575.151) [-1573.711] -- 0:00:52 172500 -- (-1574.113) [-1573.726] (-1573.057) (-1577.070) * (-1578.208) (-1577.831) (-1575.552) [-1574.295] -- 0:00:52 173000 -- [-1574.001] (-1575.593) (-1574.341) (-1575.552) * (-1576.356) (-1580.018) (-1578.564) [-1573.995] -- 0:00:52 173500 -- (-1576.571) (-1578.693) [-1573.022] (-1575.042) * [-1575.684] (-1578.094) (-1576.079) (-1573.813) -- 0:00:52 174000 -- [-1573.589] (-1576.006) (-1574.112) (-1574.719) * (-1574.814) (-1580.958) [-1577.431] (-1573.811) -- 0:00:52 174500 -- (-1573.200) [-1576.361] (-1573.115) (-1574.831) * (-1574.671) [-1575.745] (-1577.333) (-1576.254) -- 0:00:52 175000 -- (-1573.199) [-1575.136] (-1575.919) (-1575.914) * [-1575.069] (-1573.837) (-1573.937) (-1575.259) -- 0:00:51 Average standard deviation of split frequencies: 0.019454 175500 -- (-1575.565) (-1575.214) (-1576.191) [-1573.123] * (-1576.591) (-1573.346) [-1573.842] (-1573.346) -- 0:00:51 176000 -- (-1576.553) (-1581.634) [-1574.381] (-1575.748) * (-1574.820) [-1573.059] (-1574.405) (-1573.349) -- 0:00:51 176500 -- (-1575.529) (-1576.252) (-1574.959) [-1577.887] * (-1574.865) [-1573.280] (-1573.974) (-1574.297) -- 0:00:51 177000 -- (-1575.426) (-1575.129) [-1573.757] (-1574.328) * [-1574.508] (-1574.083) (-1574.435) (-1576.367) -- 0:00:51 177500 -- (-1574.594) (-1574.964) [-1574.541] (-1575.663) * (-1573.236) (-1575.051) (-1573.934) [-1576.916] -- 0:00:55 178000 -- [-1573.303] (-1575.758) (-1573.351) (-1573.334) * [-1574.412] (-1578.836) (-1574.778) (-1575.553) -- 0:00:55 178500 -- (-1573.447) [-1575.354] (-1573.228) (-1573.627) * (-1575.857) (-1576.287) (-1575.726) [-1573.580] -- 0:00:55 179000 -- (-1574.084) (-1576.295) (-1574.965) [-1577.626] * (-1578.978) (-1579.983) [-1573.346] (-1573.580) -- 0:00:55 179500 -- [-1573.466] (-1573.946) (-1576.964) (-1575.210) * (-1575.049) [-1577.129] (-1574.148) (-1573.412) -- 0:00:54 180000 -- (-1575.219) (-1573.887) (-1575.769) [-1577.263] * (-1574.077) [-1575.518] (-1573.003) (-1577.170) -- 0:00:54 Average standard deviation of split frequencies: 0.018656 180500 -- (-1575.992) (-1573.479) (-1575.124) [-1573.539] * (-1573.032) [-1575.303] (-1575.095) (-1579.009) -- 0:00:54 181000 -- (-1575.698) (-1574.611) [-1575.030] (-1574.457) * [-1574.129] (-1576.275) (-1572.984) (-1575.366) -- 0:00:54 181500 -- [-1574.024] (-1574.332) (-1574.414) (-1576.926) * (-1577.405) (-1575.083) [-1573.400] (-1574.595) -- 0:00:54 182000 -- (-1575.447) [-1573.543] (-1574.245) (-1575.973) * (-1575.115) (-1575.453) [-1573.620] (-1580.599) -- 0:00:53 182500 -- [-1575.611] (-1573.356) (-1575.271) (-1575.094) * (-1575.673) (-1575.429) (-1575.344) [-1573.522] -- 0:00:53 183000 -- (-1574.757) [-1575.888] (-1575.359) (-1573.072) * [-1576.366] (-1573.698) (-1575.398) (-1574.559) -- 0:00:53 183500 -- [-1574.243] (-1575.814) (-1574.213) (-1573.076) * (-1578.175) (-1574.837) (-1576.453) [-1573.644] -- 0:00:53 184000 -- (-1575.536) (-1574.631) [-1574.362] (-1572.899) * (-1577.498) (-1573.877) [-1576.396] (-1574.432) -- 0:00:53 184500 -- (-1578.290) [-1574.531] (-1573.891) (-1572.899) * (-1579.299) (-1578.200) [-1574.093] (-1574.541) -- 0:00:53 185000 -- [-1574.803] (-1574.073) (-1572.977) (-1574.134) * [-1575.716] (-1576.002) (-1576.102) (-1574.232) -- 0:00:52 Average standard deviation of split frequencies: 0.017280 185500 -- [-1574.959] (-1579.392) (-1573.719) (-1574.170) * (-1575.412) (-1578.359) (-1573.486) [-1576.599] -- 0:00:52 186000 -- (-1576.814) (-1575.301) (-1574.702) [-1574.092] * (-1576.186) (-1577.776) (-1576.482) [-1577.475] -- 0:00:52 186500 -- [-1577.226] (-1579.753) (-1573.891) (-1574.739) * (-1578.978) (-1574.495) [-1577.723] (-1576.399) -- 0:00:52 187000 -- [-1574.270] (-1573.977) (-1575.948) (-1574.807) * (-1580.769) [-1574.358] (-1574.944) (-1577.108) -- 0:00:52 187500 -- (-1574.302) [-1573.656] (-1581.040) (-1573.715) * (-1579.859) [-1574.587] (-1576.638) (-1577.324) -- 0:00:52 188000 -- (-1574.171) (-1574.689) [-1578.757] (-1574.813) * [-1574.863] (-1575.854) (-1574.666) (-1576.993) -- 0:00:51 188500 -- [-1575.631] (-1574.752) (-1582.576) (-1574.654) * (-1574.239) (-1577.811) (-1576.618) [-1580.308] -- 0:00:51 189000 -- (-1573.423) [-1573.682] (-1583.924) (-1574.976) * (-1575.887) (-1577.232) (-1576.043) [-1574.511] -- 0:00:51 189500 -- [-1574.227] (-1580.143) (-1579.449) (-1575.839) * (-1574.281) (-1577.818) [-1574.704] (-1575.117) -- 0:00:51 190000 -- (-1574.560) (-1576.251) (-1574.513) [-1576.132] * [-1573.304] (-1576.467) (-1574.555) (-1578.106) -- 0:00:51 Average standard deviation of split frequencies: 0.017801 190500 -- (-1574.617) [-1576.446] (-1575.282) (-1578.489) * (-1575.439) [-1576.290] (-1576.187) (-1575.713) -- 0:00:50 191000 -- (-1575.513) (-1576.264) (-1575.023) [-1576.493] * [-1576.497] (-1574.962) (-1574.870) (-1579.214) -- 0:00:50 191500 -- (-1576.343) (-1576.241) (-1574.939) [-1576.444] * (-1576.943) [-1573.400] (-1574.388) (-1576.751) -- 0:00:50 192000 -- [-1575.891] (-1578.769) (-1575.329) (-1574.358) * (-1577.017) (-1577.151) (-1578.013) [-1575.850] -- 0:00:50 192500 -- [-1576.050] (-1581.943) (-1574.238) (-1574.691) * (-1576.829) (-1575.981) (-1575.308) [-1577.339] -- 0:00:54 193000 -- (-1578.403) (-1577.902) (-1573.904) [-1573.073] * (-1576.987) (-1576.158) (-1574.815) [-1576.690] -- 0:00:54 193500 -- (-1577.544) [-1577.116] (-1578.198) (-1575.148) * (-1577.026) (-1575.370) [-1574.634] (-1584.589) -- 0:00:54 194000 -- (-1578.507) [-1575.163] (-1576.182) (-1573.540) * [-1575.006] (-1577.122) (-1575.083) (-1577.850) -- 0:00:54 194500 -- (-1574.697) (-1574.389) (-1577.129) [-1573.206] * [-1573.432] (-1576.134) (-1575.296) (-1575.695) -- 0:00:53 195000 -- (-1574.896) [-1575.752] (-1574.355) (-1576.356) * (-1573.557) (-1575.048) [-1573.199] (-1572.933) -- 0:00:53 Average standard deviation of split frequencies: 0.018608 195500 -- (-1574.318) (-1575.737) (-1576.652) [-1575.705] * [-1572.974] (-1575.318) (-1574.029) (-1572.880) -- 0:00:53 196000 -- (-1575.004) [-1575.057] (-1577.901) (-1576.572) * (-1573.896) (-1578.162) [-1577.576] (-1575.359) -- 0:00:53 196500 -- (-1575.656) (-1574.286) (-1575.942) [-1577.454] * (-1574.274) (-1576.092) (-1573.697) [-1575.712] -- 0:00:53 197000 -- (-1573.884) (-1573.552) (-1575.797) [-1577.148] * [-1575.698] (-1574.536) (-1573.497) (-1574.722) -- 0:00:52 197500 -- [-1574.075] (-1573.382) (-1577.187) (-1578.607) * [-1575.587] (-1573.573) (-1576.767) (-1574.995) -- 0:00:52 198000 -- (-1575.313) [-1574.130] (-1575.195) (-1574.955) * [-1573.598] (-1573.469) (-1575.519) (-1576.576) -- 0:00:52 198500 -- (-1574.294) (-1574.629) [-1574.992] (-1574.419) * (-1573.465) [-1576.143] (-1576.193) (-1576.645) -- 0:00:52 199000 -- (-1573.356) (-1573.750) (-1576.161) [-1576.382] * [-1573.688] (-1575.166) (-1578.941) (-1574.440) -- 0:00:52 199500 -- (-1575.952) (-1574.658) [-1575.739] (-1573.990) * [-1573.673] (-1574.225) (-1578.112) (-1574.686) -- 0:00:52 200000 -- (-1575.084) (-1574.658) [-1575.035] (-1582.276) * (-1575.490) [-1575.037] (-1577.687) (-1578.139) -- 0:00:51 Average standard deviation of split frequencies: 0.017135 200500 -- (-1574.597) (-1573.449) [-1575.090] (-1576.649) * (-1574.693) [-1577.013] (-1575.332) (-1580.852) -- 0:00:51 201000 -- (-1574.296) (-1574.134) (-1574.331) [-1576.965] * (-1574.687) (-1574.034) (-1573.727) [-1575.856] -- 0:00:51 201500 -- (-1574.453) [-1575.106] (-1577.202) (-1576.383) * (-1577.026) (-1575.821) [-1574.700] (-1574.147) -- 0:00:51 202000 -- (-1576.751) (-1575.085) (-1573.801) [-1578.788] * (-1573.426) (-1577.245) (-1574.100) [-1573.336] -- 0:00:51 202500 -- [-1574.153] (-1575.194) (-1574.361) (-1579.810) * (-1575.393) (-1574.925) [-1573.716] (-1573.466) -- 0:00:51 203000 -- (-1573.919) [-1577.219] (-1574.187) (-1576.566) * (-1574.736) (-1575.051) (-1578.429) [-1574.132] -- 0:00:51 203500 -- (-1575.686) [-1573.958] (-1573.013) (-1576.855) * (-1575.141) (-1577.451) (-1574.199) [-1574.254] -- 0:00:50 204000 -- [-1579.288] (-1575.585) (-1575.356) (-1574.397) * (-1576.141) (-1578.219) (-1575.873) [-1580.952] -- 0:00:50 204500 -- (-1577.976) [-1576.376] (-1575.015) (-1574.364) * (-1576.104) [-1577.303] (-1573.556) (-1580.927) -- 0:00:50 205000 -- (-1583.736) (-1578.031) [-1573.347] (-1574.801) * (-1576.066) (-1583.267) [-1574.949] (-1575.810) -- 0:00:50 Average standard deviation of split frequencies: 0.016139 205500 -- (-1577.238) (-1576.720) [-1573.486] (-1573.560) * (-1573.090) (-1578.664) (-1576.254) [-1575.905] -- 0:00:50 206000 -- (-1575.461) (-1577.743) (-1573.994) [-1575.335] * (-1574.816) (-1575.669) (-1573.482) [-1575.084] -- 0:00:50 206500 -- [-1575.197] (-1576.286) (-1574.028) (-1574.340) * [-1575.031] (-1576.817) (-1574.360) (-1575.580) -- 0:00:49 207000 -- (-1576.977) [-1573.340] (-1575.338) (-1576.303) * [-1575.619] (-1576.719) (-1580.277) (-1574.485) -- 0:00:49 207500 -- [-1575.267] (-1577.060) (-1576.800) (-1575.827) * (-1575.663) [-1577.640] (-1578.628) (-1573.951) -- 0:00:49 208000 -- (-1577.384) [-1576.856] (-1577.670) (-1576.326) * [-1575.300] (-1576.045) (-1578.124) (-1575.766) -- 0:00:53 208500 -- (-1577.499) [-1579.200] (-1575.363) (-1577.235) * (-1574.614) (-1576.128) [-1576.819] (-1576.283) -- 0:00:53 209000 -- (-1576.093) (-1575.747) (-1575.954) [-1574.732] * [-1574.045] (-1574.966) (-1576.398) (-1574.688) -- 0:00:52 209500 -- (-1576.584) (-1577.041) (-1576.198) [-1574.449] * [-1573.324] (-1574.333) (-1577.485) (-1578.318) -- 0:00:52 210000 -- (-1575.775) [-1574.474] (-1577.706) (-1574.261) * (-1573.935) [-1574.957] (-1580.435) (-1576.767) -- 0:00:52 Average standard deviation of split frequencies: 0.017031 210500 -- [-1574.524] (-1574.494) (-1575.473) (-1574.463) * [-1573.718] (-1579.096) (-1577.707) (-1572.999) -- 0:00:52 211000 -- (-1574.524) (-1573.365) [-1575.593] (-1574.614) * [-1573.642] (-1574.579) (-1572.933) (-1573.093) -- 0:00:52 211500 -- (-1575.414) (-1574.029) [-1577.173] (-1574.186) * (-1573.608) [-1574.571] (-1572.892) (-1574.778) -- 0:00:52 212000 -- (-1573.493) (-1573.233) [-1578.820] (-1577.518) * (-1576.964) (-1574.770) (-1577.459) [-1574.776] -- 0:00:52 212500 -- (-1573.943) [-1573.623] (-1576.005) (-1582.430) * (-1575.713) [-1575.212] (-1575.484) (-1577.741) -- 0:00:51 213000 -- (-1573.502) [-1574.076] (-1577.189) (-1579.379) * (-1576.797) (-1577.952) (-1573.307) [-1575.338] -- 0:00:51 213500 -- (-1574.858) [-1574.981] (-1577.610) (-1576.284) * (-1575.146) (-1575.930) (-1573.410) [-1574.535] -- 0:00:51 214000 -- (-1573.836) (-1574.994) [-1574.091] (-1573.586) * (-1575.260) (-1575.384) [-1573.887] (-1575.302) -- 0:00:51 214500 -- (-1575.011) (-1576.421) [-1574.282] (-1577.113) * [-1575.271] (-1573.617) (-1574.636) (-1575.875) -- 0:00:51 215000 -- (-1576.385) [-1573.515] (-1575.363) (-1573.111) * (-1575.236) (-1573.989) (-1579.106) [-1578.051] -- 0:00:51 Average standard deviation of split frequencies: 0.015641 215500 -- (-1577.144) (-1576.904) (-1574.979) [-1573.557] * (-1574.009) (-1574.867) (-1576.920) [-1575.457] -- 0:00:50 216000 -- (-1577.895) (-1581.571) (-1575.715) [-1574.318] * (-1574.477) (-1576.407) [-1576.109] (-1574.992) -- 0:00:50 216500 -- (-1575.425) (-1580.850) (-1579.289) [-1573.538] * [-1574.623] (-1573.560) (-1574.918) (-1574.148) -- 0:00:50 217000 -- [-1575.911] (-1574.003) (-1575.111) (-1573.411) * (-1575.961) (-1576.736) [-1576.309] (-1575.197) -- 0:00:50 217500 -- (-1576.847) (-1575.126) (-1575.111) [-1574.074] * (-1581.289) (-1576.618) [-1574.796] (-1576.301) -- 0:00:50 218000 -- (-1575.379) [-1575.090] (-1573.950) (-1574.837) * [-1579.762] (-1574.640) (-1575.211) (-1575.628) -- 0:00:50 218500 -- (-1576.519) (-1575.205) [-1574.937] (-1574.265) * (-1578.461) (-1574.416) (-1574.248) [-1574.584] -- 0:00:50 219000 -- (-1577.324) [-1574.674] (-1575.414) (-1576.634) * [-1576.973] (-1578.226) (-1574.587) (-1574.834) -- 0:00:49 219500 -- (-1578.418) [-1573.185] (-1575.640) (-1578.161) * (-1576.139) (-1573.775) (-1576.076) [-1574.103] -- 0:00:49 220000 -- [-1574.127] (-1574.798) (-1575.377) (-1579.342) * (-1576.721) [-1575.319] (-1575.737) (-1576.973) -- 0:00:49 Average standard deviation of split frequencies: 0.015429 220500 -- [-1573.324] (-1574.553) (-1575.205) (-1578.828) * (-1575.266) (-1575.751) [-1575.362] (-1578.504) -- 0:00:49 221000 -- [-1574.284] (-1574.140) (-1575.853) (-1574.406) * [-1576.128] (-1574.314) (-1573.930) (-1575.449) -- 0:00:49 221500 -- [-1574.517] (-1574.240) (-1574.639) (-1575.212) * (-1575.950) (-1574.027) (-1576.806) [-1576.778] -- 0:00:49 222000 -- (-1574.741) [-1574.385] (-1574.779) (-1576.654) * (-1574.316) (-1575.014) [-1574.907] (-1575.989) -- 0:00:49 222500 -- [-1575.617] (-1573.361) (-1575.948) (-1575.216) * (-1574.628) [-1574.035] (-1578.729) (-1574.901) -- 0:00:48 223000 -- (-1575.080) (-1573.172) (-1574.871) [-1574.716] * (-1574.972) [-1574.579] (-1576.916) (-1583.934) -- 0:00:48 223500 -- (-1575.081) (-1573.919) [-1576.090] (-1574.887) * (-1578.833) (-1577.379) (-1576.048) [-1573.368] -- 0:00:52 224000 -- (-1577.565) [-1573.918] (-1575.658) (-1576.100) * (-1575.377) [-1574.369] (-1579.306) (-1574.314) -- 0:00:51 224500 -- [-1577.986] (-1577.941) (-1574.814) (-1577.169) * [-1573.601] (-1574.993) (-1578.534) (-1574.349) -- 0:00:51 225000 -- (-1575.810) [-1573.865] (-1576.088) (-1574.857) * (-1574.791) (-1575.674) [-1577.779] (-1579.552) -- 0:00:51 Average standard deviation of split frequencies: 0.015760 225500 -- (-1575.619) (-1573.089) [-1573.901] (-1577.195) * (-1575.580) (-1574.662) (-1579.453) [-1575.616] -- 0:00:51 226000 -- (-1575.504) (-1574.672) (-1573.968) [-1577.451] * (-1575.826) (-1575.566) [-1577.150] (-1575.307) -- 0:00:51 226500 -- (-1575.016) (-1574.873) (-1574.447) [-1575.364] * (-1573.798) (-1574.445) (-1578.296) [-1574.195] -- 0:00:51 227000 -- (-1578.488) (-1575.920) (-1577.124) [-1575.400] * (-1574.737) (-1573.832) (-1575.584) [-1575.837] -- 0:00:51 227500 -- [-1575.330] (-1573.869) (-1577.953) (-1574.275) * (-1583.617) (-1575.861) (-1573.854) [-1574.699] -- 0:00:50 228000 -- (-1579.500) (-1573.074) [-1576.238] (-1573.655) * (-1575.185) [-1573.025] (-1575.541) (-1575.797) -- 0:00:50 228500 -- (-1575.748) [-1573.089] (-1576.178) (-1573.794) * (-1574.041) (-1577.478) (-1574.060) [-1575.094] -- 0:00:50 229000 -- (-1576.070) [-1573.091] (-1576.503) (-1575.484) * (-1573.730) (-1577.915) [-1574.396] (-1575.176) -- 0:00:50 229500 -- (-1575.888) (-1579.588) (-1576.568) [-1577.630] * (-1574.661) (-1577.729) (-1580.239) [-1573.170] -- 0:00:50 230000 -- (-1574.020) [-1574.633] (-1575.813) (-1576.952) * (-1575.062) (-1579.371) (-1574.521) [-1575.364] -- 0:00:50 Average standard deviation of split frequencies: 0.014760 230500 -- (-1574.197) [-1573.590] (-1577.490) (-1580.444) * [-1576.323] (-1576.417) (-1576.844) (-1575.290) -- 0:00:50 231000 -- (-1574.109) (-1574.599) [-1578.046] (-1579.732) * (-1579.219) (-1577.690) (-1574.790) [-1575.949] -- 0:00:49 231500 -- (-1574.995) [-1575.479] (-1573.272) (-1578.987) * (-1577.005) (-1575.292) (-1574.127) [-1576.240] -- 0:00:49 232000 -- (-1574.641) (-1574.084) (-1574.816) [-1579.190] * (-1575.182) [-1573.986] (-1575.465) (-1576.284) -- 0:00:49 232500 -- [-1574.720] (-1573.728) (-1574.582) (-1575.116) * (-1574.745) [-1574.175] (-1576.686) (-1575.683) -- 0:00:49 233000 -- (-1574.402) [-1574.725] (-1573.631) (-1574.828) * [-1575.866] (-1574.543) (-1575.565) (-1575.105) -- 0:00:49 233500 -- [-1574.660] (-1573.834) (-1573.631) (-1574.570) * [-1578.755] (-1575.443) (-1576.432) (-1578.842) -- 0:00:49 234000 -- (-1574.815) (-1575.677) [-1573.178] (-1574.754) * (-1573.349) [-1574.842] (-1576.549) (-1576.233) -- 0:00:49 234500 -- (-1575.317) [-1574.803] (-1573.548) (-1574.337) * [-1573.439] (-1575.381) (-1576.330) (-1576.356) -- 0:00:48 235000 -- (-1573.924) (-1576.379) [-1573.548] (-1574.898) * (-1577.093) (-1575.406) [-1574.358] (-1575.539) -- 0:00:48 Average standard deviation of split frequencies: 0.014204 235500 -- [-1575.643] (-1576.990) (-1573.251) (-1575.989) * (-1575.868) [-1579.017] (-1573.951) (-1578.240) -- 0:00:48 236000 -- (-1575.554) [-1576.521] (-1573.992) (-1576.626) * [-1577.459] (-1579.141) (-1575.405) (-1576.667) -- 0:00:48 236500 -- [-1575.830] (-1577.862) (-1575.324) (-1576.221) * (-1577.519) [-1578.176] (-1573.721) (-1576.253) -- 0:00:48 237000 -- (-1575.808) (-1574.881) [-1573.523] (-1574.918) * (-1582.868) (-1575.511) [-1575.546] (-1574.799) -- 0:00:48 237500 -- [-1579.484] (-1575.486) (-1573.964) (-1574.764) * (-1578.118) [-1575.337] (-1576.297) (-1574.401) -- 0:00:48 238000 -- [-1577.080] (-1573.458) (-1573.282) (-1575.134) * (-1577.464) [-1578.781] (-1574.629) (-1575.587) -- 0:00:48 238500 -- (-1582.099) (-1573.329) (-1575.356) [-1574.195] * (-1575.036) [-1578.870] (-1577.838) (-1574.814) -- 0:00:47 239000 -- (-1575.503) [-1573.268] (-1579.986) (-1575.772) * [-1574.380] (-1578.670) (-1574.759) (-1574.663) -- 0:00:47 239500 -- (-1576.177) [-1574.685] (-1580.177) (-1574.212) * [-1576.388] (-1576.022) (-1575.316) (-1574.751) -- 0:00:50 240000 -- [-1574.841] (-1575.198) (-1575.387) (-1574.340) * (-1577.077) [-1576.726] (-1576.373) (-1576.301) -- 0:00:50 Average standard deviation of split frequencies: 0.014255 240500 -- (-1574.009) (-1573.859) [-1576.420] (-1576.139) * (-1575.202) (-1576.872) (-1578.096) [-1574.012] -- 0:00:50 241000 -- (-1572.934) (-1576.091) [-1574.238] (-1574.333) * (-1575.006) (-1577.263) [-1577.043] (-1576.122) -- 0:00:50 241500 -- (-1574.638) [-1575.005] (-1575.327) (-1576.437) * (-1574.467) (-1577.622) [-1576.093] (-1574.764) -- 0:00:50 242000 -- (-1575.968) (-1574.834) (-1577.704) [-1579.461] * [-1574.126] (-1576.015) (-1580.111) (-1577.356) -- 0:00:50 242500 -- (-1580.523) (-1575.112) (-1577.248) [-1577.046] * (-1574.662) (-1574.522) (-1578.231) [-1576.804] -- 0:00:49 243000 -- [-1575.089] (-1579.739) (-1576.348) (-1583.795) * [-1574.993] (-1574.907) (-1576.366) (-1577.992) -- 0:00:49 243500 -- (-1575.374) [-1574.786] (-1574.617) (-1582.031) * (-1575.435) (-1574.972) (-1576.317) [-1575.379] -- 0:00:49 244000 -- (-1574.924) (-1576.209) [-1573.593] (-1576.935) * (-1575.218) (-1573.678) [-1575.665] (-1575.822) -- 0:00:49 244500 -- (-1577.522) (-1577.717) [-1573.593] (-1581.256) * (-1575.070) [-1573.609] (-1575.855) (-1579.193) -- 0:00:49 245000 -- (-1574.015) (-1577.538) (-1577.128) [-1579.418] * [-1573.437] (-1574.122) (-1575.367) (-1578.085) -- 0:00:49 Average standard deviation of split frequencies: 0.013011 245500 -- (-1573.991) (-1577.311) [-1573.608] (-1576.624) * (-1574.200) [-1573.661] (-1575.738) (-1575.282) -- 0:00:49 246000 -- (-1576.302) [-1574.999] (-1576.334) (-1578.957) * [-1573.304] (-1576.208) (-1573.706) (-1574.505) -- 0:00:49 246500 -- [-1574.644] (-1575.259) (-1573.119) (-1574.422) * (-1575.906) [-1574.567] (-1573.112) (-1577.681) -- 0:00:48 247000 -- (-1574.482) (-1574.541) (-1573.756) [-1573.066] * (-1574.475) (-1574.388) [-1573.032] (-1580.818) -- 0:00:48 247500 -- (-1575.447) (-1577.320) [-1574.706] (-1577.643) * [-1573.386] (-1574.369) (-1575.010) (-1576.870) -- 0:00:48 248000 -- (-1574.100) (-1575.514) [-1573.710] (-1575.528) * (-1573.735) [-1576.786] (-1573.339) (-1573.531) -- 0:00:48 248500 -- (-1575.424) (-1581.426) [-1575.308] (-1576.578) * (-1574.753) (-1574.377) [-1573.426] (-1576.817) -- 0:00:48 249000 -- [-1574.484] (-1574.796) (-1574.318) (-1577.164) * (-1575.046) (-1574.316) (-1577.097) [-1573.746] -- 0:00:48 249500 -- (-1576.355) [-1574.555] (-1574.545) (-1576.872) * (-1574.305) [-1574.449] (-1574.487) (-1574.203) -- 0:00:48 250000 -- [-1575.368] (-1574.684) (-1578.118) (-1578.918) * (-1573.457) (-1575.706) [-1573.912] (-1573.556) -- 0:00:48 Average standard deviation of split frequencies: 0.014253 250500 -- (-1575.643) [-1573.964] (-1577.876) (-1578.761) * (-1575.255) (-1574.791) (-1574.790) [-1573.556] -- 0:00:47 251000 -- (-1574.132) [-1577.195] (-1578.009) (-1577.611) * [-1574.017] (-1575.603) (-1580.503) (-1576.046) -- 0:00:47 251500 -- (-1576.500) [-1574.162] (-1575.535) (-1577.252) * (-1573.960) (-1577.362) [-1574.102] (-1577.362) -- 0:00:47 252000 -- (-1576.567) (-1574.096) [-1577.593] (-1576.151) * (-1574.979) [-1578.395] (-1573.701) (-1578.470) -- 0:00:47 252500 -- (-1574.460) (-1573.744) (-1579.500) [-1576.024] * [-1575.425] (-1574.297) (-1573.906) (-1574.261) -- 0:00:47 253000 -- [-1573.403] (-1574.553) (-1576.859) (-1574.270) * (-1577.243) (-1574.671) (-1574.660) [-1575.844] -- 0:00:47 253500 -- (-1574.042) [-1573.633] (-1576.677) (-1573.740) * (-1573.380) [-1574.847] (-1573.152) (-1576.822) -- 0:00:47 254000 -- (-1575.211) (-1573.977) (-1578.359) [-1573.847] * (-1575.096) (-1576.141) [-1572.906] (-1573.425) -- 0:00:46 254500 -- (-1575.215) [-1573.373] (-1577.732) (-1574.555) * (-1574.476) (-1574.043) [-1576.738] (-1574.921) -- 0:00:46 255000 -- [-1574.823] (-1573.088) (-1576.144) (-1574.299) * (-1573.528) [-1576.022] (-1575.226) (-1576.491) -- 0:00:46 Average standard deviation of split frequencies: 0.014834 255500 -- (-1574.790) (-1573.086) (-1577.348) [-1574.843] * (-1573.062) (-1575.103) (-1575.547) [-1577.415] -- 0:00:49 256000 -- (-1575.295) [-1575.113] (-1574.995) (-1576.047) * [-1575.124] (-1575.298) (-1577.079) (-1576.796) -- 0:00:49 256500 -- (-1575.536) (-1573.467) [-1574.767] (-1578.388) * [-1574.831] (-1573.803) (-1576.292) (-1576.403) -- 0:00:49 257000 -- (-1574.177) (-1573.781) (-1575.819) [-1575.415] * [-1574.762] (-1574.401) (-1578.648) (-1575.923) -- 0:00:49 257500 -- (-1576.325) (-1576.262) (-1576.303) [-1573.195] * [-1573.552] (-1573.890) (-1574.518) (-1574.905) -- 0:00:49 258000 -- [-1575.951] (-1574.358) (-1573.382) (-1576.907) * (-1574.212) [-1574.172] (-1573.305) (-1575.955) -- 0:00:48 258500 -- (-1576.498) (-1579.568) [-1573.143] (-1576.434) * (-1574.836) (-1573.549) (-1574.254) [-1573.558] -- 0:00:48 259000 -- (-1573.398) (-1581.208) [-1573.972] (-1576.321) * (-1575.131) [-1576.147] (-1576.260) (-1574.206) -- 0:00:48 259500 -- (-1576.610) (-1574.588) (-1579.755) [-1573.779] * (-1577.309) (-1574.552) (-1575.590) [-1575.034] -- 0:00:48 260000 -- (-1578.008) (-1574.629) [-1575.716] (-1575.498) * (-1576.137) (-1575.442) [-1574.931] (-1576.069) -- 0:00:48 Average standard deviation of split frequencies: 0.015372 260500 -- (-1574.430) (-1574.521) (-1577.692) [-1573.174] * (-1578.245) [-1575.247] (-1573.961) (-1576.677) -- 0:00:48 261000 -- (-1576.353) (-1578.889) [-1575.079] (-1574.673) * (-1575.625) (-1577.346) [-1574.057] (-1575.430) -- 0:00:48 261500 -- [-1574.969] (-1576.004) (-1574.201) (-1574.381) * (-1577.848) (-1578.706) [-1574.704] (-1574.039) -- 0:00:48 262000 -- (-1574.685) (-1575.515) [-1574.306] (-1575.604) * (-1576.017) (-1577.703) (-1584.947) [-1574.422] -- 0:00:47 262500 -- (-1574.274) (-1577.082) (-1574.095) [-1575.571] * (-1573.858) (-1578.534) [-1577.607] (-1577.204) -- 0:00:47 263000 -- (-1574.941) (-1577.007) (-1573.614) [-1577.758] * [-1577.457] (-1578.198) (-1575.921) (-1577.502) -- 0:00:47 263500 -- (-1574.965) (-1578.817) (-1574.019) [-1577.642] * [-1577.651] (-1575.111) (-1575.298) (-1576.639) -- 0:00:47 264000 -- [-1574.033] (-1579.882) (-1573.576) (-1576.037) * (-1574.829) [-1573.856] (-1574.129) (-1578.462) -- 0:00:47 264500 -- (-1574.317) (-1578.058) [-1573.761] (-1577.061) * (-1577.568) [-1577.336] (-1576.064) (-1576.992) -- 0:00:47 265000 -- (-1577.313) (-1577.112) [-1574.676] (-1576.221) * (-1576.502) (-1577.021) (-1578.775) [-1576.881] -- 0:00:47 Average standard deviation of split frequencies: 0.014830 265500 -- (-1577.521) (-1575.233) (-1573.102) [-1576.517] * (-1578.596) (-1574.902) [-1574.883] (-1573.768) -- 0:00:47 266000 -- [-1573.308] (-1576.562) (-1573.151) (-1575.035) * (-1577.765) (-1573.869) [-1574.890] (-1573.715) -- 0:00:46 266500 -- (-1573.708) [-1574.329] (-1575.005) (-1574.204) * (-1576.888) [-1574.596] (-1575.362) (-1572.892) -- 0:00:46 267000 -- [-1574.379] (-1576.311) (-1574.581) (-1576.982) * (-1575.601) [-1574.234] (-1578.143) (-1573.087) -- 0:00:46 267500 -- (-1573.985) (-1576.316) [-1573.313] (-1574.334) * (-1576.073) [-1574.107] (-1574.782) (-1573.423) -- 0:00:46 268000 -- [-1574.511] (-1579.997) (-1577.651) (-1575.982) * [-1575.755] (-1573.077) (-1578.458) (-1576.279) -- 0:00:46 268500 -- (-1574.188) [-1577.395] (-1573.908) (-1573.463) * (-1576.479) [-1573.062] (-1574.290) (-1574.948) -- 0:00:46 269000 -- [-1574.188] (-1575.042) (-1575.934) (-1573.522) * [-1577.548] (-1574.960) (-1574.614) (-1574.845) -- 0:00:46 269500 -- (-1578.023) [-1575.718] (-1573.497) (-1575.693) * (-1575.520) [-1573.519] (-1576.543) (-1575.927) -- 0:00:46 270000 -- (-1577.564) (-1576.674) (-1573.404) [-1576.665] * (-1576.276) [-1575.898] (-1576.830) (-1574.054) -- 0:00:45 Average standard deviation of split frequencies: 0.015583 270500 -- (-1576.599) (-1573.651) (-1573.658) [-1576.935] * (-1576.290) [-1573.320] (-1578.085) (-1576.733) -- 0:00:45 271000 -- (-1579.798) (-1574.475) [-1574.692] (-1575.427) * (-1577.483) (-1573.694) [-1576.444] (-1577.088) -- 0:00:48 271500 -- [-1579.351] (-1574.474) (-1573.701) (-1575.353) * (-1574.667) (-1573.950) (-1574.537) [-1574.586] -- 0:00:48 272000 -- [-1575.162] (-1574.292) (-1573.670) (-1575.883) * (-1573.886) (-1573.743) (-1578.939) [-1574.588] -- 0:00:48 272500 -- (-1577.291) [-1573.980] (-1576.263) (-1578.822) * (-1573.886) [-1574.326] (-1575.754) (-1575.368) -- 0:00:48 273000 -- (-1576.296) (-1574.973) (-1576.421) [-1575.132] * (-1573.416) (-1574.579) (-1574.946) [-1579.631] -- 0:00:47 273500 -- (-1578.368) (-1574.954) [-1574.304] (-1573.353) * (-1574.844) (-1574.542) (-1575.003) [-1579.337] -- 0:00:47 274000 -- (-1579.209) [-1575.336] (-1574.899) (-1573.432) * (-1574.215) (-1574.745) (-1574.734) [-1578.669] -- 0:00:47 274500 -- [-1575.593] (-1574.512) (-1574.803) (-1573.395) * (-1573.568) (-1575.409) (-1574.173) [-1574.377] -- 0:00:47 275000 -- [-1577.355] (-1573.911) (-1574.607) (-1573.921) * (-1573.684) [-1575.042] (-1573.714) (-1577.888) -- 0:00:47 Average standard deviation of split frequencies: 0.015642 275500 -- (-1581.320) [-1576.123] (-1575.665) (-1574.371) * (-1574.015) [-1577.507] (-1573.705) (-1578.366) -- 0:00:47 276000 -- (-1582.252) (-1573.263) [-1583.092] (-1573.958) * (-1574.447) (-1575.832) [-1576.523] (-1578.026) -- 0:00:47 276500 -- (-1579.874) [-1573.890] (-1574.544) (-1575.948) * (-1575.846) [-1576.753] (-1575.381) (-1577.180) -- 0:00:47 277000 -- (-1577.202) [-1574.115] (-1574.267) (-1574.280) * [-1574.479] (-1575.431) (-1574.312) (-1575.247) -- 0:00:46 277500 -- [-1575.734] (-1573.606) (-1574.854) (-1578.619) * [-1577.709] (-1575.547) (-1574.578) (-1574.574) -- 0:00:46 278000 -- (-1576.328) [-1573.317] (-1576.004) (-1575.342) * (-1574.587) (-1575.635) (-1575.340) [-1575.541] -- 0:00:46 278500 -- (-1575.036) (-1573.716) (-1580.384) [-1573.714] * (-1574.591) (-1578.926) [-1573.469] (-1576.101) -- 0:00:46 279000 -- [-1575.737] (-1573.839) (-1574.454) (-1575.634) * (-1576.084) (-1577.872) (-1574.357) [-1577.378] -- 0:00:46 279500 -- (-1574.840) (-1574.178) [-1577.626] (-1579.086) * (-1575.140) (-1578.106) (-1574.337) [-1575.656] -- 0:00:46 280000 -- (-1574.843) (-1574.218) [-1578.846] (-1573.888) * [-1573.765] (-1575.461) (-1574.429) (-1575.561) -- 0:00:46 Average standard deviation of split frequencies: 0.016049 280500 -- (-1573.261) [-1574.443] (-1577.591) (-1574.081) * (-1574.938) (-1577.368) [-1576.839] (-1574.946) -- 0:00:46 281000 -- [-1572.924] (-1577.358) (-1574.921) (-1575.480) * (-1573.788) [-1575.359] (-1573.391) (-1574.343) -- 0:00:46 281500 -- (-1577.305) (-1577.355) [-1575.543] (-1576.993) * (-1575.122) [-1573.408] (-1573.291) (-1575.433) -- 0:00:45 282000 -- (-1573.629) (-1576.312) (-1576.418) [-1577.368] * [-1575.207] (-1573.159) (-1573.569) (-1576.054) -- 0:00:45 282500 -- (-1578.167) [-1577.632] (-1575.529) (-1575.033) * (-1575.935) [-1573.751] (-1573.822) (-1581.713) -- 0:00:45 283000 -- (-1579.684) (-1575.946) (-1573.551) [-1576.074] * (-1575.641) (-1578.621) (-1574.119) [-1579.501] -- 0:00:45 283500 -- (-1580.581) (-1576.734) [-1573.263] (-1576.742) * (-1575.204) (-1576.177) [-1575.312] (-1576.772) -- 0:00:45 284000 -- (-1578.528) (-1573.682) (-1573.428) [-1573.896] * (-1577.223) (-1581.201) [-1573.960] (-1575.373) -- 0:00:45 284500 -- (-1573.376) (-1573.565) [-1573.714] (-1580.330) * [-1579.172] (-1578.999) (-1575.348) (-1576.129) -- 0:00:45 285000 -- (-1576.679) [-1573.288] (-1574.494) (-1575.366) * [-1578.619] (-1574.737) (-1575.906) (-1578.565) -- 0:00:45 Average standard deviation of split frequencies: 0.014743 285500 -- (-1573.564) (-1573.900) (-1575.220) [-1574.781] * (-1574.754) [-1573.884] (-1578.102) (-1577.527) -- 0:00:45 286000 -- (-1573.247) [-1574.156] (-1574.773) (-1574.894) * (-1574.788) (-1573.884) [-1573.615] (-1582.825) -- 0:00:44 286500 -- (-1575.585) (-1575.329) [-1574.763] (-1575.099) * (-1574.793) [-1577.518] (-1573.828) (-1580.202) -- 0:00:44 287000 -- (-1574.963) (-1576.835) (-1576.975) [-1574.690] * (-1578.889) [-1574.018] (-1576.913) (-1574.956) -- 0:00:44 287500 -- (-1574.021) (-1576.907) [-1581.808] (-1574.946) * (-1576.512) (-1574.678) [-1576.143] (-1574.876) -- 0:00:47 288000 -- (-1573.598) [-1577.498] (-1581.575) (-1577.283) * (-1580.225) [-1573.819] (-1575.593) (-1577.495) -- 0:00:46 288500 -- (-1577.202) (-1576.435) (-1576.149) [-1574.258] * (-1577.366) (-1575.810) [-1575.334] (-1577.908) -- 0:00:46 289000 -- (-1577.074) (-1575.911) [-1579.183] (-1575.366) * (-1575.650) (-1579.049) (-1575.625) [-1575.362] -- 0:00:46 289500 -- (-1579.575) [-1574.097] (-1581.466) (-1576.505) * (-1576.945) (-1574.650) [-1574.714] (-1577.171) -- 0:00:46 290000 -- (-1578.732) (-1577.668) (-1575.206) [-1575.591] * (-1576.866) (-1575.798) (-1577.680) [-1577.796] -- 0:00:46 Average standard deviation of split frequencies: 0.015587 290500 -- (-1576.753) [-1574.057] (-1576.344) (-1581.491) * (-1578.846) (-1574.517) [-1574.025] (-1574.368) -- 0:00:46 291000 -- [-1575.347] (-1575.412) (-1576.222) (-1576.095) * (-1577.097) (-1574.219) [-1573.437] (-1574.907) -- 0:00:46 291500 -- [-1575.522] (-1576.409) (-1573.956) (-1573.906) * (-1574.881) [-1574.229] (-1573.695) (-1573.296) -- 0:00:46 292000 -- (-1575.184) [-1578.625] (-1575.683) (-1576.763) * [-1576.034] (-1576.186) (-1573.455) (-1573.050) -- 0:00:46 292500 -- (-1574.238) (-1583.662) [-1575.032] (-1574.675) * (-1578.502) (-1574.755) [-1573.166] (-1574.848) -- 0:00:45 293000 -- (-1574.175) (-1575.283) (-1574.474) [-1574.047] * (-1576.428) (-1574.347) [-1574.308] (-1575.748) -- 0:00:45 293500 -- (-1574.263) (-1573.763) [-1577.857] (-1575.096) * (-1574.667) (-1575.187) (-1574.660) [-1574.780] -- 0:00:45 294000 -- [-1573.236] (-1574.224) (-1577.921) (-1576.570) * (-1578.059) (-1579.548) (-1573.492) [-1575.420] -- 0:00:45 294500 -- [-1573.713] (-1576.818) (-1575.888) (-1576.329) * (-1573.817) [-1573.610] (-1576.901) (-1578.939) -- 0:00:45 295000 -- (-1572.903) [-1576.865] (-1574.407) (-1576.827) * (-1574.815) (-1574.923) [-1574.761] (-1581.320) -- 0:00:45 Average standard deviation of split frequencies: 0.015306 295500 -- (-1577.648) (-1577.456) [-1576.115] (-1573.337) * (-1575.361) (-1574.822) (-1574.275) [-1578.758] -- 0:00:45 296000 -- (-1574.317) (-1576.547) (-1573.997) [-1574.492] * [-1573.903] (-1578.962) (-1574.144) (-1575.748) -- 0:00:45 296500 -- [-1574.760] (-1577.377) (-1574.656) (-1575.101) * [-1573.941] (-1577.256) (-1574.965) (-1576.932) -- 0:00:45 297000 -- (-1573.120) [-1573.472] (-1576.238) (-1572.865) * [-1574.804] (-1577.313) (-1574.859) (-1575.046) -- 0:00:44 297500 -- (-1573.119) (-1574.433) [-1573.825] (-1573.211) * (-1573.793) (-1576.226) (-1573.416) [-1577.652] -- 0:00:44 298000 -- [-1574.029] (-1573.862) (-1577.201) (-1573.707) * [-1573.163] (-1577.350) (-1575.963) (-1577.816) -- 0:00:44 298500 -- (-1577.865) (-1573.918) (-1578.229) [-1573.707] * (-1575.567) [-1577.828] (-1575.012) (-1574.271) -- 0:00:44 299000 -- (-1579.945) (-1573.918) [-1578.067] (-1574.084) * [-1576.082] (-1578.031) (-1574.692) (-1574.658) -- 0:00:44 299500 -- (-1577.338) (-1574.371) (-1572.793) [-1577.781] * [-1573.731] (-1576.550) (-1573.867) (-1574.436) -- 0:00:44 300000 -- [-1577.385] (-1574.339) (-1574.641) (-1575.254) * [-1574.249] (-1576.465) (-1575.837) (-1576.909) -- 0:00:44 Average standard deviation of split frequencies: 0.015417 300500 -- [-1573.610] (-1573.940) (-1576.109) (-1574.688) * [-1575.100] (-1578.865) (-1574.654) (-1576.562) -- 0:00:44 301000 -- [-1573.487] (-1575.548) (-1577.442) (-1575.429) * (-1573.329) (-1576.854) (-1576.670) [-1576.716] -- 0:00:44 301500 -- [-1574.041] (-1575.594) (-1574.577) (-1576.306) * (-1575.785) [-1577.229] (-1576.325) (-1576.887) -- 0:00:44 302000 -- (-1577.188) (-1578.082) [-1575.083] (-1574.187) * [-1577.408] (-1575.911) (-1576.039) (-1576.765) -- 0:00:43 302500 -- (-1576.639) (-1574.810) [-1574.896] (-1573.966) * (-1577.519) [-1575.458] (-1576.768) (-1576.775) -- 0:00:46 303000 -- (-1575.410) (-1574.234) (-1576.682) [-1574.330] * (-1575.488) [-1575.228] (-1573.511) (-1577.716) -- 0:00:46 303500 -- (-1576.405) (-1573.593) (-1576.798) [-1574.132] * (-1575.852) (-1574.358) (-1578.669) [-1577.747] -- 0:00:45 304000 -- (-1575.121) (-1573.526) (-1573.978) [-1574.816] * (-1578.893) (-1575.147) (-1576.069) [-1574.052] -- 0:00:45 304500 -- [-1573.649] (-1575.711) (-1575.642) (-1581.373) * (-1573.959) (-1577.115) [-1573.852] (-1575.288) -- 0:00:45 305000 -- (-1573.089) (-1574.207) (-1574.026) [-1577.152] * [-1576.122] (-1576.683) (-1574.929) (-1575.221) -- 0:00:45 Average standard deviation of split frequencies: 0.015149 305500 -- [-1573.876] (-1574.319) (-1573.556) (-1574.682) * (-1576.613) (-1576.052) (-1574.873) [-1574.505] -- 0:00:45 306000 -- (-1572.928) (-1574.283) [-1574.736] (-1575.291) * (-1576.666) (-1573.547) (-1577.479) [-1573.773] -- 0:00:45 306500 -- (-1572.924) (-1574.619) (-1574.525) [-1576.016] * (-1577.338) (-1577.938) (-1573.668) [-1573.810] -- 0:00:45 307000 -- (-1575.374) [-1574.013] (-1577.244) (-1577.924) * (-1574.742) (-1573.382) [-1573.664] (-1577.034) -- 0:00:45 307500 -- (-1576.604) (-1574.192) (-1576.695) [-1577.235] * (-1574.197) (-1578.353) [-1574.325] (-1578.188) -- 0:00:45 308000 -- (-1575.845) [-1574.107] (-1577.010) (-1578.661) * [-1574.409] (-1577.802) (-1573.581) (-1580.403) -- 0:00:44 308500 -- (-1576.519) [-1574.031] (-1584.406) (-1579.788) * (-1573.932) (-1575.484) (-1575.449) [-1576.346] -- 0:00:44 309000 -- (-1575.262) [-1577.367] (-1577.710) (-1579.873) * (-1574.937) [-1575.814] (-1577.507) (-1576.346) -- 0:00:44 309500 -- (-1580.127) [-1575.393] (-1576.503) (-1575.220) * (-1576.001) (-1574.791) [-1574.840] (-1574.997) -- 0:00:44 310000 -- (-1576.827) [-1577.095] (-1575.884) (-1575.153) * (-1573.905) (-1576.279) (-1574.835) [-1575.080] -- 0:00:44 Average standard deviation of split frequencies: 0.013300 310500 -- (-1576.033) (-1574.316) (-1575.746) [-1575.401] * (-1573.328) (-1574.595) [-1575.465] (-1575.646) -- 0:00:44 311000 -- [-1575.593] (-1573.346) (-1574.940) (-1575.418) * (-1575.540) [-1577.648] (-1573.056) (-1573.651) -- 0:00:44 311500 -- (-1575.744) (-1573.267) [-1576.618] (-1573.720) * (-1575.608) [-1577.013] (-1573.163) (-1573.518) -- 0:00:44 312000 -- [-1574.373] (-1574.637) (-1574.384) (-1574.277) * [-1574.091] (-1575.059) (-1575.320) (-1574.984) -- 0:00:44 312500 -- (-1580.236) (-1575.810) [-1573.724] (-1576.689) * (-1575.226) (-1574.195) [-1574.935] (-1577.150) -- 0:00:44 313000 -- (-1576.123) (-1577.281) [-1576.012] (-1573.025) * [-1576.746] (-1573.966) (-1575.621) (-1579.090) -- 0:00:43 313500 -- (-1578.775) [-1576.237] (-1575.268) (-1576.628) * (-1575.730) (-1578.341) (-1576.443) [-1575.104] -- 0:00:43 314000 -- (-1574.774) (-1576.424) (-1573.528) [-1574.326] * (-1574.351) [-1573.742] (-1574.138) (-1575.627) -- 0:00:43 314500 -- [-1576.052] (-1577.557) (-1573.553) (-1574.453) * (-1573.958) (-1574.534) (-1574.593) [-1574.160] -- 0:00:43 315000 -- (-1575.082) (-1574.876) [-1574.760] (-1574.800) * (-1574.159) (-1577.098) (-1576.389) [-1574.556] -- 0:00:43 Average standard deviation of split frequencies: 0.012373 315500 -- (-1575.197) (-1578.242) [-1574.455] (-1573.488) * (-1574.720) (-1577.692) [-1573.970] (-1573.625) -- 0:00:43 316000 -- (-1576.504) (-1575.966) [-1574.589] (-1573.463) * (-1575.091) [-1574.048] (-1575.219) (-1577.763) -- 0:00:43 316500 -- [-1579.021] (-1576.786) (-1574.741) (-1573.770) * (-1575.087) (-1577.221) [-1578.391] (-1579.601) -- 0:00:43 317000 -- (-1573.728) [-1575.901] (-1573.867) (-1577.084) * (-1574.779) [-1576.337] (-1577.840) (-1576.439) -- 0:00:43 317500 -- (-1574.386) [-1574.519] (-1574.584) (-1575.723) * (-1574.396) (-1575.168) [-1577.520] (-1576.295) -- 0:00:42 318000 -- (-1575.717) (-1581.630) (-1575.269) [-1574.962] * (-1573.898) (-1575.061) [-1575.488] (-1574.205) -- 0:00:42 318500 -- (-1575.844) (-1578.782) [-1575.007] (-1575.414) * (-1579.893) [-1575.822] (-1581.252) (-1574.236) -- 0:00:44 319000 -- [-1576.475] (-1576.647) (-1574.843) (-1577.289) * (-1577.241) (-1577.935) [-1578.376] (-1576.470) -- 0:00:44 319500 -- (-1575.830) (-1574.261) [-1575.721] (-1577.117) * (-1578.782) (-1574.597) [-1576.743] (-1577.205) -- 0:00:44 320000 -- [-1576.511] (-1574.886) (-1576.070) (-1575.670) * (-1578.736) (-1578.018) [-1574.075] (-1575.393) -- 0:00:44 Average standard deviation of split frequencies: 0.012496 320500 -- (-1576.072) (-1576.437) [-1574.584] (-1574.935) * (-1579.658) [-1573.758] (-1572.977) (-1573.930) -- 0:00:44 321000 -- (-1574.826) [-1575.957] (-1575.883) (-1575.562) * (-1582.502) (-1576.197) (-1575.682) [-1573.451] -- 0:00:44 321500 -- (-1575.638) (-1577.163) [-1577.213] (-1575.793) * [-1575.320] (-1575.779) (-1574.020) (-1573.451) -- 0:00:44 322000 -- (-1579.730) [-1574.327] (-1576.746) (-1574.618) * [-1573.982] (-1574.156) (-1574.790) (-1574.856) -- 0:00:44 322500 -- (-1576.265) [-1577.286] (-1577.779) (-1576.449) * (-1574.378) (-1574.484) [-1573.773] (-1574.686) -- 0:00:44 323000 -- (-1576.093) (-1575.688) [-1575.048] (-1574.509) * (-1573.750) [-1576.007] (-1573.795) (-1577.493) -- 0:00:44 323500 -- (-1576.717) (-1576.775) [-1575.622] (-1573.953) * [-1576.249] (-1574.485) (-1573.940) (-1576.061) -- 0:00:43 324000 -- (-1574.058) (-1575.944) [-1574.681] (-1577.387) * [-1576.611] (-1575.912) (-1574.028) (-1574.064) -- 0:00:43 324500 -- (-1574.185) [-1574.155] (-1574.826) (-1576.665) * [-1577.921] (-1573.438) (-1574.944) (-1575.281) -- 0:00:43 325000 -- (-1574.445) [-1573.593] (-1576.857) (-1574.536) * (-1574.815) (-1575.504) (-1574.944) [-1573.128] -- 0:00:43 Average standard deviation of split frequencies: 0.011568 325500 -- [-1574.399] (-1573.235) (-1578.079) (-1576.899) * (-1574.573) [-1575.462] (-1575.817) (-1573.342) -- 0:00:43 326000 -- (-1574.933) (-1573.602) (-1575.714) [-1577.065] * (-1573.720) (-1575.023) (-1573.996) [-1577.617] -- 0:00:43 326500 -- (-1577.465) [-1574.909] (-1576.477) (-1575.493) * (-1574.164) (-1574.356) [-1575.291] (-1574.489) -- 0:00:43 327000 -- (-1577.142) [-1573.664] (-1573.364) (-1573.744) * (-1574.953) [-1577.804] (-1575.525) (-1574.241) -- 0:00:43 327500 -- (-1574.713) [-1573.201] (-1575.129) (-1573.851) * (-1573.377) (-1578.417) (-1574.781) [-1575.273] -- 0:00:43 328000 -- (-1573.396) [-1574.824] (-1575.427) (-1574.325) * (-1576.711) [-1575.514] (-1573.997) (-1581.109) -- 0:00:43 328500 -- (-1573.337) (-1575.820) [-1574.621] (-1574.333) * (-1575.039) (-1576.134) (-1574.569) [-1575.533] -- 0:00:42 329000 -- (-1576.692) [-1573.468] (-1578.480) (-1574.447) * (-1573.420) [-1576.679] (-1576.897) (-1574.996) -- 0:00:42 329500 -- (-1575.476) (-1574.168) [-1576.271] (-1575.815) * (-1574.312) [-1574.716] (-1573.811) (-1576.834) -- 0:00:42 330000 -- (-1577.584) (-1575.177) (-1575.531) [-1575.110] * (-1574.201) (-1574.666) [-1574.209] (-1576.942) -- 0:00:42 Average standard deviation of split frequencies: 0.011657 330500 -- (-1575.610) (-1576.910) (-1574.162) [-1575.317] * (-1574.027) (-1573.777) [-1576.377] (-1573.693) -- 0:00:42 331000 -- (-1574.112) [-1576.990] (-1574.353) (-1576.034) * (-1574.655) (-1575.623) [-1575.273] (-1574.790) -- 0:00:42 331500 -- (-1573.740) (-1580.287) (-1575.001) [-1575.975] * (-1575.349) (-1577.249) [-1576.802] (-1575.517) -- 0:00:42 332000 -- [-1574.026] (-1579.465) (-1575.139) (-1574.975) * [-1575.074] (-1579.963) (-1575.864) (-1573.240) -- 0:00:42 332500 -- (-1573.704) (-1573.765) (-1573.512) [-1577.430] * (-1573.644) (-1576.589) [-1576.504] (-1573.240) -- 0:00:42 333000 -- (-1576.726) [-1574.588] (-1574.655) (-1576.865) * (-1573.656) (-1574.584) (-1578.037) [-1573.748] -- 0:00:42 333500 -- (-1573.419) (-1574.650) [-1573.652] (-1579.257) * (-1572.841) (-1574.055) (-1576.750) [-1572.992] -- 0:00:41 334000 -- [-1573.486] (-1574.791) (-1573.657) (-1579.491) * [-1574.302] (-1575.481) (-1575.446) (-1572.974) -- 0:00:43 334500 -- (-1578.195) [-1573.677] (-1578.908) (-1578.931) * (-1576.879) (-1577.365) [-1574.495] (-1574.025) -- 0:00:43 335000 -- (-1577.324) [-1575.357] (-1576.918) (-1575.965) * [-1575.097] (-1576.597) (-1574.176) (-1574.861) -- 0:00:43 Average standard deviation of split frequencies: 0.011306 335500 -- (-1577.240) [-1574.483] (-1577.779) (-1577.058) * (-1572.934) (-1574.246) (-1575.852) [-1573.600] -- 0:00:43 336000 -- (-1575.727) [-1574.434] (-1574.949) (-1577.982) * [-1575.674] (-1574.747) (-1575.352) (-1573.292) -- 0:00:43 336500 -- (-1580.072) (-1575.257) [-1575.030] (-1574.210) * [-1576.192] (-1574.897) (-1574.592) (-1574.425) -- 0:00:43 337000 -- [-1576.376] (-1575.899) (-1574.890) (-1574.432) * (-1573.953) [-1575.470] (-1579.269) (-1576.517) -- 0:00:43 337500 -- (-1576.517) [-1576.087] (-1577.178) (-1574.322) * (-1573.684) [-1576.226] (-1578.004) (-1578.035) -- 0:00:43 338000 -- (-1575.934) [-1574.562] (-1578.540) (-1574.487) * (-1574.049) (-1575.320) (-1576.945) [-1577.905] -- 0:00:43 338500 -- [-1573.550] (-1573.820) (-1576.698) (-1576.199) * [-1574.831] (-1575.527) (-1576.050) (-1576.982) -- 0:00:42 339000 -- (-1573.560) [-1575.574] (-1576.388) (-1575.629) * (-1576.592) [-1574.298] (-1576.910) (-1575.492) -- 0:00:42 339500 -- (-1575.813) (-1578.045) (-1576.150) [-1576.756] * (-1573.368) (-1573.532) [-1576.597] (-1576.123) -- 0:00:42 340000 -- (-1573.864) [-1576.520] (-1574.057) (-1575.097) * (-1574.382) [-1573.363] (-1576.556) (-1575.882) -- 0:00:42 Average standard deviation of split frequencies: 0.010292 340500 -- [-1574.043] (-1574.461) (-1574.540) (-1574.583) * [-1573.099] (-1573.194) (-1575.704) (-1574.506) -- 0:00:42 341000 -- (-1574.742) [-1575.270] (-1576.759) (-1575.922) * (-1573.479) [-1573.655] (-1573.322) (-1574.147) -- 0:00:42 341500 -- (-1574.000) [-1576.547] (-1576.958) (-1573.997) * [-1575.054] (-1573.239) (-1573.816) (-1579.840) -- 0:00:42 342000 -- (-1576.961) (-1575.377) [-1574.599] (-1573.416) * (-1574.927) (-1575.316) [-1574.670] (-1577.327) -- 0:00:42 342500 -- [-1577.927] (-1575.651) (-1575.080) (-1575.617) * [-1575.285] (-1574.472) (-1573.919) (-1574.954) -- 0:00:42 343000 -- [-1578.394] (-1576.539) (-1576.114) (-1574.237) * [-1574.493] (-1574.870) (-1573.950) (-1576.085) -- 0:00:42 343500 -- [-1577.525] (-1578.250) (-1576.032) (-1573.012) * [-1574.570] (-1574.514) (-1576.573) (-1576.497) -- 0:00:42 344000 -- (-1578.433) [-1577.855] (-1578.842) (-1573.308) * (-1576.928) [-1574.006] (-1577.047) (-1574.944) -- 0:00:41 344500 -- (-1576.365) (-1581.974) (-1577.499) [-1574.232] * (-1574.268) [-1576.371] (-1575.909) (-1576.859) -- 0:00:41 345000 -- (-1575.596) (-1579.137) (-1574.893) [-1575.675] * (-1577.706) [-1573.677] (-1579.062) (-1577.433) -- 0:00:41 Average standard deviation of split frequencies: 0.010559 345500 -- (-1574.415) [-1574.022] (-1575.918) (-1575.903) * (-1575.076) (-1575.462) (-1573.067) [-1578.913] -- 0:00:41 346000 -- (-1574.448) [-1583.015] (-1574.959) (-1573.373) * (-1574.120) (-1576.036) (-1573.327) [-1577.660] -- 0:00:41 346500 -- (-1576.202) [-1575.699] (-1577.337) (-1573.373) * (-1575.917) [-1574.535] (-1574.914) (-1575.547) -- 0:00:41 347000 -- (-1576.149) (-1575.015) [-1577.467] (-1574.776) * (-1576.528) (-1576.437) [-1574.979] (-1579.422) -- 0:00:41 347500 -- [-1576.095] (-1576.986) (-1580.364) (-1575.935) * (-1576.392) [-1574.789] (-1574.192) (-1575.583) -- 0:00:41 348000 -- [-1573.967] (-1580.532) (-1583.006) (-1573.302) * (-1576.599) [-1574.572] (-1574.819) (-1581.230) -- 0:00:41 348500 -- (-1573.542) (-1575.315) [-1573.844] (-1573.265) * (-1576.307) [-1576.841] (-1574.824) (-1577.164) -- 0:00:41 349000 -- (-1573.784) [-1577.509] (-1573.664) (-1577.137) * [-1574.767] (-1575.065) (-1573.883) (-1576.923) -- 0:00:41 349500 -- (-1576.603) (-1576.482) [-1573.572] (-1581.178) * [-1576.655] (-1574.463) (-1573.722) (-1577.669) -- 0:00:42 350000 -- (-1574.899) (-1579.751) (-1576.484) [-1575.861] * (-1576.452) [-1573.475] (-1576.965) (-1577.886) -- 0:00:42 Average standard deviation of split frequencies: 0.009746 350500 -- [-1574.270] (-1575.974) (-1575.413) (-1576.381) * (-1574.514) [-1573.074] (-1576.003) (-1575.807) -- 0:00:42 351000 -- (-1574.104) (-1576.490) (-1576.136) [-1575.813] * (-1575.127) [-1575.523] (-1575.591) (-1574.291) -- 0:00:42 351500 -- [-1573.145] (-1575.608) (-1575.999) (-1574.455) * (-1577.963) [-1576.678] (-1573.746) (-1574.509) -- 0:00:42 352000 -- (-1575.191) (-1576.117) [-1573.292] (-1577.077) * (-1578.059) [-1575.144] (-1575.458) (-1575.134) -- 0:00:42 352500 -- (-1575.676) [-1575.165] (-1573.322) (-1576.373) * (-1575.719) [-1573.031] (-1574.825) (-1573.967) -- 0:00:42 353000 -- (-1573.650) [-1573.355] (-1574.411) (-1576.025) * (-1578.821) [-1573.025] (-1575.453) (-1579.105) -- 0:00:42 353500 -- [-1573.185] (-1573.912) (-1575.711) (-1574.811) * (-1577.761) (-1574.115) [-1573.990] (-1575.851) -- 0:00:42 354000 -- [-1573.658] (-1574.865) (-1575.959) (-1573.796) * [-1575.065] (-1575.195) (-1573.529) (-1575.192) -- 0:00:41 354500 -- (-1576.622) (-1575.097) [-1574.901] (-1573.611) * (-1576.290) (-1576.112) (-1575.319) [-1574.883] -- 0:00:41 355000 -- (-1576.682) [-1574.907] (-1579.766) (-1573.621) * (-1578.222) (-1575.036) [-1576.484] (-1574.677) -- 0:00:41 Average standard deviation of split frequencies: 0.009766 355500 -- (-1574.695) (-1574.099) [-1575.909] (-1576.198) * (-1575.181) (-1575.665) (-1575.179) [-1576.228] -- 0:00:41 356000 -- [-1573.925] (-1576.185) (-1577.596) (-1573.676) * (-1573.541) (-1576.980) (-1576.458) [-1577.571] -- 0:00:41 356500 -- (-1573.424) (-1582.507) (-1578.261) [-1575.477] * [-1573.551] (-1574.523) (-1579.129) (-1581.105) -- 0:00:41 357000 -- [-1575.549] (-1575.768) (-1576.177) (-1573.220) * (-1575.249) (-1577.587) (-1578.658) [-1575.865] -- 0:00:41 357500 -- (-1575.578) (-1573.965) [-1574.028] (-1576.948) * [-1573.471] (-1574.692) (-1574.877) (-1576.761) -- 0:00:41 358000 -- [-1575.917] (-1573.651) (-1578.321) (-1574.776) * (-1574.278) (-1582.387) (-1577.139) [-1577.044] -- 0:00:41 358500 -- (-1576.221) (-1575.398) [-1581.199] (-1574.375) * (-1575.210) (-1576.496) [-1576.533] (-1575.329) -- 0:00:41 359000 -- (-1576.221) [-1574.705] (-1576.776) (-1580.309) * (-1575.512) [-1575.560] (-1579.934) (-1574.487) -- 0:00:41 359500 -- (-1575.125) (-1574.660) [-1574.960] (-1576.256) * (-1574.940) (-1576.985) (-1580.342) [-1576.690] -- 0:00:40 360000 -- (-1575.502) [-1577.017] (-1574.516) (-1577.253) * (-1578.865) (-1576.371) (-1573.875) [-1577.430] -- 0:00:40 Average standard deviation of split frequencies: 0.010375 360500 -- (-1575.289) [-1576.308] (-1574.441) (-1575.600) * [-1577.665] (-1574.351) (-1574.517) (-1584.070) -- 0:00:40 361000 -- (-1574.290) (-1577.302) (-1576.729) [-1574.639] * (-1579.791) (-1575.255) [-1574.142] (-1576.179) -- 0:00:40 361500 -- (-1577.551) [-1574.174] (-1576.033) (-1574.847) * (-1573.523) (-1575.017) (-1575.732) [-1574.634] -- 0:00:40 362000 -- (-1574.287) (-1574.319) [-1580.432] (-1574.317) * [-1574.354] (-1574.776) (-1575.062) (-1574.659) -- 0:00:40 362500 -- (-1574.225) [-1574.804] (-1575.492) (-1575.427) * [-1574.450] (-1578.015) (-1573.569) (-1576.887) -- 0:00:40 363000 -- (-1574.979) (-1574.794) [-1578.329] (-1578.202) * (-1578.421) (-1577.795) (-1573.949) [-1581.641] -- 0:00:40 363500 -- (-1573.672) [-1574.697] (-1575.755) (-1576.237) * (-1574.101) (-1573.228) [-1573.649] (-1574.895) -- 0:00:40 364000 -- (-1573.742) (-1576.549) (-1575.287) [-1577.360] * (-1573.605) (-1573.923) [-1573.768] (-1576.639) -- 0:00:40 364500 -- (-1578.918) (-1581.298) (-1573.208) [-1574.510] * [-1573.274] (-1573.934) (-1580.223) (-1574.615) -- 0:00:40 365000 -- [-1574.984] (-1578.096) (-1573.772) (-1576.140) * (-1575.210) (-1576.668) [-1574.970] (-1574.601) -- 0:00:40 Average standard deviation of split frequencies: 0.010834 365500 -- (-1575.175) [-1579.179] (-1573.765) (-1574.920) * [-1573.295] (-1575.086) (-1573.065) (-1576.098) -- 0:00:41 366000 -- [-1573.325] (-1577.752) (-1572.951) (-1577.226) * (-1573.745) [-1575.930] (-1573.068) (-1574.521) -- 0:00:41 366500 -- [-1574.165] (-1576.216) (-1573.121) (-1575.481) * (-1574.607) (-1583.348) (-1573.076) [-1577.391] -- 0:00:41 367000 -- (-1574.763) (-1575.496) (-1576.333) [-1577.226] * (-1573.960) [-1574.997] (-1574.154) (-1575.294) -- 0:00:41 367500 -- [-1574.833] (-1574.068) (-1575.721) (-1577.507) * (-1573.698) (-1574.738) (-1575.610) [-1577.533] -- 0:00:41 368000 -- (-1573.485) (-1576.181) (-1575.568) [-1573.669] * (-1577.138) (-1577.588) [-1575.736] (-1581.552) -- 0:00:41 368500 -- [-1576.087] (-1583.329) (-1573.668) (-1577.637) * [-1576.629] (-1578.266) (-1579.626) (-1577.271) -- 0:00:41 369000 -- [-1573.242] (-1578.007) (-1578.316) (-1579.041) * [-1575.244] (-1577.089) (-1577.570) (-1574.838) -- 0:00:41 369500 -- (-1575.259) (-1578.733) (-1576.833) [-1578.253] * (-1573.725) (-1574.937) [-1573.771] (-1575.034) -- 0:00:40 370000 -- (-1576.406) (-1577.004) (-1574.042) [-1573.915] * (-1577.515) (-1574.632) (-1574.980) [-1574.996] -- 0:00:40 Average standard deviation of split frequencies: 0.010651 370500 -- [-1575.546] (-1574.897) (-1574.662) (-1574.557) * [-1576.659] (-1574.560) (-1574.609) (-1580.350) -- 0:00:40 371000 -- [-1574.707] (-1577.386) (-1575.232) (-1577.552) * [-1575.297] (-1574.559) (-1578.689) (-1575.514) -- 0:00:40 371500 -- (-1579.272) (-1575.244) (-1576.244) [-1573.047] * (-1575.285) (-1575.592) (-1576.898) [-1575.426] -- 0:00:40 372000 -- (-1581.659) (-1576.191) [-1575.186] (-1573.255) * (-1574.273) (-1574.412) (-1575.443) [-1575.471] -- 0:00:40 372500 -- [-1575.052] (-1575.538) (-1575.273) (-1573.926) * [-1573.964] (-1574.781) (-1575.361) (-1575.143) -- 0:00:40 373000 -- (-1574.276) [-1575.952] (-1574.353) (-1574.216) * (-1573.434) (-1574.558) (-1575.738) [-1575.778] -- 0:00:40 373500 -- (-1577.209) (-1574.797) (-1574.525) [-1575.117] * (-1575.420) (-1573.291) [-1573.640] (-1577.871) -- 0:00:40 374000 -- (-1577.241) (-1575.052) (-1574.474) [-1574.702] * (-1577.232) (-1575.573) [-1576.469] (-1575.398) -- 0:00:40 374500 -- (-1574.796) (-1575.376) (-1574.730) [-1573.652] * (-1576.764) [-1573.378] (-1580.197) (-1579.426) -- 0:00:40 375000 -- [-1573.761] (-1576.753) (-1574.632) (-1578.718) * [-1575.561] (-1574.172) (-1575.203) (-1576.394) -- 0:00:40 Average standard deviation of split frequencies: 0.010578 375500 -- (-1573.997) [-1573.163] (-1574.854) (-1579.045) * [-1573.863] (-1575.479) (-1574.458) (-1575.889) -- 0:00:39 376000 -- (-1576.181) (-1574.213) (-1574.711) [-1576.952] * [-1574.904] (-1581.430) (-1575.523) (-1574.845) -- 0:00:39 376500 -- [-1576.312] (-1574.170) (-1575.844) (-1574.612) * (-1576.044) [-1575.289] (-1574.382) (-1580.929) -- 0:00:39 377000 -- (-1575.523) (-1573.058) (-1574.710) [-1574.124] * (-1576.786) (-1575.921) (-1575.095) [-1575.576] -- 0:00:39 377500 -- (-1574.830) (-1575.435) (-1574.622) [-1575.644] * (-1575.838) (-1574.508) (-1575.229) [-1575.192] -- 0:00:39 378000 -- (-1575.007) [-1574.338] (-1574.235) (-1576.556) * (-1575.112) [-1574.201] (-1575.464) (-1575.814) -- 0:00:39 378500 -- (-1573.594) [-1575.445] (-1574.017) (-1576.243) * (-1576.031) (-1574.807) (-1575.442) [-1573.557] -- 0:00:39 379000 -- [-1573.377] (-1573.809) (-1575.062) (-1573.925) * [-1574.821] (-1574.717) (-1574.965) (-1575.749) -- 0:00:39 379500 -- [-1574.403] (-1574.755) (-1575.469) (-1575.838) * [-1574.843] (-1574.017) (-1575.993) (-1575.651) -- 0:00:39 380000 -- [-1574.987] (-1583.993) (-1578.232) (-1578.653) * (-1573.480) [-1573.936] (-1579.647) (-1575.237) -- 0:00:39 Average standard deviation of split frequencies: 0.009675 380500 -- [-1575.111] (-1575.993) (-1579.120) (-1577.214) * (-1574.214) [-1573.936] (-1577.535) (-1573.293) -- 0:00:39 381000 -- (-1577.178) (-1575.929) [-1575.610] (-1576.240) * (-1573.566) (-1574.067) (-1575.478) [-1573.276] -- 0:00:40 381500 -- (-1574.126) [-1576.980] (-1577.130) (-1575.640) * (-1573.906) (-1573.247) (-1575.320) [-1573.260] -- 0:00:40 382000 -- (-1577.117) [-1574.996] (-1574.464) (-1580.206) * (-1573.890) (-1577.983) [-1576.916] (-1573.789) -- 0:00:40 382500 -- (-1581.454) (-1574.288) [-1576.807] (-1575.434) * (-1576.255) (-1574.534) (-1574.514) [-1573.917] -- 0:00:40 383000 -- (-1574.952) (-1576.644) (-1574.549) [-1576.415] * (-1577.152) (-1573.597) [-1574.598] (-1575.278) -- 0:00:40 383500 -- (-1577.275) [-1574.297] (-1574.417) (-1575.621) * (-1575.059) (-1573.298) [-1576.688] (-1573.801) -- 0:00:40 384000 -- (-1574.771) (-1575.153) [-1573.255] (-1578.378) * [-1574.138] (-1576.204) (-1575.531) (-1578.111) -- 0:00:40 384500 -- [-1574.672] (-1574.653) (-1574.003) (-1576.558) * (-1576.865) (-1576.402) (-1575.163) [-1573.684] -- 0:00:40 385000 -- [-1577.832] (-1575.962) (-1574.314) (-1577.511) * (-1574.317) (-1574.051) (-1575.993) [-1573.621] -- 0:00:39 Average standard deviation of split frequencies: 0.009770 385500 -- (-1578.146) [-1577.864] (-1574.478) (-1578.263) * [-1573.684] (-1575.424) (-1575.766) (-1574.242) -- 0:00:39 386000 -- (-1575.004) [-1573.703] (-1573.276) (-1576.290) * [-1574.004] (-1574.546) (-1577.526) (-1572.876) -- 0:00:39 386500 -- [-1574.115] (-1578.775) (-1573.895) (-1579.216) * [-1573.938] (-1578.886) (-1580.018) (-1573.245) -- 0:00:39 387000 -- (-1575.016) [-1575.152] (-1574.331) (-1580.407) * (-1583.920) (-1575.486) [-1573.672] (-1573.430) -- 0:00:39 387500 -- (-1573.525) (-1578.916) [-1575.782] (-1575.280) * (-1576.612) (-1574.719) (-1573.488) [-1574.117] -- 0:00:39 388000 -- [-1575.785] (-1574.737) (-1575.210) (-1575.879) * (-1575.582) [-1575.758] (-1579.525) (-1574.119) -- 0:00:39 388500 -- (-1578.617) [-1574.759] (-1573.886) (-1576.309) * [-1574.704] (-1574.644) (-1577.131) (-1574.793) -- 0:00:39 389000 -- (-1577.829) [-1575.720] (-1575.881) (-1576.185) * (-1574.236) (-1586.553) (-1573.910) [-1574.550] -- 0:00:39 389500 -- (-1576.130) [-1575.689] (-1576.020) (-1574.638) * [-1573.445] (-1578.770) (-1574.311) (-1577.903) -- 0:00:39 390000 -- (-1576.188) [-1574.102] (-1573.148) (-1573.960) * (-1574.131) (-1574.489) [-1574.192] (-1574.047) -- 0:00:39 Average standard deviation of split frequencies: 0.010257 390500 -- (-1576.079) (-1576.059) (-1574.859) [-1573.316] * (-1575.002) [-1576.597] (-1579.551) (-1573.845) -- 0:00:39 391000 -- (-1577.581) [-1574.990] (-1575.556) (-1573.738) * (-1579.942) (-1575.388) [-1574.991] (-1574.319) -- 0:00:38 391500 -- (-1574.594) (-1575.194) [-1574.290] (-1577.459) * (-1581.536) [-1573.850] (-1575.866) (-1575.109) -- 0:00:38 392000 -- [-1576.136] (-1576.390) (-1579.865) (-1576.203) * (-1573.892) (-1578.370) (-1577.893) [-1578.211] -- 0:00:38 392500 -- (-1578.420) [-1574.155] (-1577.111) (-1574.064) * (-1573.892) (-1578.605) [-1574.823] (-1576.354) -- 0:00:38 393000 -- (-1578.542) (-1578.502) (-1582.671) [-1574.511] * (-1574.795) (-1577.002) [-1574.236] (-1578.908) -- 0:00:38 393500 -- [-1577.742] (-1575.491) (-1576.733) (-1574.695) * (-1574.202) [-1573.293] (-1574.062) (-1578.697) -- 0:00:38 394000 -- [-1574.518] (-1576.601) (-1575.764) (-1573.927) * (-1575.881) (-1577.641) [-1573.913] (-1575.833) -- 0:00:38 394500 -- (-1573.449) (-1575.930) (-1579.862) [-1574.101] * [-1575.757] (-1577.923) (-1575.176) (-1575.161) -- 0:00:38 395000 -- (-1573.615) (-1576.016) [-1575.230] (-1577.857) * [-1575.559] (-1576.376) (-1575.699) (-1574.057) -- 0:00:38 Average standard deviation of split frequencies: 0.010639 395500 -- [-1573.616] (-1576.567) (-1574.977) (-1576.764) * (-1573.618) (-1577.188) (-1574.569) [-1575.246] -- 0:00:38 396000 -- [-1573.616] (-1573.923) (-1574.671) (-1575.246) * [-1573.502] (-1578.268) (-1575.355) (-1576.742) -- 0:00:38 396500 -- (-1574.672) (-1574.142) [-1573.531] (-1573.393) * (-1573.824) [-1576.624] (-1574.467) (-1575.322) -- 0:00:39 397000 -- (-1574.273) (-1574.899) (-1574.322) [-1573.391] * [-1573.936] (-1575.095) (-1576.576) (-1575.162) -- 0:00:39 397500 -- (-1573.306) (-1574.726) (-1578.865) [-1574.216] * [-1575.761] (-1576.101) (-1576.281) (-1574.458) -- 0:00:39 398000 -- (-1574.996) (-1573.979) (-1577.110) [-1573.198] * (-1574.646) (-1580.438) [-1576.588] (-1577.480) -- 0:00:39 398500 -- (-1579.854) (-1573.664) [-1574.918] (-1576.767) * (-1576.687) (-1574.311) [-1576.870] (-1574.733) -- 0:00:39 399000 -- (-1578.614) (-1575.582) [-1575.186] (-1575.546) * (-1573.797) (-1575.892) [-1575.551] (-1576.169) -- 0:00:39 399500 -- [-1576.400] (-1574.600) (-1574.952) (-1574.530) * (-1575.283) (-1574.248) [-1575.549] (-1574.203) -- 0:00:39 400000 -- (-1573.597) [-1574.981] (-1573.996) (-1573.229) * (-1574.100) (-1574.536) [-1575.905] (-1575.671) -- 0:00:39 Average standard deviation of split frequencies: 0.010797 400500 -- (-1573.882) (-1575.079) [-1573.999] (-1573.381) * (-1574.798) (-1573.998) [-1576.647] (-1575.355) -- 0:00:38 401000 -- (-1574.585) [-1573.926] (-1574.884) (-1573.565) * (-1581.945) [-1576.192] (-1577.366) (-1575.511) -- 0:00:38 401500 -- (-1575.361) (-1573.567) [-1573.887] (-1574.177) * (-1574.098) [-1574.983] (-1584.034) (-1575.078) -- 0:00:38 402000 -- [-1574.109] (-1573.831) (-1575.889) (-1576.155) * (-1573.726) [-1574.588] (-1574.886) (-1573.649) -- 0:00:38 402500 -- (-1574.478) [-1574.189] (-1578.915) (-1574.218) * (-1572.918) (-1574.412) (-1574.612) [-1574.138] -- 0:00:38 403000 -- (-1577.163) [-1574.773] (-1579.626) (-1576.631) * (-1573.491) (-1573.772) [-1573.194] (-1573.750) -- 0:00:38 403500 -- (-1577.033) [-1574.749] (-1576.968) (-1574.718) * (-1575.111) (-1574.252) [-1574.146] (-1579.168) -- 0:00:38 404000 -- (-1574.946) (-1573.655) [-1575.318] (-1576.544) * [-1576.802] (-1575.445) (-1574.741) (-1580.097) -- 0:00:38 404500 -- (-1574.198) (-1573.773) (-1575.238) [-1575.701] * [-1575.288] (-1576.168) (-1574.662) (-1578.691) -- 0:00:38 405000 -- (-1574.762) [-1575.323] (-1574.272) (-1574.448) * (-1576.991) [-1577.090] (-1573.200) (-1576.950) -- 0:00:38 Average standard deviation of split frequencies: 0.010586 405500 -- (-1574.465) [-1573.883] (-1573.911) (-1573.429) * (-1575.483) (-1574.763) (-1575.409) [-1575.754] -- 0:00:38 406000 -- (-1575.522) (-1573.996) (-1574.532) [-1573.404] * (-1574.860) (-1575.430) [-1575.109] (-1574.993) -- 0:00:38 406500 -- (-1578.430) (-1575.028) (-1574.776) [-1574.152] * (-1574.378) (-1573.934) (-1574.373) [-1575.176] -- 0:00:37 407000 -- (-1575.348) (-1575.325) (-1575.903) [-1574.358] * (-1573.599) [-1573.536] (-1575.940) (-1578.506) -- 0:00:37 407500 -- (-1576.548) (-1577.011) (-1574.629) [-1573.918] * [-1574.560] (-1573.546) (-1578.956) (-1578.887) -- 0:00:37 408000 -- (-1575.411) (-1576.376) [-1576.064] (-1574.296) * (-1574.023) [-1574.581] (-1573.333) (-1579.492) -- 0:00:37 408500 -- (-1576.272) [-1575.607] (-1576.977) (-1573.528) * (-1574.349) [-1573.439] (-1573.122) (-1579.768) -- 0:00:37 409000 -- (-1577.290) (-1575.337) (-1574.851) [-1573.587] * (-1576.086) (-1574.517) [-1573.551] (-1573.686) -- 0:00:37 409500 -- (-1575.001) (-1573.923) (-1574.986) [-1573.756] * (-1573.503) [-1573.382] (-1576.817) (-1574.556) -- 0:00:37 410000 -- (-1573.731) (-1573.262) [-1577.009] (-1573.690) * (-1574.496) (-1576.303) (-1576.183) [-1574.907] -- 0:00:37 Average standard deviation of split frequencies: 0.011006 410500 -- (-1576.247) (-1573.271) [-1576.253] (-1574.701) * (-1573.814) (-1576.586) (-1574.228) [-1574.684] -- 0:00:37 411000 -- [-1579.015] (-1574.799) (-1575.882) (-1577.373) * (-1576.995) (-1578.351) [-1575.052] (-1576.156) -- 0:00:37 411500 -- [-1579.049] (-1575.209) (-1573.542) (-1575.466) * (-1576.377) (-1576.250) (-1574.423) [-1574.266] -- 0:00:37 412000 -- [-1576.757] (-1579.088) (-1577.175) (-1575.991) * (-1577.481) (-1580.915) (-1574.646) [-1575.309] -- 0:00:38 412500 -- [-1576.046] (-1576.415) (-1575.761) (-1576.293) * (-1578.214) (-1575.649) (-1575.857) [-1574.752] -- 0:00:38 413000 -- (-1576.715) (-1577.010) (-1576.968) [-1576.431] * (-1575.389) (-1577.735) (-1574.138) [-1575.221] -- 0:00:38 413500 -- (-1575.477) [-1574.378] (-1573.782) (-1580.905) * (-1574.179) (-1573.260) (-1575.105) [-1575.352] -- 0:00:38 414000 -- [-1576.570] (-1573.832) (-1575.995) (-1579.654) * (-1573.739) [-1573.845] (-1573.631) (-1574.677) -- 0:00:38 414500 -- [-1578.329] (-1574.511) (-1577.211) (-1579.690) * (-1573.935) [-1573.408] (-1576.441) (-1578.861) -- 0:00:38 415000 -- (-1578.263) [-1573.917] (-1579.782) (-1573.655) * (-1574.301) [-1574.500] (-1574.789) (-1579.568) -- 0:00:38 Average standard deviation of split frequencies: 0.010865 415500 -- [-1574.958] (-1576.696) (-1581.876) (-1575.430) * [-1574.163] (-1573.956) (-1576.879) (-1573.904) -- 0:00:37 416000 -- (-1576.307) (-1578.321) (-1573.971) [-1573.811] * [-1574.050] (-1577.343) (-1575.095) (-1577.846) -- 0:00:37 416500 -- (-1575.383) (-1577.747) (-1575.196) [-1575.323] * (-1575.779) (-1575.396) [-1573.911] (-1579.235) -- 0:00:37 417000 -- (-1573.924) (-1577.298) (-1575.531) [-1576.145] * (-1577.565) [-1579.252] (-1574.530) (-1575.746) -- 0:00:37 417500 -- (-1576.195) [-1575.900] (-1575.686) (-1574.632) * (-1573.721) (-1577.674) [-1574.526] (-1574.276) -- 0:00:37 418000 -- (-1577.862) [-1575.797] (-1574.900) (-1573.318) * [-1577.651] (-1575.581) (-1575.894) (-1575.510) -- 0:00:37 418500 -- (-1574.693) (-1575.708) (-1579.506) [-1573.835] * (-1577.532) (-1575.111) [-1573.700] (-1577.730) -- 0:00:37 419000 -- (-1575.305) [-1574.206] (-1579.168) (-1574.311) * (-1576.218) [-1574.584] (-1574.578) (-1573.493) -- 0:00:37 419500 -- (-1573.901) [-1574.412] (-1576.372) (-1580.279) * (-1575.642) (-1580.784) [-1574.039] (-1574.566) -- 0:00:37 420000 -- (-1573.715) (-1573.956) [-1576.334] (-1578.442) * (-1575.684) (-1573.146) [-1573.803] (-1573.967) -- 0:00:37 Average standard deviation of split frequencies: 0.010547 420500 -- (-1575.240) (-1573.876) [-1574.481] (-1579.401) * (-1575.462) (-1573.143) (-1576.336) [-1574.773] -- 0:00:37 421000 -- (-1575.580) [-1573.583] (-1573.605) (-1579.553) * (-1576.571) (-1573.625) (-1575.014) [-1574.539] -- 0:00:37 421500 -- (-1574.493) [-1575.172] (-1574.731) (-1574.517) * (-1573.495) [-1572.967] (-1575.014) (-1575.325) -- 0:00:37 422000 -- (-1574.409) (-1577.219) (-1574.503) [-1575.074] * (-1573.495) [-1573.990] (-1573.806) (-1573.885) -- 0:00:36 422500 -- (-1573.946) (-1575.902) [-1576.354] (-1576.065) * (-1573.410) (-1573.678) [-1573.669] (-1578.407) -- 0:00:36 423000 -- (-1573.394) [-1578.407] (-1574.047) (-1574.468) * (-1573.410) [-1574.779] (-1575.106) (-1576.108) -- 0:00:36 423500 -- (-1574.625) (-1579.362) [-1573.835] (-1574.199) * (-1574.104) (-1576.085) (-1575.397) [-1573.685] -- 0:00:36 424000 -- (-1574.330) (-1578.372) (-1575.249) [-1573.342] * (-1573.457) (-1575.981) (-1576.650) [-1574.624] -- 0:00:36 424500 -- (-1574.330) (-1574.115) (-1574.190) [-1574.498] * (-1577.253) (-1575.521) (-1580.109) [-1576.738] -- 0:00:36 425000 -- (-1574.288) [-1574.100] (-1575.357) (-1576.432) * (-1576.215) (-1577.807) (-1577.132) [-1575.452] -- 0:00:36 Average standard deviation of split frequencies: 0.010415 425500 -- [-1574.169] (-1574.588) (-1575.584) (-1579.309) * (-1575.581) (-1577.720) [-1576.771] (-1577.271) -- 0:00:36 426000 -- [-1573.761] (-1576.311) (-1575.405) (-1587.764) * (-1573.794) (-1578.938) (-1574.478) [-1578.762] -- 0:00:36 426500 -- (-1573.761) (-1574.479) [-1575.973] (-1579.024) * (-1575.203) (-1577.401) [-1574.328] (-1580.738) -- 0:00:36 427000 -- (-1574.883) (-1576.713) [-1574.540] (-1577.386) * (-1575.684) [-1575.161] (-1577.886) (-1574.147) -- 0:00:36 427500 -- (-1576.487) (-1574.623) [-1574.222] (-1573.835) * (-1574.132) (-1574.953) [-1576.930] (-1575.193) -- 0:00:36 428000 -- [-1574.351] (-1574.464) (-1577.667) (-1575.223) * (-1578.533) [-1574.934] (-1573.552) (-1577.790) -- 0:00:37 428500 -- [-1577.504] (-1574.781) (-1576.710) (-1576.607) * [-1573.874] (-1575.299) (-1574.283) (-1575.909) -- 0:00:37 429000 -- (-1577.446) (-1574.432) [-1577.002] (-1576.544) * (-1577.161) (-1575.191) (-1575.768) [-1575.305] -- 0:00:37 429500 -- (-1576.068) (-1573.679) [-1575.236] (-1574.929) * (-1583.712) (-1580.633) (-1575.621) [-1574.615] -- 0:00:37 430000 -- (-1577.221) (-1573.576) [-1574.435] (-1574.781) * [-1581.604] (-1575.089) (-1573.516) (-1576.796) -- 0:00:37 Average standard deviation of split frequencies: 0.010431 430500 -- (-1576.146) [-1574.187] (-1573.695) (-1577.591) * (-1574.925) (-1576.289) (-1573.736) [-1573.748] -- 0:00:37 431000 -- (-1575.418) (-1574.617) [-1573.122] (-1575.601) * (-1575.737) (-1576.133) [-1575.520] (-1577.841) -- 0:00:36 431500 -- [-1577.789] (-1574.888) (-1575.273) (-1575.082) * (-1576.146) (-1577.371) (-1575.378) [-1576.066] -- 0:00:36 432000 -- (-1577.016) (-1575.446) (-1579.197) [-1577.562] * (-1572.925) [-1574.502] (-1579.056) (-1573.640) -- 0:00:36 432500 -- (-1577.019) [-1575.153] (-1575.023) (-1575.481) * [-1574.265] (-1576.379) (-1577.086) (-1573.981) -- 0:00:36 433000 -- (-1575.384) [-1575.140] (-1575.003) (-1575.778) * (-1575.351) (-1577.470) (-1574.158) [-1574.586] -- 0:00:36 433500 -- (-1574.947) [-1575.914] (-1575.121) (-1575.744) * (-1575.457) (-1573.855) [-1574.122] (-1575.676) -- 0:00:36 434000 -- [-1573.682] (-1576.227) (-1579.759) (-1576.206) * (-1576.606) [-1573.855] (-1574.147) (-1576.306) -- 0:00:36 434500 -- [-1574.492] (-1575.721) (-1576.140) (-1575.765) * (-1579.631) (-1579.511) (-1577.415) [-1576.923] -- 0:00:36 435000 -- (-1574.564) (-1575.702) (-1575.750) [-1580.395] * (-1578.062) (-1574.451) (-1575.586) [-1573.420] -- 0:00:36 Average standard deviation of split frequencies: 0.009791 435500 -- (-1574.537) (-1573.216) (-1574.441) [-1579.692] * (-1577.596) (-1576.470) (-1576.333) [-1573.422] -- 0:00:36 436000 -- [-1574.647] (-1575.007) (-1574.139) (-1575.509) * (-1573.635) [-1583.094] (-1578.247) (-1574.710) -- 0:00:36 436500 -- (-1578.653) (-1574.300) (-1573.850) [-1576.128] * (-1573.738) [-1573.908] (-1580.025) (-1573.611) -- 0:00:36 437000 -- (-1576.317) (-1575.114) (-1573.755) [-1573.644] * (-1574.364) [-1576.792] (-1575.526) (-1574.316) -- 0:00:36 437500 -- (-1577.151) (-1574.068) (-1576.153) [-1574.376] * (-1579.415) (-1578.297) [-1578.659] (-1578.485) -- 0:00:36 438000 -- (-1575.568) (-1574.075) [-1573.830] (-1577.266) * (-1574.507) (-1576.075) (-1575.364) [-1575.209] -- 0:00:35 438500 -- (-1574.186) [-1576.706] (-1575.603) (-1574.744) * (-1574.798) [-1576.059] (-1576.248) (-1575.489) -- 0:00:35 439000 -- [-1575.828] (-1574.866) (-1575.198) (-1574.880) * (-1574.916) (-1576.381) (-1573.914) [-1574.716] -- 0:00:35 439500 -- [-1573.568] (-1576.285) (-1573.928) (-1574.273) * (-1575.157) (-1575.270) (-1575.083) [-1574.950] -- 0:00:35 440000 -- (-1575.541) (-1573.350) [-1573.629] (-1576.860) * (-1575.680) [-1580.657] (-1574.821) (-1573.142) -- 0:00:35 Average standard deviation of split frequencies: 0.010876 440500 -- (-1574.350) (-1574.378) [-1574.711] (-1576.939) * (-1579.907) (-1577.154) (-1575.705) [-1573.818] -- 0:00:35 441000 -- (-1573.693) (-1573.348) (-1575.531) [-1574.350] * [-1574.545] (-1575.198) (-1574.196) (-1574.123) -- 0:00:35 441500 -- (-1574.432) [-1573.259] (-1577.945) (-1575.018) * (-1576.521) (-1575.301) (-1574.228) [-1574.960] -- 0:00:35 442000 -- [-1574.400] (-1573.239) (-1576.261) (-1574.557) * (-1575.761) (-1574.057) (-1573.696) [-1575.477] -- 0:00:35 442500 -- [-1573.431] (-1576.978) (-1574.234) (-1574.264) * [-1574.370] (-1573.740) (-1573.666) (-1574.845) -- 0:00:35 443000 -- (-1574.723) (-1573.830) (-1573.678) [-1576.526] * (-1573.761) (-1574.417) [-1575.287] (-1572.762) -- 0:00:35 443500 -- (-1574.255) (-1574.303) (-1575.941) [-1574.600] * [-1573.787] (-1576.940) (-1574.401) (-1573.022) -- 0:00:36 444000 -- (-1574.146) (-1575.693) (-1573.309) [-1573.072] * (-1573.880) (-1575.196) (-1573.936) [-1573.879] -- 0:00:36 444500 -- (-1577.178) (-1576.680) (-1578.107) [-1573.936] * (-1573.799) (-1574.282) (-1578.439) [-1574.945] -- 0:00:36 445000 -- (-1579.390) (-1574.809) [-1576.199] (-1578.017) * [-1573.606] (-1574.044) (-1576.099) (-1576.147) -- 0:00:36 Average standard deviation of split frequencies: 0.009637 445500 -- [-1576.464] (-1574.399) (-1581.023) (-1575.169) * [-1575.019] (-1575.173) (-1574.772) (-1573.095) -- 0:00:36 446000 -- (-1578.129) (-1574.797) [-1573.837] (-1574.715) * (-1578.965) [-1576.053] (-1575.381) (-1575.554) -- 0:00:36 446500 -- (-1576.416) [-1574.956] (-1577.867) (-1575.379) * [-1573.412] (-1575.958) (-1573.406) (-1575.435) -- 0:00:35 447000 -- (-1576.736) (-1574.321) (-1574.279) [-1573.909] * (-1574.390) [-1575.127] (-1573.252) (-1575.187) -- 0:00:35 447500 -- (-1577.732) [-1575.296] (-1574.780) (-1574.140) * (-1575.815) (-1573.062) (-1573.824) [-1574.660] -- 0:00:35 448000 -- (-1577.604) (-1573.185) [-1575.625] (-1574.969) * [-1578.984] (-1577.002) (-1576.052) (-1575.052) -- 0:00:35 448500 -- (-1577.291) [-1573.088] (-1576.846) (-1574.969) * (-1580.804) (-1573.741) (-1575.189) [-1574.557] -- 0:00:35 449000 -- (-1576.455) [-1574.017] (-1582.040) (-1576.126) * (-1578.673) [-1573.632] (-1575.272) (-1576.937) -- 0:00:35 449500 -- (-1578.760) (-1580.838) [-1577.024] (-1575.691) * (-1578.913) (-1574.344) (-1574.074) [-1576.027] -- 0:00:35 450000 -- (-1575.541) [-1577.955] (-1577.684) (-1573.247) * (-1575.260) (-1576.609) [-1578.612] (-1574.867) -- 0:00:35 Average standard deviation of split frequencies: 0.010153 450500 -- [-1575.120] (-1576.374) (-1578.446) (-1573.504) * (-1574.317) [-1574.849] (-1577.237) (-1575.438) -- 0:00:35 451000 -- (-1574.043) [-1574.348] (-1577.506) (-1577.558) * (-1577.476) (-1575.200) [-1575.301] (-1574.285) -- 0:00:35 451500 -- (-1574.475) [-1577.711] (-1576.259) (-1576.349) * (-1575.849) [-1575.772] (-1576.473) (-1576.222) -- 0:00:35 452000 -- [-1574.855] (-1578.524) (-1574.678) (-1577.278) * (-1579.747) (-1575.156) (-1576.485) [-1575.935] -- 0:00:35 452500 -- [-1573.680] (-1578.908) (-1573.971) (-1576.643) * (-1580.700) (-1578.943) [-1576.043] (-1575.008) -- 0:00:35 453000 -- (-1573.737) [-1574.003] (-1574.471) (-1584.469) * (-1576.799) (-1576.762) (-1579.197) [-1574.976] -- 0:00:35 453500 -- (-1574.118) (-1575.310) (-1575.215) [-1575.006] * (-1573.193) (-1580.079) [-1576.633] (-1577.011) -- 0:00:34 454000 -- (-1575.450) (-1573.917) [-1573.656] (-1574.803) * (-1573.724) [-1575.297] (-1577.000) (-1574.233) -- 0:00:34 454500 -- [-1578.269] (-1576.367) (-1573.967) (-1578.394) * (-1575.380) [-1574.262] (-1578.483) (-1575.842) -- 0:00:34 455000 -- (-1581.049) (-1576.735) [-1577.607] (-1575.396) * (-1574.743) (-1574.257) (-1576.553) [-1574.170] -- 0:00:34 Average standard deviation of split frequencies: 0.009973 455500 -- (-1575.842) (-1575.712) (-1577.235) [-1575.280] * [-1573.760] (-1574.430) (-1577.292) (-1582.848) -- 0:00:34 456000 -- [-1574.520] (-1575.715) (-1576.930) (-1575.034) * (-1574.197) (-1576.042) (-1575.858) [-1575.385] -- 0:00:34 456500 -- (-1578.055) (-1573.924) (-1577.134) [-1575.545] * (-1575.315) (-1577.933) [-1578.027] (-1576.490) -- 0:00:34 457000 -- (-1581.027) (-1573.095) [-1574.884] (-1574.791) * (-1573.906) (-1577.470) [-1574.726] (-1579.470) -- 0:00:34 457500 -- (-1575.692) (-1572.898) (-1575.309) [-1574.055] * (-1574.699) (-1577.389) [-1575.729] (-1576.653) -- 0:00:34 458000 -- [-1576.247] (-1572.898) (-1575.332) (-1577.012) * (-1573.453) [-1573.830] (-1574.800) (-1574.128) -- 0:00:34 458500 -- (-1579.051) [-1573.702] (-1575.801) (-1573.764) * (-1575.163) (-1575.113) (-1576.281) [-1577.501] -- 0:00:34 459000 -- (-1576.507) (-1573.688) [-1576.122] (-1573.911) * (-1575.577) (-1573.352) (-1574.320) [-1576.679] -- 0:00:35 459500 -- (-1574.282) (-1573.883) [-1574.635] (-1575.464) * (-1575.484) (-1574.684) (-1574.689) [-1576.284] -- 0:00:35 460000 -- (-1574.439) [-1573.882] (-1575.218) (-1575.599) * [-1573.755] (-1576.313) (-1574.837) (-1575.475) -- 0:00:35 Average standard deviation of split frequencies: 0.009812 460500 -- (-1575.534) [-1574.102] (-1575.482) (-1574.438) * (-1574.036) [-1578.911] (-1574.243) (-1573.791) -- 0:00:35 461000 -- (-1574.096) (-1578.131) [-1576.417] (-1573.451) * [-1573.575] (-1577.283) (-1574.010) (-1574.419) -- 0:00:35 461500 -- (-1573.858) [-1576.228] (-1575.575) (-1574.034) * (-1574.122) (-1574.148) (-1574.749) [-1574.022] -- 0:00:35 462000 -- [-1574.844] (-1574.403) (-1578.969) (-1579.321) * [-1574.135] (-1574.899) (-1578.513) (-1576.458) -- 0:00:34 462500 -- (-1573.702) [-1577.457] (-1576.217) (-1578.663) * (-1573.548) (-1578.667) (-1578.586) [-1573.622] -- 0:00:34 463000 -- (-1574.822) (-1577.439) (-1576.797) [-1576.212] * (-1574.036) (-1578.474) [-1574.498] (-1579.655) -- 0:00:34 463500 -- [-1577.208] (-1576.142) (-1575.353) (-1583.302) * (-1574.004) [-1576.446] (-1574.255) (-1574.170) -- 0:00:34 464000 -- (-1574.593) (-1574.485) (-1574.147) [-1582.449] * (-1573.716) [-1577.017] (-1574.828) (-1579.794) -- 0:00:34 464500 -- [-1574.141] (-1576.116) (-1575.794) (-1575.701) * (-1573.394) (-1575.228) [-1575.216] (-1575.724) -- 0:00:34 465000 -- (-1576.329) (-1574.971) [-1575.027] (-1577.610) * [-1574.836] (-1572.787) (-1579.338) (-1574.559) -- 0:00:34 Average standard deviation of split frequencies: 0.010711 465500 -- (-1576.085) (-1576.289) [-1575.842] (-1579.984) * (-1574.789) (-1578.181) [-1575.097] (-1574.829) -- 0:00:34 466000 -- (-1574.355) (-1575.323) (-1575.931) [-1577.283] * (-1577.849) (-1575.269) [-1577.135] (-1574.382) -- 0:00:34 466500 -- [-1574.512] (-1576.432) (-1577.002) (-1574.970) * [-1575.508] (-1574.840) (-1573.883) (-1577.021) -- 0:00:34 467000 -- (-1575.379) (-1575.950) [-1575.032] (-1575.219) * (-1574.421) (-1573.526) (-1575.157) [-1574.178] -- 0:00:34 467500 -- (-1577.281) (-1576.067) (-1577.327) [-1575.148] * (-1574.322) [-1573.525] (-1573.263) (-1573.407) -- 0:00:34 468000 -- (-1574.009) (-1576.132) [-1573.112] (-1574.079) * [-1575.185] (-1574.107) (-1576.657) (-1573.984) -- 0:00:34 468500 -- [-1574.841] (-1574.132) (-1573.844) (-1574.670) * [-1575.590] (-1574.189) (-1575.971) (-1577.563) -- 0:00:34 469000 -- (-1575.430) (-1574.132) [-1575.589] (-1575.311) * [-1573.617] (-1574.733) (-1576.931) (-1574.392) -- 0:00:33 469500 -- (-1574.438) [-1574.283] (-1579.458) (-1575.241) * (-1574.399) (-1573.821) (-1575.964) [-1573.566] -- 0:00:33 470000 -- (-1574.442) [-1573.940] (-1580.826) (-1577.753) * (-1574.001) (-1573.513) (-1576.765) [-1572.802] -- 0:00:33 Average standard deviation of split frequencies: 0.010899 470500 -- (-1573.148) (-1576.576) (-1576.403) [-1574.348] * [-1573.380] (-1574.325) (-1574.359) (-1573.369) -- 0:00:33 471000 -- (-1573.119) [-1575.137] (-1573.568) (-1576.876) * [-1573.612] (-1573.903) (-1576.713) (-1573.369) -- 0:00:33 471500 -- (-1573.391) (-1578.636) [-1575.381] (-1575.633) * (-1573.376) (-1584.141) [-1576.241] (-1573.937) -- 0:00:33 472000 -- (-1576.258) (-1581.433) [-1573.324] (-1578.039) * (-1573.859) (-1576.513) (-1577.113) [-1573.550] -- 0:00:33 472500 -- (-1576.670) (-1576.721) [-1576.905] (-1574.714) * (-1574.592) [-1573.393] (-1576.771) (-1573.960) -- 0:00:33 473000 -- (-1576.808) (-1573.680) [-1574.828] (-1574.860) * (-1574.631) (-1577.768) [-1574.117] (-1576.688) -- 0:00:33 473500 -- (-1575.490) (-1573.678) (-1578.962) [-1574.527] * (-1575.009) [-1573.621] (-1572.840) (-1575.932) -- 0:00:33 474000 -- (-1575.611) (-1573.124) [-1575.971] (-1573.785) * (-1575.304) [-1577.189] (-1574.059) (-1573.786) -- 0:00:33 474500 -- (-1574.838) (-1575.415) [-1575.951] (-1576.864) * (-1575.683) (-1577.007) (-1575.442) [-1578.185] -- 0:00:33 475000 -- (-1576.089) (-1574.894) [-1574.620] (-1574.569) * (-1578.332) [-1575.384] (-1575.626) (-1576.706) -- 0:00:34 Average standard deviation of split frequencies: 0.010428 475500 -- (-1573.417) [-1575.255] (-1576.376) (-1574.751) * (-1580.943) [-1574.030] (-1578.108) (-1579.072) -- 0:00:34 476000 -- (-1573.730) (-1577.596) (-1573.712) [-1575.733] * (-1576.201) [-1575.607] (-1575.188) (-1574.900) -- 0:00:34 476500 -- (-1574.022) (-1576.412) (-1577.152) [-1574.220] * (-1576.287) [-1575.863] (-1576.697) (-1575.743) -- 0:00:34 477000 -- (-1574.029) (-1578.051) [-1575.421] (-1574.069) * (-1576.274) (-1573.830) [-1578.785] (-1576.269) -- 0:00:33 477500 -- (-1573.296) (-1577.387) (-1577.633) [-1573.445] * (-1574.433) (-1576.526) (-1578.125) [-1578.544] -- 0:00:33 478000 -- (-1575.314) (-1573.621) [-1577.952] (-1573.238) * [-1573.860] (-1574.516) (-1573.581) (-1579.718) -- 0:00:33 478500 -- (-1573.503) (-1573.897) [-1573.730] (-1580.449) * [-1574.075] (-1577.237) (-1573.672) (-1577.459) -- 0:00:33 479000 -- [-1573.783] (-1573.621) (-1573.630) (-1577.184) * (-1574.109) [-1576.212] (-1577.636) (-1576.992) -- 0:00:33 479500 -- (-1576.276) (-1574.854) [-1573.477] (-1576.624) * (-1573.946) (-1575.903) [-1574.258] (-1576.070) -- 0:00:33 480000 -- [-1575.961] (-1577.437) (-1574.475) (-1573.632) * (-1573.959) (-1573.956) [-1574.207] (-1573.491) -- 0:00:33 Average standard deviation of split frequencies: 0.010442 480500 -- (-1576.080) (-1577.369) [-1574.978] (-1573.671) * (-1574.354) (-1576.414) (-1573.267) [-1574.845] -- 0:00:33 481000 -- (-1577.415) (-1573.217) [-1574.483] (-1574.183) * (-1573.820) (-1574.610) [-1576.634] (-1574.415) -- 0:00:33 481500 -- (-1576.872) [-1573.823] (-1574.799) (-1580.418) * (-1573.804) (-1574.493) (-1577.526) [-1575.791] -- 0:00:33 482000 -- [-1574.930] (-1575.636) (-1582.952) (-1575.707) * (-1573.736) [-1575.477] (-1575.843) (-1574.402) -- 0:00:33 482500 -- (-1576.632) [-1575.566] (-1576.991) (-1575.301) * (-1573.766) (-1575.751) [-1575.670] (-1574.951) -- 0:00:33 483000 -- (-1577.958) [-1573.876] (-1575.010) (-1576.054) * (-1573.529) (-1576.205) (-1577.484) [-1573.531] -- 0:00:33 483500 -- [-1575.353] (-1577.690) (-1576.024) (-1582.421) * (-1573.977) (-1578.010) (-1575.358) [-1573.412] -- 0:00:33 484000 -- [-1574.207] (-1578.356) (-1577.098) (-1575.295) * (-1578.191) (-1577.207) (-1579.078) [-1573.483] -- 0:00:33 484500 -- (-1574.012) [-1578.520] (-1573.547) (-1574.238) * (-1576.713) (-1577.392) (-1574.148) [-1573.435] -- 0:00:32 485000 -- [-1573.386] (-1579.022) (-1573.175) (-1578.656) * (-1581.550) (-1574.435) (-1576.304) [-1574.207] -- 0:00:32 Average standard deviation of split frequencies: 0.010441 485500 -- (-1576.011) (-1575.177) [-1575.703] (-1577.235) * [-1573.542] (-1575.952) (-1576.084) (-1575.257) -- 0:00:32 486000 -- [-1576.313] (-1573.933) (-1576.200) (-1580.143) * (-1584.285) [-1575.835] (-1575.678) (-1575.724) -- 0:00:32 486500 -- (-1580.028) (-1575.624) (-1575.696) [-1575.844] * [-1576.154] (-1574.463) (-1578.472) (-1574.245) -- 0:00:32 487000 -- [-1578.488] (-1574.787) (-1575.634) (-1574.622) * [-1574.982] (-1578.409) (-1576.245) (-1573.839) -- 0:00:32 487500 -- [-1575.922] (-1575.049) (-1578.518) (-1577.810) * (-1578.321) [-1575.565] (-1577.778) (-1576.096) -- 0:00:32 488000 -- (-1575.571) [-1575.401] (-1576.255) (-1576.045) * (-1576.324) [-1576.702] (-1578.464) (-1576.968) -- 0:00:32 488500 -- (-1575.180) (-1574.494) (-1575.470) [-1574.005] * (-1579.427) [-1577.560] (-1574.401) (-1577.327) -- 0:00:32 489000 -- [-1575.543] (-1574.055) (-1577.588) (-1583.241) * (-1574.703) (-1576.667) (-1575.700) [-1577.215] -- 0:00:32 489500 -- (-1574.292) (-1574.580) [-1578.117] (-1582.585) * (-1575.505) [-1581.444] (-1580.034) (-1576.516) -- 0:00:32 490000 -- (-1574.771) [-1573.814] (-1576.049) (-1581.607) * (-1578.045) (-1579.118) (-1576.321) [-1575.356] -- 0:00:32 Average standard deviation of split frequencies: 0.010455 490500 -- (-1575.914) [-1578.746] (-1575.282) (-1576.572) * [-1576.653] (-1579.641) (-1575.544) (-1578.125) -- 0:00:33 491000 -- (-1573.235) [-1574.194] (-1574.431) (-1574.984) * [-1575.024] (-1575.744) (-1574.181) (-1574.849) -- 0:00:33 491500 -- (-1573.867) [-1578.092] (-1575.065) (-1576.669) * [-1573.719] (-1576.864) (-1575.030) (-1575.752) -- 0:00:33 492000 -- (-1573.426) (-1577.199) (-1575.636) [-1574.587] * (-1574.934) (-1573.806) [-1574.270] (-1575.119) -- 0:00:33 492500 -- (-1574.696) [-1574.349] (-1574.715) (-1577.007) * [-1574.193] (-1574.534) (-1573.660) (-1575.127) -- 0:00:32 493000 -- [-1575.784] (-1574.416) (-1576.248) (-1573.565) * (-1574.603) (-1574.611) [-1574.027] (-1574.606) -- 0:00:32 493500 -- (-1574.323) (-1574.160) [-1576.159] (-1573.047) * (-1575.528) (-1573.989) [-1576.979] (-1573.776) -- 0:00:32 494000 -- (-1575.526) [-1573.825] (-1577.154) (-1575.423) * (-1575.031) (-1574.570) (-1576.473) [-1573.964] -- 0:00:32 494500 -- (-1576.507) [-1575.057] (-1574.647) (-1573.527) * (-1573.873) (-1577.372) (-1574.843) [-1575.547] -- 0:00:32 495000 -- [-1574.467] (-1574.211) (-1579.527) (-1576.525) * (-1573.718) [-1574.098] (-1573.537) (-1581.591) -- 0:00:32 Average standard deviation of split frequencies: 0.010902 495500 -- [-1575.480] (-1572.838) (-1577.019) (-1577.418) * (-1573.960) [-1579.096] (-1575.128) (-1578.746) -- 0:00:32 496000 -- (-1577.536) [-1582.099] (-1575.931) (-1581.081) * (-1575.411) (-1574.430) [-1574.191] (-1579.054) -- 0:00:32 496500 -- (-1574.992) (-1574.291) [-1577.175] (-1574.835) * (-1574.959) [-1576.828] (-1574.545) (-1576.494) -- 0:00:32 497000 -- (-1577.704) (-1577.450) [-1576.029] (-1579.268) * (-1574.394) (-1579.850) [-1576.155] (-1578.751) -- 0:00:32 497500 -- (-1575.418) [-1574.125] (-1577.215) (-1574.584) * (-1573.169) [-1574.447] (-1574.438) (-1574.675) -- 0:00:32 498000 -- (-1577.427) [-1574.654] (-1574.082) (-1574.585) * (-1573.218) [-1573.535] (-1576.467) (-1575.695) -- 0:00:32 498500 -- (-1575.996) (-1573.842) [-1575.589] (-1575.091) * [-1579.090] (-1578.767) (-1574.723) (-1573.496) -- 0:00:32 499000 -- (-1574.584) (-1576.416) (-1578.680) [-1575.274] * [-1574.644] (-1577.618) (-1575.878) (-1575.149) -- 0:00:32 499500 -- (-1574.374) (-1577.412) [-1573.840] (-1574.407) * (-1578.188) (-1580.001) [-1575.807] (-1576.778) -- 0:00:32 500000 -- [-1575.979] (-1574.167) (-1576.309) (-1574.313) * (-1573.612) (-1573.598) (-1575.106) [-1578.064] -- 0:00:32 Average standard deviation of split frequencies: 0.010856 500500 -- (-1575.808) [-1575.008] (-1577.231) (-1575.101) * (-1576.133) (-1574.930) (-1577.884) [-1576.433] -- 0:00:31 501000 -- (-1574.669) [-1573.335] (-1577.043) (-1576.019) * (-1578.429) (-1577.239) (-1574.922) [-1575.747] -- 0:00:31 501500 -- (-1577.324) (-1574.722) [-1575.402] (-1575.451) * (-1577.670) [-1575.248] (-1576.724) (-1577.895) -- 0:00:31 502000 -- (-1574.768) (-1575.881) (-1574.122) [-1575.753] * (-1581.049) [-1576.496] (-1575.647) (-1574.768) -- 0:00:31 502500 -- [-1574.570] (-1575.823) (-1577.661) (-1575.724) * (-1574.090) [-1573.706] (-1574.994) (-1574.571) -- 0:00:31 503000 -- (-1573.825) [-1573.950] (-1574.191) (-1576.593) * (-1573.145) (-1576.784) (-1573.506) [-1574.762] -- 0:00:31 503500 -- (-1578.229) (-1575.502) (-1574.831) [-1576.060] * (-1573.965) (-1577.517) [-1573.889] (-1574.490) -- 0:00:31 504000 -- (-1578.091) (-1576.784) [-1574.442] (-1573.077) * (-1573.963) [-1575.810] (-1575.718) (-1575.101) -- 0:00:31 504500 -- (-1576.080) (-1573.358) [-1574.840] (-1579.495) * (-1578.068) (-1574.549) [-1576.073] (-1575.162) -- 0:00:31 505000 -- (-1575.099) (-1573.354) (-1573.404) [-1574.425] * (-1573.700) (-1574.919) [-1575.876] (-1575.813) -- 0:00:31 Average standard deviation of split frequencies: 0.011234 505500 -- (-1573.780) (-1574.384) [-1575.221] (-1574.425) * (-1573.957) [-1574.909] (-1575.628) (-1573.291) -- 0:00:31 506000 -- [-1573.771] (-1575.166) (-1580.768) (-1575.207) * (-1575.972) (-1578.108) [-1574.668] (-1574.355) -- 0:00:31 506500 -- (-1573.625) (-1574.771) (-1582.502) [-1576.687] * (-1575.534) (-1575.327) (-1573.287) [-1572.940] -- 0:00:32 507000 -- [-1574.568] (-1575.494) (-1575.589) (-1576.646) * (-1576.334) [-1576.679] (-1574.028) (-1573.817) -- 0:00:32 507500 -- [-1573.898] (-1574.341) (-1575.289) (-1575.778) * (-1573.257) (-1577.682) [-1573.990] (-1573.820) -- 0:00:32 508000 -- [-1575.686] (-1579.491) (-1574.038) (-1576.384) * (-1577.152) (-1576.439) (-1578.613) [-1573.499] -- 0:00:31 508500 -- (-1577.007) (-1578.811) [-1574.538] (-1574.453) * (-1577.046) (-1573.660) (-1577.763) [-1573.728] -- 0:00:31 509000 -- (-1578.570) (-1572.943) [-1574.597] (-1574.959) * (-1577.481) (-1574.470) (-1578.088) [-1573.717] -- 0:00:31 509500 -- (-1575.691) (-1573.824) (-1575.763) [-1572.989] * (-1577.069) (-1574.303) (-1584.286) [-1576.722] -- 0:00:31 510000 -- (-1575.037) (-1575.579) (-1579.592) [-1578.200] * [-1576.395] (-1573.847) (-1576.196) (-1577.218) -- 0:00:31 Average standard deviation of split frequencies: 0.011512 510500 -- (-1573.809) (-1574.248) (-1574.704) [-1578.097] * (-1573.867) [-1581.158] (-1576.753) (-1574.561) -- 0:00:31 511000 -- [-1574.039] (-1575.212) (-1577.168) (-1574.740) * (-1578.319) (-1580.372) [-1573.639] (-1574.362) -- 0:00:31 511500 -- (-1574.842) (-1574.547) [-1574.027] (-1578.456) * [-1574.300] (-1574.589) (-1573.804) (-1574.525) -- 0:00:31 512000 -- [-1575.115] (-1575.421) (-1573.985) (-1575.434) * [-1577.297] (-1576.828) (-1574.496) (-1573.725) -- 0:00:31 512500 -- (-1574.034) (-1576.106) (-1574.484) [-1576.870] * (-1574.951) (-1578.459) (-1574.267) [-1575.374] -- 0:00:31 513000 -- (-1577.711) (-1576.550) (-1574.705) [-1573.923] * [-1573.735] (-1574.569) (-1578.995) (-1574.891) -- 0:00:31 513500 -- (-1575.506) [-1576.045] (-1574.687) (-1574.253) * (-1573.699) (-1574.623) [-1576.108] (-1582.039) -- 0:00:31 514000 -- (-1575.921) [-1576.787] (-1575.494) (-1578.542) * (-1573.308) [-1575.962] (-1577.054) (-1579.936) -- 0:00:31 514500 -- (-1580.604) (-1575.916) (-1574.809) [-1573.567] * (-1572.977) (-1580.536) [-1577.348] (-1576.761) -- 0:00:31 515000 -- [-1578.802] (-1578.268) (-1573.679) (-1574.961) * (-1573.344) (-1576.093) (-1573.748) [-1574.792] -- 0:00:31 Average standard deviation of split frequencies: 0.011608 515500 -- [-1577.030] (-1578.210) (-1573.771) (-1575.553) * (-1574.819) (-1578.324) [-1574.312] (-1574.551) -- 0:00:31 516000 -- (-1575.965) (-1578.843) [-1573.993] (-1578.033) * (-1573.088) (-1575.115) (-1575.889) [-1574.023] -- 0:00:30 516500 -- (-1573.409) [-1578.410] (-1573.591) (-1579.865) * [-1574.530] (-1575.251) (-1573.976) (-1574.489) -- 0:00:30 517000 -- [-1573.362] (-1576.805) (-1573.774) (-1573.534) * (-1573.790) (-1574.337) (-1574.101) [-1574.713] -- 0:00:30 517500 -- (-1575.502) (-1575.040) (-1574.533) [-1575.467] * (-1573.539) [-1576.282] (-1574.694) (-1574.065) -- 0:00:30 518000 -- (-1576.447) (-1573.768) (-1576.706) [-1574.759] * (-1575.083) (-1574.677) (-1574.085) [-1573.922] -- 0:00:30 518500 -- [-1574.391] (-1573.690) (-1574.287) (-1578.839) * [-1574.471] (-1573.603) (-1575.534) (-1573.222) -- 0:00:30 519000 -- (-1574.198) [-1585.452] (-1573.631) (-1577.133) * (-1574.274) (-1574.526) [-1577.201] (-1576.654) -- 0:00:30 519500 -- (-1573.491) (-1575.431) [-1574.096] (-1578.927) * (-1575.750) (-1573.259) [-1575.216] (-1577.570) -- 0:00:30 520000 -- (-1573.952) (-1576.427) [-1573.198] (-1580.106) * (-1577.875) (-1574.437) [-1574.735] (-1575.036) -- 0:00:30 Average standard deviation of split frequencies: 0.011983 520500 -- [-1577.925] (-1579.424) (-1580.302) (-1578.215) * (-1574.056) (-1577.710) [-1573.204] (-1574.589) -- 0:00:30 521000 -- (-1575.217) (-1574.232) [-1575.912] (-1574.872) * (-1577.912) [-1576.635] (-1573.127) (-1575.408) -- 0:00:30 521500 -- (-1574.413) (-1573.591) [-1577.029] (-1573.441) * (-1581.383) [-1575.399] (-1575.329) (-1577.578) -- 0:00:31 522000 -- (-1573.022) (-1573.695) [-1575.547] (-1575.079) * (-1573.821) [-1576.320] (-1579.123) (-1574.332) -- 0:00:31 522500 -- [-1575.187] (-1573.829) (-1574.527) (-1579.492) * (-1578.457) (-1573.731) [-1577.340] (-1573.823) -- 0:00:31 523000 -- (-1575.914) (-1577.190) [-1574.761] (-1581.310) * (-1581.628) (-1576.029) (-1576.857) [-1574.833] -- 0:00:31 523500 -- (-1575.247) (-1577.219) (-1575.087) [-1575.338] * (-1575.922) (-1576.287) (-1578.572) [-1573.700] -- 0:00:30 524000 -- (-1576.440) (-1577.233) [-1578.467] (-1575.500) * [-1576.022] (-1577.212) (-1573.878) (-1575.988) -- 0:00:30 524500 -- [-1574.802] (-1574.708) (-1578.132) (-1573.707) * (-1575.274) [-1576.064] (-1572.861) (-1577.374) -- 0:00:30 525000 -- (-1574.933) (-1574.741) (-1578.845) [-1574.495] * (-1575.343) (-1576.110) (-1573.091) [-1573.376] -- 0:00:30 Average standard deviation of split frequencies: 0.011750 525500 -- (-1573.799) (-1574.694) [-1579.555] (-1573.506) * (-1573.730) (-1575.445) [-1573.426] (-1573.246) -- 0:00:30 526000 -- (-1573.900) [-1574.070] (-1575.490) (-1575.159) * (-1574.780) (-1576.190) [-1573.464] (-1573.323) -- 0:00:30 526500 -- (-1575.324) [-1573.594] (-1575.265) (-1574.314) * [-1574.744] (-1574.405) (-1573.921) (-1574.720) -- 0:00:30 527000 -- (-1575.888) (-1575.649) (-1576.083) [-1575.336] * (-1574.628) (-1573.134) (-1578.065) [-1573.753] -- 0:00:30 527500 -- (-1575.606) [-1573.332] (-1576.594) (-1578.868) * (-1573.797) (-1573.280) [-1575.086] (-1573.743) -- 0:00:30 528000 -- (-1576.075) [-1577.133] (-1576.359) (-1577.046) * (-1575.255) (-1573.490) (-1574.589) [-1576.200] -- 0:00:30 528500 -- (-1575.869) (-1575.309) [-1574.941] (-1578.528) * (-1573.932) (-1573.391) [-1576.888] (-1574.700) -- 0:00:30 529000 -- (-1575.018) (-1573.591) [-1575.374] (-1578.257) * [-1574.578] (-1574.011) (-1573.897) (-1575.545) -- 0:00:30 529500 -- (-1576.018) [-1572.888] (-1574.106) (-1574.541) * [-1574.880] (-1574.735) (-1574.327) (-1573.564) -- 0:00:30 530000 -- (-1575.583) [-1572.910] (-1573.654) (-1575.892) * (-1574.021) (-1575.077) (-1575.049) [-1576.714] -- 0:00:30 Average standard deviation of split frequencies: 0.012071 530500 -- (-1575.402) [-1572.970] (-1573.936) (-1574.096) * (-1575.867) (-1576.207) [-1575.179] (-1576.184) -- 0:00:30 531000 -- (-1575.468) (-1574.005) (-1574.362) [-1574.679] * (-1577.499) (-1574.667) (-1577.779) [-1578.466] -- 0:00:30 531500 -- [-1574.356] (-1574.274) (-1577.926) (-1574.772) * [-1576.385] (-1573.161) (-1573.699) (-1584.525) -- 0:00:29 532000 -- (-1577.554) [-1574.467] (-1575.317) (-1575.502) * [-1575.464] (-1580.716) (-1575.645) (-1580.903) -- 0:00:29 532500 -- [-1582.306] (-1577.380) (-1577.461) (-1574.009) * (-1573.521) (-1574.284) [-1574.289] (-1578.765) -- 0:00:29 533000 -- (-1577.497) (-1576.804) (-1575.163) [-1575.798] * (-1574.675) (-1575.549) (-1574.610) [-1573.940] -- 0:00:29 533500 -- (-1575.687) [-1576.439] (-1579.789) (-1573.750) * (-1576.826) (-1576.477) [-1573.589] (-1574.841) -- 0:00:29 534000 -- [-1578.005] (-1576.800) (-1577.576) (-1576.998) * (-1576.252) (-1574.989) [-1575.900] (-1575.110) -- 0:00:29 534500 -- (-1575.734) (-1577.217) (-1575.429) [-1575.201] * (-1576.295) [-1574.604] (-1573.895) (-1575.372) -- 0:00:29 535000 -- (-1575.890) (-1581.148) (-1575.026) [-1575.046] * (-1575.328) [-1573.891] (-1573.768) (-1580.737) -- 0:00:29 Average standard deviation of split frequencies: 0.012106 535500 -- (-1575.741) [-1575.092] (-1574.911) (-1575.866) * (-1573.962) (-1573.852) [-1576.502] (-1577.845) -- 0:00:29 536000 -- (-1575.969) (-1575.553) (-1575.642) [-1578.263] * (-1575.062) (-1573.273) [-1574.384] (-1577.451) -- 0:00:30 536500 -- [-1574.522] (-1576.519) (-1575.475) (-1579.571) * [-1573.547] (-1574.167) (-1575.152) (-1577.330) -- 0:00:30 537000 -- (-1574.010) [-1576.117] (-1575.601) (-1575.586) * (-1573.630) (-1573.161) (-1577.086) [-1579.539] -- 0:00:30 537500 -- [-1576.593] (-1576.281) (-1574.472) (-1574.550) * (-1573.432) (-1576.516) [-1575.910] (-1580.698) -- 0:00:30 538000 -- [-1573.326] (-1576.010) (-1574.944) (-1574.263) * (-1574.904) [-1574.900] (-1574.596) (-1577.531) -- 0:00:30 538500 -- [-1577.092] (-1576.954) (-1575.128) (-1576.248) * [-1575.056] (-1573.282) (-1576.395) (-1574.593) -- 0:00:29 539000 -- (-1573.923) [-1573.508] (-1577.804) (-1575.413) * [-1575.283] (-1575.720) (-1573.408) (-1577.090) -- 0:00:29 539500 -- [-1574.229] (-1574.459) (-1578.184) (-1575.413) * (-1573.443) (-1574.651) [-1575.763] (-1578.333) -- 0:00:29 540000 -- (-1574.966) [-1575.993] (-1575.294) (-1574.613) * (-1573.142) [-1581.103] (-1574.124) (-1577.007) -- 0:00:29 Average standard deviation of split frequencies: 0.012155 540500 -- (-1575.937) (-1575.715) (-1575.502) [-1575.375] * (-1577.959) (-1580.450) (-1574.534) [-1575.079] -- 0:00:29 541000 -- (-1574.130) [-1576.381] (-1575.664) (-1577.505) * [-1574.853] (-1578.912) (-1574.578) (-1577.226) -- 0:00:29 541500 -- (-1574.775) [-1574.989] (-1573.815) (-1580.708) * (-1573.247) (-1575.819) (-1576.874) [-1577.923] -- 0:00:29 542000 -- (-1573.966) (-1580.258) [-1577.419] (-1575.459) * [-1574.498] (-1575.888) (-1573.705) (-1577.484) -- 0:00:29 542500 -- (-1573.608) (-1575.670) [-1576.322] (-1574.596) * (-1573.712) (-1574.680) (-1575.875) [-1578.881] -- 0:00:29 543000 -- (-1574.163) (-1577.586) (-1575.602) [-1574.970] * (-1573.711) [-1578.093] (-1575.805) (-1576.549) -- 0:00:29 543500 -- (-1576.558) (-1578.448) [-1576.808] (-1575.451) * [-1574.636] (-1575.698) (-1575.530) (-1578.219) -- 0:00:29 544000 -- (-1577.776) (-1576.993) [-1575.611] (-1574.808) * [-1576.818] (-1576.592) (-1576.548) (-1577.532) -- 0:00:29 544500 -- (-1576.412) (-1575.817) [-1575.749] (-1575.123) * (-1574.822) (-1573.992) (-1573.692) [-1573.632] -- 0:00:29 545000 -- (-1573.271) (-1575.725) (-1577.174) [-1575.024] * (-1576.434) [-1574.223] (-1574.303) (-1573.187) -- 0:00:29 Average standard deviation of split frequencies: 0.012494 545500 -- [-1573.363] (-1573.443) (-1573.038) (-1575.152) * [-1573.291] (-1573.998) (-1573.813) (-1576.694) -- 0:00:29 546000 -- (-1573.523) [-1577.984] (-1578.542) (-1573.624) * (-1574.242) [-1574.394] (-1577.287) (-1577.008) -- 0:00:29 546500 -- (-1575.129) [-1574.363] (-1573.833) (-1574.506) * (-1574.815) (-1576.365) [-1575.240] (-1574.679) -- 0:00:29 547000 -- [-1573.800] (-1574.327) (-1577.153) (-1574.008) * (-1574.041) (-1575.259) (-1576.345) [-1577.437] -- 0:00:28 547500 -- (-1574.277) (-1573.003) (-1574.322) [-1575.389] * (-1573.954) (-1578.315) [-1575.754] (-1579.063) -- 0:00:28 548000 -- (-1574.613) [-1573.094] (-1575.318) (-1574.995) * [-1573.852] (-1577.636) (-1578.797) (-1579.370) -- 0:00:28 548500 -- (-1578.916) (-1573.994) (-1574.658) [-1574.581] * (-1577.073) (-1577.749) (-1576.645) [-1574.492] -- 0:00:28 549000 -- (-1575.664) (-1575.652) (-1574.988) [-1573.459] * (-1575.488) (-1577.143) [-1577.046] (-1575.836) -- 0:00:28 549500 -- (-1577.372) [-1573.588] (-1576.540) (-1574.468) * (-1575.797) (-1577.690) (-1574.470) [-1577.527] -- 0:00:28 550000 -- (-1579.686) [-1576.810] (-1576.048) (-1577.086) * (-1577.850) [-1577.867] (-1575.203) (-1577.371) -- 0:00:28 Average standard deviation of split frequencies: 0.012460 550500 -- (-1575.820) [-1575.710] (-1580.328) (-1577.099) * (-1575.416) [-1581.011] (-1575.339) (-1574.662) -- 0:00:28 551000 -- (-1577.101) [-1574.370] (-1575.232) (-1575.367) * (-1573.434) [-1574.355] (-1575.040) (-1575.270) -- 0:00:28 551500 -- (-1573.505) (-1580.039) (-1580.155) [-1574.873] * (-1576.494) [-1577.431] (-1574.824) (-1579.212) -- 0:00:29 552000 -- (-1573.307) [-1574.525] (-1574.645) (-1574.488) * [-1575.455] (-1575.338) (-1574.563) (-1577.874) -- 0:00:29 552500 -- (-1575.442) [-1575.198] (-1573.833) (-1573.474) * (-1575.899) [-1574.882] (-1578.802) (-1575.364) -- 0:00:29 553000 -- (-1573.412) (-1574.881) (-1574.082) [-1575.269] * (-1575.563) (-1573.573) (-1577.141) [-1575.272] -- 0:00:29 553500 -- (-1573.514) (-1577.088) (-1575.587) [-1574.998] * (-1573.880) [-1578.027] (-1575.218) (-1579.371) -- 0:00:29 554000 -- (-1573.580) (-1576.555) (-1578.466) [-1577.005] * (-1576.237) (-1574.676) [-1575.132] (-1574.749) -- 0:00:28 554500 -- (-1576.702) [-1579.837] (-1575.046) (-1578.297) * (-1576.193) (-1577.167) (-1575.892) [-1573.280] -- 0:00:28 555000 -- [-1572.882] (-1576.968) (-1575.811) (-1574.148) * (-1578.054) (-1577.670) [-1574.560] (-1573.511) -- 0:00:28 Average standard deviation of split frequencies: 0.011870 555500 -- (-1573.575) (-1577.045) [-1576.951] (-1575.496) * (-1574.061) [-1575.836] (-1578.968) (-1573.824) -- 0:00:28 556000 -- (-1575.067) (-1577.156) [-1574.724] (-1575.047) * (-1574.387) (-1574.056) (-1579.825) [-1575.840] -- 0:00:28 556500 -- (-1573.649) (-1576.389) [-1574.326] (-1580.698) * [-1577.442] (-1575.555) (-1574.419) (-1574.241) -- 0:00:28 557000 -- [-1573.449] (-1576.501) (-1577.738) (-1574.766) * (-1574.535) [-1575.308] (-1575.347) (-1574.440) -- 0:00:28 557500 -- (-1573.442) (-1574.535) (-1577.762) [-1575.511] * (-1574.094) (-1575.115) [-1575.493] (-1575.622) -- 0:00:28 558000 -- (-1574.559) [-1575.902] (-1574.823) (-1576.006) * (-1576.458) [-1573.521] (-1574.427) (-1574.430) -- 0:00:28 558500 -- (-1575.877) (-1574.378) [-1573.604] (-1579.420) * (-1577.989) (-1577.549) [-1574.162] (-1574.997) -- 0:00:28 559000 -- (-1574.664) [-1573.413] (-1573.270) (-1577.304) * (-1580.449) [-1574.344] (-1573.793) (-1576.486) -- 0:00:28 559500 -- [-1575.274] (-1574.504) (-1575.570) (-1576.178) * (-1573.852) [-1574.317] (-1577.016) (-1574.891) -- 0:00:28 560000 -- (-1575.848) (-1575.027) [-1577.087] (-1575.350) * [-1573.513] (-1573.028) (-1576.839) (-1574.232) -- 0:00:28 Average standard deviation of split frequencies: 0.012332 560500 -- (-1575.915) [-1574.326] (-1576.043) (-1578.261) * [-1573.398] (-1574.971) (-1575.215) (-1574.164) -- 0:00:28 561000 -- (-1577.708) [-1579.024] (-1578.554) (-1576.791) * (-1576.341) [-1575.326] (-1578.621) (-1576.071) -- 0:00:28 561500 -- (-1577.955) (-1578.800) (-1575.235) [-1576.178] * (-1575.093) (-1575.091) [-1580.612] (-1573.915) -- 0:00:28 562000 -- (-1574.673) (-1572.822) [-1575.187] (-1573.949) * (-1574.441) (-1576.099) (-1574.344) [-1576.873] -- 0:00:28 562500 -- (-1573.744) (-1578.240) (-1574.738) [-1573.748] * (-1573.627) (-1573.681) (-1574.732) [-1576.775] -- 0:00:28 563000 -- (-1575.670) (-1577.274) [-1574.653] (-1577.548) * (-1577.534) (-1577.441) (-1573.570) [-1574.842] -- 0:00:27 563500 -- (-1576.356) [-1575.981] (-1577.519) (-1576.540) * (-1573.249) [-1576.229] (-1574.423) (-1576.948) -- 0:00:27 564000 -- (-1575.068) (-1575.593) (-1580.712) [-1574.285] * [-1573.414] (-1574.284) (-1575.566) (-1578.042) -- 0:00:27 564500 -- (-1576.125) (-1574.974) [-1575.042] (-1574.834) * (-1574.835) (-1574.107) (-1576.024) [-1575.222] -- 0:00:27 565000 -- (-1575.116) (-1573.281) (-1574.109) [-1576.794] * (-1574.864) (-1574.352) [-1574.683] (-1578.910) -- 0:00:27 Average standard deviation of split frequencies: 0.011967 565500 -- (-1574.262) (-1574.735) [-1574.077] (-1577.577) * (-1576.512) (-1574.873) (-1576.032) [-1575.958] -- 0:00:27 566000 -- (-1574.291) (-1574.645) (-1574.964) [-1574.875] * [-1575.966] (-1576.071) (-1573.724) (-1575.982) -- 0:00:27 566500 -- [-1574.247] (-1575.070) (-1574.745) (-1574.697) * (-1581.475) [-1574.121] (-1574.520) (-1582.893) -- 0:00:27 567000 -- (-1574.818) (-1574.225) (-1574.762) [-1573.180] * (-1574.077) [-1574.488] (-1575.849) (-1574.445) -- 0:00:27 567500 -- [-1574.015] (-1574.370) (-1576.497) (-1575.392) * (-1575.675) (-1574.863) (-1576.304) [-1574.341] -- 0:00:28 568000 -- (-1575.195) [-1575.595] (-1575.278) (-1576.486) * [-1575.280] (-1576.445) (-1575.268) (-1575.002) -- 0:00:28 568500 -- (-1577.206) (-1574.156) (-1576.762) [-1576.376] * [-1573.482] (-1577.415) (-1574.651) (-1574.063) -- 0:00:28 569000 -- (-1575.926) (-1574.159) [-1575.932] (-1576.538) * (-1573.430) (-1574.807) (-1573.514) [-1576.302] -- 0:00:28 569500 -- (-1574.847) (-1579.247) [-1575.855] (-1575.033) * (-1574.479) [-1576.885] (-1574.641) (-1573.544) -- 0:00:27 570000 -- (-1574.766) (-1578.163) (-1576.873) [-1573.242] * [-1577.270] (-1577.143) (-1573.705) (-1574.408) -- 0:00:27 Average standard deviation of split frequencies: 0.012666 570500 -- (-1576.134) [-1573.841] (-1575.873) (-1576.808) * (-1576.885) [-1574.440] (-1574.653) (-1574.578) -- 0:00:27 571000 -- (-1575.801) [-1573.789] (-1573.034) (-1582.552) * [-1575.518] (-1574.976) (-1574.727) (-1573.361) -- 0:00:27 571500 -- [-1573.782] (-1576.678) (-1573.223) (-1576.715) * (-1573.945) (-1574.253) (-1578.858) [-1573.392] -- 0:00:27 572000 -- [-1575.136] (-1574.347) (-1574.157) (-1576.548) * (-1574.015) [-1574.474] (-1575.341) (-1576.071) -- 0:00:27 572500 -- [-1579.378] (-1575.977) (-1573.639) (-1577.243) * (-1573.844) [-1572.863] (-1578.162) (-1575.650) -- 0:00:27 573000 -- (-1579.478) (-1580.409) [-1574.653] (-1575.669) * (-1576.107) (-1573.211) (-1575.654) [-1575.777] -- 0:00:27 573500 -- (-1578.473) [-1574.700] (-1574.266) (-1574.686) * (-1574.254) (-1573.200) (-1573.469) [-1573.329] -- 0:00:27 574000 -- (-1576.024) (-1574.857) [-1573.322] (-1574.400) * (-1575.687) [-1578.001] (-1573.831) (-1575.873) -- 0:00:27 574500 -- (-1573.772) (-1574.011) [-1573.864] (-1575.271) * (-1578.070) (-1575.803) [-1573.881] (-1573.332) -- 0:00:27 575000 -- (-1574.826) [-1575.294] (-1574.028) (-1577.749) * (-1574.241) (-1578.254) [-1574.773] (-1573.044) -- 0:00:27 Average standard deviation of split frequencies: 0.012640 575500 -- (-1576.184) (-1574.314) [-1573.103] (-1575.542) * (-1577.323) (-1577.426) (-1574.995) [-1574.521] -- 0:00:27 576000 -- (-1574.945) (-1573.754) (-1573.783) [-1574.936] * [-1574.045] (-1575.333) (-1575.811) (-1574.119) -- 0:00:27 576500 -- (-1575.728) [-1575.280] (-1573.553) (-1577.123) * (-1573.277) (-1574.467) [-1574.834] (-1574.440) -- 0:00:27 577000 -- (-1574.040) [-1575.113] (-1577.875) (-1578.373) * (-1574.135) (-1573.646) (-1573.726) [-1574.667] -- 0:00:27 577500 -- (-1575.919) [-1576.566] (-1579.938) (-1576.614) * [-1575.386] (-1573.693) (-1576.400) (-1580.927) -- 0:00:27 578000 -- (-1577.039) (-1574.119) [-1576.826] (-1574.085) * (-1574.596) [-1576.105] (-1580.820) (-1576.063) -- 0:00:27 578500 -- [-1577.367] (-1574.209) (-1574.517) (-1576.919) * [-1574.106] (-1579.032) (-1577.415) (-1575.685) -- 0:00:26 579000 -- (-1573.713) (-1573.847) (-1573.555) [-1574.181] * (-1574.576) [-1574.282] (-1578.179) (-1578.967) -- 0:00:26 579500 -- [-1573.965] (-1574.693) (-1573.844) (-1578.932) * (-1578.646) (-1573.847) (-1577.770) [-1575.107] -- 0:00:26 580000 -- (-1574.343) [-1573.745] (-1574.331) (-1576.966) * [-1575.716] (-1574.203) (-1574.670) (-1576.569) -- 0:00:26 Average standard deviation of split frequencies: 0.012674 580500 -- [-1578.338] (-1574.487) (-1573.975) (-1574.586) * (-1576.569) (-1574.408) [-1577.636] (-1575.699) -- 0:00:26 581000 -- (-1574.195) (-1574.907) [-1575.004] (-1574.424) * (-1575.572) (-1576.109) [-1574.353] (-1574.407) -- 0:00:26 581500 -- (-1575.351) [-1574.944] (-1576.283) (-1575.297) * (-1577.709) [-1573.753] (-1573.700) (-1574.300) -- 0:00:26 582000 -- [-1573.641] (-1575.549) (-1575.477) (-1578.697) * (-1575.679) (-1573.253) [-1574.004] (-1574.705) -- 0:00:26 582500 -- (-1574.204) [-1574.729] (-1576.826) (-1576.806) * (-1576.227) [-1573.776] (-1576.467) (-1578.213) -- 0:00:26 583000 -- [-1574.290] (-1575.515) (-1576.345) (-1577.386) * [-1573.430] (-1576.260) (-1573.798) (-1574.081) -- 0:00:27 583500 -- (-1574.562) (-1579.701) (-1573.740) [-1575.547] * [-1574.856] (-1574.728) (-1574.382) (-1573.868) -- 0:00:27 584000 -- (-1573.967) (-1574.166) [-1573.783] (-1573.488) * (-1574.225) [-1575.031] (-1574.259) (-1574.678) -- 0:00:27 584500 -- (-1573.679) (-1578.215) (-1575.095) [-1573.517] * (-1574.397) (-1577.641) (-1576.864) [-1574.604] -- 0:00:27 585000 -- (-1575.592) (-1574.663) (-1577.815) [-1575.328] * [-1574.612] (-1579.945) (-1577.929) (-1575.546) -- 0:00:26 Average standard deviation of split frequencies: 0.012558 585500 -- [-1575.319] (-1574.063) (-1578.580) (-1576.538) * (-1574.235) (-1577.787) (-1579.809) [-1575.470] -- 0:00:26 586000 -- (-1577.807) (-1574.562) [-1574.152] (-1577.827) * (-1577.587) [-1577.553] (-1579.943) (-1575.949) -- 0:00:26 586500 -- (-1575.726) (-1577.082) [-1574.114] (-1579.314) * [-1572.856] (-1578.025) (-1576.755) (-1575.263) -- 0:00:26 587000 -- (-1576.448) (-1573.920) (-1574.734) [-1574.559] * (-1577.828) (-1575.303) [-1574.321] (-1574.882) -- 0:00:26 587500 -- [-1574.148] (-1573.790) (-1574.336) (-1575.025) * (-1573.555) (-1575.333) [-1573.473] (-1575.301) -- 0:00:26 588000 -- (-1576.470) (-1575.548) [-1574.244] (-1574.424) * (-1576.283) [-1576.326] (-1574.059) (-1574.232) -- 0:00:26 588500 -- (-1576.759) (-1574.826) [-1574.609] (-1574.658) * [-1572.874] (-1576.143) (-1573.457) (-1575.966) -- 0:00:26 589000 -- [-1575.770] (-1576.897) (-1575.206) (-1573.748) * [-1574.964] (-1575.357) (-1574.939) (-1575.453) -- 0:00:26 589500 -- (-1576.930) (-1576.120) (-1576.587) [-1574.315] * [-1574.633] (-1577.300) (-1573.590) (-1576.629) -- 0:00:26 590000 -- (-1574.140) (-1575.638) (-1575.298) [-1575.777] * [-1579.510] (-1574.383) (-1573.848) (-1577.898) -- 0:00:26 Average standard deviation of split frequencies: 0.012991 590500 -- [-1574.793] (-1574.274) (-1573.985) (-1573.815) * (-1576.009) (-1578.551) [-1574.649] (-1576.379) -- 0:00:26 591000 -- (-1574.013) (-1574.207) [-1576.426] (-1576.108) * (-1573.839) [-1577.261] (-1576.420) (-1575.186) -- 0:00:26 591500 -- [-1573.244] (-1575.866) (-1580.286) (-1578.482) * (-1577.478) [-1575.508] (-1576.345) (-1573.878) -- 0:00:26 592000 -- (-1573.172) (-1574.312) [-1579.564] (-1580.962) * (-1574.951) [-1575.815] (-1578.112) (-1575.000) -- 0:00:26 592500 -- [-1573.964] (-1577.597) (-1573.100) (-1581.500) * (-1575.531) (-1575.046) [-1575.342] (-1574.830) -- 0:00:26 593000 -- (-1575.417) (-1576.131) (-1575.309) [-1574.652] * (-1575.054) (-1576.564) [-1574.893] (-1578.204) -- 0:00:26 593500 -- (-1573.877) (-1574.158) (-1576.422) [-1574.116] * (-1575.234) (-1576.026) [-1574.482] (-1577.257) -- 0:00:26 594000 -- (-1576.418) [-1573.977] (-1573.246) (-1574.760) * [-1579.925] (-1573.474) (-1574.336) (-1576.753) -- 0:00:25 594500 -- (-1578.566) [-1573.777] (-1573.251) (-1580.489) * (-1574.978) [-1573.425] (-1575.362) (-1577.180) -- 0:00:25 595000 -- (-1575.867) (-1575.064) [-1574.887] (-1576.829) * (-1576.121) [-1574.119] (-1574.885) (-1574.140) -- 0:00:25 Average standard deviation of split frequencies: 0.012831 595500 -- (-1573.346) (-1573.452) (-1572.887) [-1574.458] * (-1576.342) [-1574.165] (-1578.328) (-1582.226) -- 0:00:25 596000 -- [-1575.776] (-1574.669) (-1573.753) (-1574.587) * (-1574.789) [-1575.330] (-1575.475) (-1575.241) -- 0:00:25 596500 -- (-1577.140) (-1575.161) [-1573.840] (-1574.611) * (-1577.785) [-1573.678] (-1577.458) (-1574.979) -- 0:00:25 597000 -- (-1574.366) (-1578.844) [-1575.510] (-1575.471) * [-1577.133] (-1573.539) (-1577.296) (-1574.690) -- 0:00:26 597500 -- (-1575.244) (-1576.028) [-1575.973] (-1575.051) * (-1574.302) (-1573.995) [-1574.232] (-1574.689) -- 0:00:26 598000 -- (-1577.089) [-1574.764] (-1576.124) (-1576.243) * (-1577.623) (-1574.233) [-1574.003] (-1575.061) -- 0:00:26 598500 -- [-1578.882] (-1575.687) (-1576.695) (-1576.444) * (-1577.243) (-1577.155) (-1574.806) [-1577.177] -- 0:00:26 599000 -- (-1575.030) (-1575.495) [-1575.692] (-1575.021) * (-1575.159) [-1575.513] (-1577.067) (-1577.952) -- 0:00:26 599500 -- (-1577.358) [-1576.918] (-1575.712) (-1577.686) * (-1576.522) (-1577.577) [-1575.783] (-1576.447) -- 0:00:26 600000 -- (-1573.839) (-1579.745) (-1574.253) [-1574.149] * (-1575.726) (-1575.561) (-1576.715) [-1578.739] -- 0:00:25 Average standard deviation of split frequencies: 0.012513 600500 -- [-1574.173] (-1577.169) (-1575.016) (-1578.660) * [-1575.142] (-1576.336) (-1574.439) (-1575.430) -- 0:00:25 601000 -- [-1575.537] (-1574.157) (-1575.446) (-1573.086) * (-1576.554) (-1575.826) [-1574.481] (-1575.007) -- 0:00:25 601500 -- (-1576.449) (-1576.743) (-1575.027) [-1573.071] * (-1576.977) [-1573.447] (-1578.901) (-1574.497) -- 0:00:25 602000 -- (-1577.014) [-1582.819] (-1575.857) (-1576.499) * (-1575.456) (-1573.925) (-1573.390) [-1575.218] -- 0:00:25 602500 -- [-1575.052] (-1578.199) (-1575.672) (-1580.087) * (-1573.284) (-1574.496) [-1573.227] (-1576.837) -- 0:00:25 603000 -- (-1575.932) [-1575.825] (-1574.151) (-1580.946) * (-1574.551) (-1575.032) (-1576.213) [-1574.697] -- 0:00:25 603500 -- (-1573.728) [-1575.767] (-1573.528) (-1574.436) * (-1573.963) [-1573.572] (-1576.192) (-1574.697) -- 0:00:25 604000 -- (-1573.648) [-1578.035] (-1575.304) (-1577.731) * (-1574.711) (-1576.212) (-1577.666) [-1577.641] -- 0:00:25 604500 -- [-1573.769] (-1576.194) (-1573.686) (-1575.344) * [-1574.081] (-1575.443) (-1577.072) (-1574.266) -- 0:00:25 605000 -- (-1573.770) (-1577.651) [-1573.731] (-1576.334) * [-1574.174] (-1575.754) (-1575.479) (-1574.312) -- 0:00:25 Average standard deviation of split frequencies: 0.011806 605500 -- (-1575.206) [-1577.789] (-1577.214) (-1577.260) * (-1575.543) (-1578.585) (-1576.983) [-1574.376] -- 0:00:25 606000 -- (-1576.634) [-1577.596] (-1578.095) (-1574.552) * [-1576.140] (-1577.983) (-1573.970) (-1576.072) -- 0:00:25 606500 -- (-1574.206) [-1574.590] (-1574.352) (-1577.133) * [-1576.419] (-1578.263) (-1579.113) (-1577.367) -- 0:00:25 607000 -- (-1574.746) (-1575.291) (-1573.196) [-1574.285] * [-1577.561] (-1575.397) (-1574.396) (-1577.081) -- 0:00:25 607500 -- (-1574.858) [-1574.530] (-1577.481) (-1577.338) * (-1575.130) (-1576.449) [-1575.687] (-1574.806) -- 0:00:25 608000 -- [-1574.769] (-1573.986) (-1575.584) (-1576.954) * (-1574.688) (-1574.151) (-1575.971) [-1575.477] -- 0:00:25 608500 -- (-1574.623) [-1574.546] (-1574.801) (-1575.944) * (-1575.528) [-1574.827] (-1580.845) (-1575.234) -- 0:00:25 609000 -- [-1574.711] (-1573.405) (-1574.094) (-1575.568) * (-1576.407) [-1573.213] (-1580.775) (-1576.925) -- 0:00:25 609500 -- (-1574.468) [-1573.676] (-1578.683) (-1573.429) * (-1575.460) (-1575.486) (-1574.717) [-1575.725] -- 0:00:24 610000 -- [-1577.595] (-1575.819) (-1580.465) (-1573.046) * (-1575.021) (-1576.737) (-1575.472) [-1575.092] -- 0:00:24 Average standard deviation of split frequencies: 0.010979 610500 -- (-1579.298) (-1577.382) [-1577.101] (-1574.433) * [-1573.632] (-1573.915) (-1577.170) (-1577.311) -- 0:00:24 611000 -- [-1580.197] (-1576.494) (-1579.146) (-1574.637) * (-1574.579) (-1574.948) [-1578.578] (-1574.256) -- 0:00:24 611500 -- [-1576.065] (-1581.918) (-1578.050) (-1575.386) * (-1575.457) [-1575.382] (-1575.792) (-1577.091) -- 0:00:24 612000 -- [-1575.005] (-1579.154) (-1575.163) (-1578.672) * [-1576.671] (-1574.575) (-1574.319) (-1575.929) -- 0:00:25 612500 -- (-1578.220) [-1574.682] (-1576.350) (-1576.940) * (-1574.133) (-1575.356) (-1576.190) [-1574.718] -- 0:00:25 613000 -- (-1575.485) [-1576.822] (-1575.163) (-1574.770) * (-1576.148) (-1575.753) (-1577.145) [-1576.040] -- 0:00:25 613500 -- (-1576.993) (-1575.314) [-1574.719] (-1576.755) * (-1578.540) [-1575.263] (-1573.480) (-1579.375) -- 0:00:25 614000 -- (-1580.630) (-1574.611) [-1574.552] (-1577.669) * (-1577.446) (-1574.403) (-1573.538) [-1577.485] -- 0:00:25 614500 -- (-1575.898) [-1576.161] (-1576.475) (-1575.847) * (-1577.226) (-1573.476) [-1576.240] (-1576.807) -- 0:00:25 615000 -- (-1575.528) [-1573.911] (-1575.524) (-1578.034) * (-1577.697) (-1576.633) (-1576.653) [-1576.346] -- 0:00:25 Average standard deviation of split frequencies: 0.010084 615500 -- (-1577.177) [-1573.226] (-1575.958) (-1575.339) * (-1575.548) (-1574.386) [-1578.422] (-1576.359) -- 0:00:24 616000 -- [-1574.005] (-1577.020) (-1581.730) (-1573.771) * (-1575.774) [-1577.380] (-1576.941) (-1575.427) -- 0:00:24 616500 -- (-1574.405) (-1574.086) [-1577.909] (-1574.554) * (-1576.077) (-1576.628) [-1578.031] (-1575.593) -- 0:00:24 617000 -- (-1577.666) (-1574.418) [-1576.032] (-1578.659) * (-1579.248) [-1574.143] (-1576.925) (-1578.834) -- 0:00:24 617500 -- (-1572.832) [-1575.629] (-1576.319) (-1577.616) * (-1577.646) (-1574.143) (-1577.472) [-1575.031] -- 0:00:24 618000 -- (-1573.350) [-1573.181] (-1573.901) (-1581.608) * (-1573.634) (-1581.238) (-1574.956) [-1577.644] -- 0:00:24 618500 -- [-1574.030] (-1576.892) (-1574.075) (-1578.374) * [-1573.321] (-1577.902) (-1574.687) (-1576.286) -- 0:00:24 619000 -- (-1573.842) [-1575.294] (-1574.637) (-1576.693) * (-1574.027) (-1577.317) [-1575.209] (-1575.312) -- 0:00:24 619500 -- (-1573.105) (-1577.066) [-1573.627] (-1578.854) * (-1578.165) (-1574.694) [-1578.711] (-1575.273) -- 0:00:24 620000 -- (-1575.602) (-1582.452) [-1573.362] (-1575.845) * [-1577.395] (-1576.261) (-1575.911) (-1582.196) -- 0:00:24 Average standard deviation of split frequencies: 0.009969 620500 -- (-1575.058) [-1581.420] (-1574.720) (-1575.670) * (-1578.406) [-1575.598] (-1578.307) (-1574.167) -- 0:00:24 621000 -- (-1575.571) [-1577.561] (-1578.520) (-1574.391) * [-1576.690] (-1576.009) (-1579.273) (-1573.753) -- 0:00:24 621500 -- [-1575.806] (-1577.203) (-1575.622) (-1574.899) * (-1578.172) (-1582.074) [-1576.133] (-1574.068) -- 0:00:24 622000 -- (-1576.398) (-1576.247) (-1573.367) [-1574.047] * (-1578.923) [-1576.266] (-1575.405) (-1574.191) -- 0:00:24 622500 -- (-1573.961) [-1574.284] (-1575.042) (-1577.194) * (-1577.997) (-1573.542) (-1573.123) [-1575.654] -- 0:00:24 623000 -- (-1573.405) (-1573.127) (-1575.907) [-1575.192] * [-1573.773] (-1573.332) (-1574.962) (-1578.308) -- 0:00:24 623500 -- (-1573.103) (-1572.999) [-1577.616] (-1573.930) * (-1577.060) (-1573.558) (-1573.546) [-1575.540] -- 0:00:24 624000 -- (-1580.693) (-1575.034) (-1573.537) [-1574.223] * [-1573.946] (-1578.399) (-1573.470) (-1575.614) -- 0:00:24 624500 -- (-1577.713) [-1573.391] (-1575.961) (-1573.924) * (-1573.215) (-1574.309) (-1573.908) [-1573.206] -- 0:00:24 625000 -- [-1575.158] (-1574.479) (-1579.429) (-1573.224) * (-1574.615) (-1580.297) (-1574.304) [-1573.972] -- 0:00:24 Average standard deviation of split frequencies: 0.010144 625500 -- [-1574.188] (-1574.275) (-1574.249) (-1575.673) * (-1579.257) (-1576.397) (-1575.414) [-1574.795] -- 0:00:23 626000 -- (-1574.151) (-1574.771) [-1574.373] (-1576.501) * (-1578.171) (-1574.794) (-1574.809) [-1574.799] -- 0:00:23 626500 -- (-1575.711) (-1575.727) [-1573.862] (-1575.064) * (-1573.752) (-1576.446) [-1578.471] (-1576.880) -- 0:00:23 627000 -- [-1574.748] (-1578.532) (-1575.635) (-1575.242) * (-1573.076) (-1575.456) (-1577.403) [-1575.027] -- 0:00:23 627500 -- (-1574.610) [-1574.784] (-1574.523) (-1574.867) * (-1573.417) (-1575.384) [-1575.909] (-1577.847) -- 0:00:24 628000 -- [-1576.173] (-1574.471) (-1575.087) (-1573.340) * [-1575.600] (-1573.685) (-1575.957) (-1579.035) -- 0:00:24 628500 -- (-1574.445) (-1574.185) [-1575.232] (-1577.298) * (-1574.856) [-1573.898] (-1574.489) (-1573.207) -- 0:00:24 629000 -- [-1574.851] (-1576.518) (-1574.118) (-1575.448) * (-1573.875) [-1573.229] (-1575.307) (-1574.152) -- 0:00:24 629500 -- (-1575.397) (-1574.109) (-1577.441) [-1575.556] * (-1577.773) [-1575.257] (-1573.906) (-1578.307) -- 0:00:24 630000 -- (-1574.857) [-1576.203] (-1574.291) (-1575.946) * (-1577.871) [-1577.136] (-1576.796) (-1576.141) -- 0:00:24 Average standard deviation of split frequencies: 0.010421 630500 -- [-1573.831] (-1575.660) (-1575.578) (-1574.309) * [-1577.605] (-1576.030) (-1574.663) (-1578.959) -- 0:00:24 631000 -- (-1575.268) (-1574.675) [-1574.149] (-1573.633) * [-1573.782] (-1580.443) (-1574.043) (-1573.801) -- 0:00:23 631500 -- (-1575.259) [-1575.392] (-1577.364) (-1573.557) * (-1574.140) (-1580.367) (-1576.648) [-1573.698] -- 0:00:23 632000 -- (-1574.300) (-1573.783) (-1576.400) [-1573.970] * [-1576.470] (-1574.960) (-1578.364) (-1573.785) -- 0:00:23 632500 -- (-1578.252) (-1575.597) [-1576.256] (-1579.207) * (-1574.950) (-1579.989) [-1576.312] (-1576.918) -- 0:00:23 633000 -- (-1578.193) [-1574.328] (-1575.121) (-1575.320) * (-1574.637) (-1574.806) [-1575.757] (-1574.566) -- 0:00:23 633500 -- (-1577.657) [-1575.369] (-1573.743) (-1575.542) * (-1574.216) (-1574.120) (-1576.261) [-1574.633] -- 0:00:23 634000 -- [-1576.171] (-1577.381) (-1573.865) (-1573.917) * [-1575.143] (-1573.383) (-1575.924) (-1575.509) -- 0:00:23 634500 -- (-1576.078) [-1576.964] (-1573.737) (-1574.899) * [-1578.958] (-1573.875) (-1574.366) (-1575.894) -- 0:00:23 635000 -- (-1575.339) [-1575.652] (-1573.134) (-1576.375) * (-1579.585) (-1574.345) (-1576.254) [-1574.658] -- 0:00:23 Average standard deviation of split frequencies: 0.010516 635500 -- (-1575.371) (-1577.616) [-1574.151] (-1574.850) * (-1577.689) (-1576.471) [-1579.003] (-1576.879) -- 0:00:23 636000 -- (-1576.841) (-1574.120) [-1575.396] (-1575.634) * (-1575.504) (-1574.410) (-1576.634) [-1574.919] -- 0:00:23 636500 -- (-1575.412) (-1574.728) (-1575.896) [-1574.875] * [-1576.592] (-1575.692) (-1576.195) (-1574.204) -- 0:00:23 637000 -- (-1574.367) [-1574.380] (-1575.540) (-1578.803) * (-1576.299) (-1573.744) (-1581.116) [-1576.034] -- 0:00:23 637500 -- [-1575.352] (-1577.081) (-1576.224) (-1577.144) * [-1573.599] (-1574.051) (-1576.756) (-1575.503) -- 0:00:23 638000 -- (-1574.261) (-1576.323) (-1577.507) [-1574.570] * (-1573.014) [-1573.048] (-1575.943) (-1575.152) -- 0:00:23 638500 -- (-1573.848) (-1573.186) (-1579.289) [-1578.018] * [-1573.753] (-1577.878) (-1576.672) (-1577.768) -- 0:00:23 639000 -- [-1574.185] (-1575.116) (-1576.665) (-1574.677) * (-1576.298) [-1574.305] (-1575.918) (-1577.514) -- 0:00:23 639500 -- (-1577.682) (-1576.520) [-1577.367] (-1575.435) * [-1576.129] (-1576.997) (-1575.001) (-1579.627) -- 0:00:23 640000 -- (-1575.060) (-1584.687) (-1576.907) [-1577.848] * [-1573.365] (-1575.121) (-1576.554) (-1575.937) -- 0:00:23 Average standard deviation of split frequencies: 0.010163 640500 -- (-1573.893) [-1577.665] (-1577.710) (-1576.045) * (-1573.989) (-1574.623) (-1574.452) [-1574.904] -- 0:00:23 641000 -- (-1574.776) (-1575.657) [-1581.069] (-1578.369) * [-1574.311] (-1574.782) (-1577.442) (-1576.773) -- 0:00:22 641500 -- (-1574.013) [-1573.372] (-1575.338) (-1575.882) * [-1576.053] (-1573.200) (-1577.807) (-1574.398) -- 0:00:22 642000 -- (-1575.361) [-1576.297] (-1579.191) (-1576.889) * [-1576.688] (-1575.621) (-1575.242) (-1575.651) -- 0:00:22 642500 -- (-1573.104) (-1574.437) (-1574.581) [-1575.584] * (-1575.140) (-1574.106) [-1574.108] (-1574.537) -- 0:00:22 643000 -- (-1573.430) (-1574.079) [-1574.361] (-1573.821) * [-1576.716] (-1575.627) (-1573.954) (-1576.356) -- 0:00:23 643500 -- (-1576.506) (-1581.975) [-1573.847] (-1575.564) * (-1573.671) (-1574.093) [-1575.836] (-1576.295) -- 0:00:23 644000 -- (-1575.549) (-1575.465) (-1573.560) [-1575.057] * (-1575.072) [-1574.026] (-1575.581) (-1576.903) -- 0:00:23 644500 -- (-1572.944) (-1575.059) (-1575.771) [-1576.222] * (-1576.485) (-1574.821) (-1575.251) [-1576.307] -- 0:00:23 645000 -- (-1574.592) (-1574.111) (-1578.218) [-1578.462] * [-1574.721] (-1573.877) (-1574.700) (-1586.452) -- 0:00:23 Average standard deviation of split frequencies: 0.010431 645500 -- [-1573.803] (-1575.466) (-1579.032) (-1578.014) * (-1576.297) (-1575.118) [-1574.058] (-1578.450) -- 0:00:23 646000 -- (-1573.300) [-1576.809] (-1576.856) (-1576.446) * (-1576.184) (-1573.055) [-1574.332] (-1575.419) -- 0:00:23 646500 -- (-1573.301) (-1573.748) (-1573.373) [-1574.303] * [-1575.365] (-1575.358) (-1580.083) (-1577.353) -- 0:00:22 647000 -- (-1573.301) (-1573.425) [-1575.107] (-1576.486) * (-1575.158) [-1574.813] (-1579.266) (-1577.313) -- 0:00:22 647500 -- (-1573.255) [-1573.475] (-1578.722) (-1576.015) * (-1574.636) (-1573.074) (-1578.067) [-1574.595] -- 0:00:22 648000 -- (-1576.548) (-1577.721) (-1576.133) [-1575.063] * [-1574.639] (-1573.087) (-1576.267) (-1578.513) -- 0:00:22 648500 -- [-1576.409] (-1574.672) (-1575.290) (-1575.513) * [-1577.107] (-1574.301) (-1573.249) (-1575.365) -- 0:00:22 649000 -- (-1579.700) (-1576.657) (-1576.631) [-1573.988] * [-1575.872] (-1576.712) (-1578.480) (-1573.668) -- 0:00:22 649500 -- (-1576.615) (-1573.664) (-1577.837) [-1574.796] * (-1578.373) (-1576.035) (-1573.995) [-1575.980] -- 0:00:22 650000 -- (-1574.797) (-1573.664) (-1577.245) [-1574.797] * (-1576.066) (-1574.959) [-1573.369] (-1577.915) -- 0:00:22 Average standard deviation of split frequencies: 0.010228 650500 -- (-1575.637) [-1574.622] (-1576.318) (-1576.097) * (-1575.807) [-1575.337] (-1573.735) (-1575.249) -- 0:00:22 651000 -- (-1575.465) (-1574.568) [-1573.829] (-1578.389) * [-1574.477] (-1577.217) (-1573.443) (-1575.817) -- 0:00:22 651500 -- [-1574.529] (-1574.532) (-1573.172) (-1575.115) * (-1575.524) (-1576.779) [-1574.651] (-1580.121) -- 0:00:22 652000 -- [-1575.499] (-1574.273) (-1573.896) (-1576.965) * (-1578.191) (-1575.618) (-1575.881) [-1573.878] -- 0:00:22 652500 -- (-1575.649) (-1577.689) [-1575.574] (-1576.313) * (-1575.093) [-1575.394] (-1575.813) (-1574.324) -- 0:00:22 653000 -- (-1573.553) (-1574.657) (-1576.877) [-1575.698] * [-1573.732] (-1575.417) (-1573.170) (-1573.415) -- 0:00:22 653500 -- (-1575.586) (-1576.098) [-1573.823] (-1575.408) * (-1574.599) (-1575.277) (-1573.549) [-1573.450] -- 0:00:22 654000 -- (-1576.378) (-1574.632) [-1574.541] (-1575.026) * (-1574.256) [-1576.599] (-1574.035) (-1573.958) -- 0:00:22 654500 -- (-1574.420) (-1576.526) (-1576.234) [-1577.207] * (-1574.135) (-1576.052) [-1573.949] (-1573.876) -- 0:00:22 655000 -- (-1574.397) (-1574.888) [-1575.990] (-1578.886) * (-1573.707) [-1576.828] (-1577.700) (-1575.414) -- 0:00:22 Average standard deviation of split frequencies: 0.009746 655500 -- (-1576.038) [-1575.254] (-1577.689) (-1579.153) * (-1573.869) [-1575.924] (-1574.566) (-1580.687) -- 0:00:22 656000 -- [-1575.445] (-1575.255) (-1575.267) (-1577.080) * (-1574.551) [-1574.950] (-1576.661) (-1576.816) -- 0:00:22 656500 -- [-1576.575] (-1577.599) (-1576.137) (-1574.066) * [-1576.694] (-1573.506) (-1573.731) (-1574.855) -- 0:00:21 657000 -- (-1574.090) (-1576.096) [-1574.905] (-1580.924) * (-1574.522) (-1575.065) [-1573.401] (-1578.333) -- 0:00:21 657500 -- [-1574.923] (-1575.868) (-1575.700) (-1574.349) * (-1575.193) (-1579.281) (-1576.407) [-1574.679] -- 0:00:21 658000 -- [-1576.605] (-1574.572) (-1578.918) (-1576.885) * [-1575.169] (-1575.176) (-1573.186) (-1584.223) -- 0:00:21 658500 -- (-1574.254) (-1575.161) (-1576.326) [-1576.823] * [-1575.659] (-1574.807) (-1576.837) (-1575.429) -- 0:00:22 659000 -- [-1574.867] (-1576.331) (-1576.468) (-1578.105) * (-1577.972) (-1575.847) [-1573.980] (-1573.457) -- 0:00:22 659500 -- [-1575.874] (-1576.624) (-1574.669) (-1575.588) * [-1579.038] (-1579.322) (-1575.812) (-1574.364) -- 0:00:22 660000 -- (-1574.805) (-1574.592) [-1574.915] (-1573.823) * (-1573.653) (-1581.794) (-1575.912) [-1574.307] -- 0:00:22 Average standard deviation of split frequencies: 0.010168 660500 -- [-1577.316] (-1574.864) (-1574.148) (-1574.735) * (-1578.148) [-1576.215] (-1576.759) (-1573.437) -- 0:00:22 661000 -- (-1576.252) (-1574.453) (-1573.881) [-1575.622] * (-1575.739) (-1575.250) (-1577.263) [-1574.073] -- 0:00:22 661500 -- (-1575.353) (-1574.871) (-1577.486) [-1574.058] * (-1575.469) (-1579.221) [-1575.836] (-1575.339) -- 0:00:22 662000 -- [-1573.799] (-1577.639) (-1576.248) (-1576.129) * [-1575.578] (-1574.696) (-1575.330) (-1577.504) -- 0:00:21 662500 -- (-1575.033) [-1574.941] (-1574.950) (-1573.371) * (-1578.505) (-1574.109) (-1574.697) [-1574.719] -- 0:00:21 663000 -- (-1575.293) [-1573.543] (-1574.448) (-1573.547) * (-1573.776) (-1574.408) (-1574.183) [-1573.554] -- 0:00:21 663500 -- (-1574.341) [-1574.846] (-1574.026) (-1577.495) * (-1573.726) [-1574.210] (-1574.413) (-1573.563) -- 0:00:21 664000 -- (-1574.201) [-1574.843] (-1573.478) (-1575.430) * (-1574.674) (-1575.907) [-1573.448] (-1573.330) -- 0:00:21 664500 -- (-1578.237) (-1574.547) [-1575.372] (-1579.184) * (-1574.396) [-1574.699] (-1573.892) (-1575.133) -- 0:00:21 665000 -- (-1576.849) [-1574.761] (-1574.600) (-1573.668) * [-1574.590] (-1573.425) (-1576.984) (-1579.576) -- 0:00:21 Average standard deviation of split frequencies: 0.009644 665500 -- [-1574.940] (-1574.107) (-1576.086) (-1573.395) * (-1576.032) (-1573.343) (-1575.115) [-1578.225] -- 0:00:21 666000 -- [-1575.941] (-1573.702) (-1574.939) (-1577.279) * (-1575.697) (-1575.062) (-1577.295) [-1574.144] -- 0:00:21 666500 -- (-1574.259) (-1576.175) (-1577.489) [-1576.042] * (-1574.481) (-1576.346) (-1574.377) [-1573.753] -- 0:00:21 667000 -- (-1574.988) [-1576.117] (-1580.936) (-1576.648) * (-1575.564) (-1574.994) (-1573.962) [-1573.282] -- 0:00:21 667500 -- [-1573.690] (-1576.706) (-1579.754) (-1575.982) * (-1574.922) (-1574.792) (-1575.263) [-1581.903] -- 0:00:21 668000 -- [-1575.634] (-1575.235) (-1577.144) (-1577.599) * [-1576.331] (-1574.535) (-1574.384) (-1575.000) -- 0:00:21 668500 -- [-1576.311] (-1573.468) (-1573.504) (-1579.572) * [-1576.167] (-1579.251) (-1578.204) (-1575.925) -- 0:00:21 669000 -- (-1579.231) [-1577.045] (-1576.620) (-1575.167) * (-1573.751) (-1579.138) [-1574.623] (-1578.630) -- 0:00:21 669500 -- (-1574.863) (-1575.650) [-1573.366] (-1577.676) * (-1574.023) [-1576.177] (-1577.882) (-1581.303) -- 0:00:21 670000 -- (-1579.573) [-1574.593] (-1575.432) (-1574.058) * (-1574.074) [-1573.663] (-1574.349) (-1573.755) -- 0:00:21 Average standard deviation of split frequencies: 0.010016 670500 -- (-1578.206) (-1575.363) [-1573.923] (-1573.988) * (-1573.650) [-1575.283] (-1578.147) (-1574.664) -- 0:00:21 671000 -- [-1573.442] (-1574.817) (-1576.355) (-1573.843) * [-1573.425] (-1574.142) (-1577.938) (-1578.937) -- 0:00:21 671500 -- [-1573.394] (-1575.628) (-1575.392) (-1575.587) * [-1573.093] (-1574.477) (-1575.136) (-1573.850) -- 0:00:21 672000 -- (-1574.933) [-1575.585] (-1576.914) (-1574.468) * (-1578.060) (-1579.491) (-1580.628) [-1573.879] -- 0:00:20 672500 -- (-1573.519) (-1575.147) (-1577.640) [-1577.171] * [-1577.829] (-1574.997) (-1575.026) (-1575.612) -- 0:00:20 673000 -- (-1573.530) (-1576.513) (-1575.021) [-1573.842] * [-1575.441] (-1577.862) (-1577.212) (-1577.394) -- 0:00:20 673500 -- (-1576.513) (-1576.025) [-1576.411] (-1573.781) * [-1575.511] (-1580.571) (-1574.826) (-1579.177) -- 0:00:20 674000 -- [-1577.566] (-1575.013) (-1578.299) (-1575.902) * [-1575.643] (-1575.804) (-1574.520) (-1576.094) -- 0:00:21 674500 -- (-1573.853) (-1575.002) (-1574.331) [-1575.786] * [-1575.404] (-1575.946) (-1577.860) (-1576.740) -- 0:00:21 675000 -- [-1573.540] (-1575.704) (-1573.527) (-1574.073) * (-1575.826) (-1578.764) (-1574.748) [-1577.281] -- 0:00:21 Average standard deviation of split frequencies: 0.009676 675500 -- (-1574.136) (-1576.267) (-1576.757) [-1574.042] * [-1573.677] (-1574.634) (-1574.861) (-1575.029) -- 0:00:21 676000 -- [-1574.340] (-1577.189) (-1577.434) (-1576.224) * (-1574.572) (-1573.928) (-1574.128) [-1577.359] -- 0:00:21 676500 -- (-1574.395) (-1573.841) (-1577.849) [-1575.134] * (-1574.167) [-1573.745] (-1573.496) (-1576.939) -- 0:00:21 677000 -- (-1574.156) (-1573.010) [-1574.370] (-1582.729) * (-1575.347) (-1575.494) (-1573.955) [-1574.671] -- 0:00:20 677500 -- [-1573.065] (-1578.055) (-1577.221) (-1579.789) * (-1576.031) (-1574.904) [-1576.197] (-1583.826) -- 0:00:20 678000 -- [-1573.099] (-1577.084) (-1574.964) (-1574.524) * [-1576.199] (-1574.254) (-1576.182) (-1576.285) -- 0:00:20 678500 -- (-1573.690) (-1577.192) [-1573.522] (-1575.735) * (-1576.823) (-1574.334) [-1574.987] (-1574.704) -- 0:00:20 679000 -- (-1576.213) [-1574.101] (-1574.160) (-1581.733) * (-1574.457) [-1576.543] (-1574.643) (-1574.388) -- 0:00:20 679500 -- (-1577.100) [-1575.052] (-1573.337) (-1574.939) * [-1575.137] (-1578.118) (-1574.680) (-1573.891) -- 0:00:20 680000 -- [-1575.702] (-1575.206) (-1573.457) (-1577.216) * (-1574.301) (-1575.476) [-1577.209] (-1574.093) -- 0:00:20 Average standard deviation of split frequencies: 0.009739 680500 -- (-1574.792) (-1576.655) [-1573.492] (-1577.608) * (-1576.387) [-1575.647] (-1576.671) (-1577.015) -- 0:00:20 681000 -- (-1583.366) (-1575.348) (-1576.754) [-1574.683] * [-1577.199] (-1574.498) (-1574.441) (-1584.200) -- 0:00:20 681500 -- (-1576.949) (-1577.166) (-1577.088) [-1578.543] * [-1574.716] (-1574.869) (-1576.793) (-1576.227) -- 0:00:20 682000 -- (-1575.575) (-1573.675) (-1578.082) [-1573.907] * (-1576.041) (-1576.298) (-1578.706) [-1574.919] -- 0:00:20 682500 -- (-1574.023) (-1577.164) [-1576.024] (-1575.065) * (-1574.843) (-1579.370) (-1579.694) [-1574.453] -- 0:00:20 683000 -- (-1576.218) (-1576.239) (-1574.635) [-1574.325] * (-1575.719) (-1575.245) [-1573.897] (-1574.576) -- 0:00:20 683500 -- [-1573.803] (-1574.695) (-1573.913) (-1576.515) * (-1573.635) (-1573.382) (-1575.187) [-1575.027] -- 0:00:20 684000 -- (-1577.957) (-1576.880) [-1575.475] (-1576.548) * (-1574.907) (-1575.413) (-1574.965) [-1576.505] -- 0:00:20 684500 -- (-1574.732) [-1575.937] (-1574.816) (-1576.026) * (-1576.251) (-1575.352) (-1573.012) [-1575.940] -- 0:00:20 685000 -- [-1575.278] (-1576.619) (-1578.805) (-1574.586) * (-1575.891) (-1575.059) (-1574.177) [-1574.208] -- 0:00:20 Average standard deviation of split frequencies: 0.009663 685500 -- (-1577.429) (-1578.613) (-1573.856) [-1574.610] * (-1576.293) (-1575.060) [-1574.674] (-1574.041) -- 0:00:20 686000 -- (-1574.093) (-1577.377) [-1578.273] (-1574.652) * (-1579.520) (-1575.442) (-1575.400) [-1574.032] -- 0:00:20 686500 -- [-1576.338] (-1575.657) (-1573.173) (-1573.373) * [-1573.653] (-1574.442) (-1575.801) (-1575.270) -- 0:00:20 687000 -- (-1575.057) (-1574.894) [-1574.684] (-1574.563) * (-1573.899) [-1573.170] (-1575.709) (-1578.439) -- 0:00:20 687500 -- (-1575.983) [-1573.834] (-1573.898) (-1574.187) * (-1574.389) [-1573.826] (-1578.071) (-1575.235) -- 0:00:20 688000 -- (-1573.135) (-1573.694) (-1573.925) [-1577.443] * (-1574.336) (-1575.114) [-1576.586] (-1576.274) -- 0:00:19 688500 -- (-1574.965) [-1574.223] (-1576.859) (-1574.676) * (-1574.537) [-1575.330] (-1574.365) (-1575.534) -- 0:00:19 689000 -- [-1577.817] (-1573.617) (-1573.404) (-1574.407) * [-1574.555] (-1576.874) (-1574.707) (-1575.326) -- 0:00:19 689500 -- (-1573.295) [-1573.372] (-1573.163) (-1576.990) * (-1575.768) (-1576.545) (-1577.484) [-1575.600] -- 0:00:20 690000 -- (-1574.311) (-1580.397) [-1575.823] (-1576.211) * [-1575.635] (-1574.631) (-1576.653) (-1576.948) -- 0:00:20 Average standard deviation of split frequencies: 0.009939 690500 -- (-1573.863) (-1577.307) (-1579.284) [-1575.926] * (-1576.630) (-1574.841) [-1573.783] (-1575.018) -- 0:00:20 691000 -- (-1573.372) [-1577.046] (-1578.244) (-1578.811) * (-1573.841) [-1575.487] (-1573.624) (-1574.026) -- 0:00:20 691500 -- (-1572.782) (-1575.799) [-1574.488] (-1577.990) * (-1576.498) (-1575.633) [-1573.703] (-1574.160) -- 0:00:20 692000 -- (-1576.027) [-1574.289] (-1577.953) (-1577.352) * (-1579.681) (-1574.805) (-1574.013) [-1575.945] -- 0:00:20 692500 -- (-1576.681) [-1574.420] (-1578.604) (-1576.099) * (-1573.681) (-1577.099) (-1573.987) [-1574.165] -- 0:00:19 693000 -- (-1578.708) (-1578.609) (-1576.928) [-1574.333] * (-1573.652) (-1577.715) (-1575.423) [-1577.609] -- 0:00:19 693500 -- (-1575.490) [-1577.247] (-1575.390) (-1574.824) * (-1574.685) (-1576.718) (-1575.486) [-1574.539] -- 0:00:19 694000 -- [-1576.717] (-1577.548) (-1574.734) (-1576.512) * (-1575.217) (-1578.735) [-1575.999] (-1574.912) -- 0:00:19 694500 -- (-1575.022) (-1575.263) (-1574.633) [-1578.277] * (-1578.107) (-1577.578) (-1575.069) [-1575.669] -- 0:00:19 695000 -- [-1574.888] (-1576.578) (-1576.755) (-1577.210) * (-1579.258) (-1577.747) (-1575.509) [-1573.392] -- 0:00:19 Average standard deviation of split frequencies: 0.009863 695500 -- (-1576.556) (-1577.574) (-1576.278) [-1574.784] * (-1582.210) (-1574.787) (-1576.750) [-1573.306] -- 0:00:19 696000 -- (-1578.464) (-1574.759) (-1574.368) [-1573.269] * (-1575.079) (-1573.950) (-1579.428) [-1573.375] -- 0:00:19 696500 -- (-1574.885) (-1580.453) [-1578.837] (-1577.847) * (-1576.323) (-1574.762) (-1575.948) [-1575.410] -- 0:00:19 697000 -- (-1576.448) [-1574.733] (-1575.526) (-1574.341) * (-1575.166) (-1577.623) (-1577.159) [-1577.239] -- 0:00:19 697500 -- (-1575.269) (-1574.705) (-1574.265) [-1574.227] * [-1573.600] (-1574.033) (-1573.964) (-1574.682) -- 0:00:19 698000 -- (-1577.363) [-1574.841] (-1574.221) (-1574.760) * [-1574.097] (-1574.475) (-1573.637) (-1578.120) -- 0:00:19 698500 -- (-1575.783) (-1580.088) (-1574.289) [-1574.804] * (-1574.685) (-1577.806) [-1574.126] (-1578.120) -- 0:00:19 699000 -- (-1574.840) (-1576.856) [-1577.460] (-1577.314) * (-1575.080) [-1576.238] (-1574.056) (-1574.981) -- 0:00:19 699500 -- (-1574.480) (-1577.407) [-1575.803] (-1577.283) * [-1576.071] (-1574.545) (-1575.192) (-1579.567) -- 0:00:19 700000 -- (-1574.715) (-1575.474) (-1576.088) [-1576.590] * [-1578.634] (-1579.536) (-1575.704) (-1573.641) -- 0:00:19 Average standard deviation of split frequencies: 0.009125 700500 -- (-1576.115) (-1577.484) (-1575.662) [-1577.059] * (-1576.843) [-1577.483] (-1575.067) (-1575.512) -- 0:00:19 701000 -- (-1577.845) (-1573.797) (-1574.602) [-1576.333] * (-1577.269) (-1576.028) (-1574.360) [-1575.414] -- 0:00:19 701500 -- (-1575.300) (-1573.887) [-1573.735] (-1577.799) * [-1577.991] (-1577.632) (-1578.395) (-1574.238) -- 0:00:19 702000 -- (-1573.423) (-1575.211) [-1573.794] (-1577.114) * (-1575.749) [-1574.447] (-1575.163) (-1576.059) -- 0:00:19 702500 -- [-1576.415] (-1575.351) (-1575.876) (-1577.296) * (-1574.222) (-1574.123) (-1575.172) [-1574.560] -- 0:00:19 703000 -- (-1579.256) [-1575.037] (-1579.601) (-1578.560) * (-1574.249) (-1574.399) [-1573.220] (-1576.172) -- 0:00:19 703500 -- (-1574.304) [-1574.103] (-1580.847) (-1580.026) * (-1576.387) [-1573.514] (-1573.563) (-1578.601) -- 0:00:18 704000 -- (-1575.702) [-1575.199] (-1575.447) (-1578.959) * (-1573.513) (-1574.298) [-1577.877] (-1574.463) -- 0:00:18 704500 -- (-1573.091) (-1576.064) (-1573.897) [-1577.439] * [-1574.848] (-1574.074) (-1573.684) (-1574.013) -- 0:00:18 705000 -- (-1573.029) (-1573.999) (-1574.803) [-1573.121] * (-1578.932) [-1575.797] (-1576.853) (-1578.486) -- 0:00:19 Average standard deviation of split frequencies: 0.009515 705500 -- (-1573.676) (-1577.139) [-1577.942] (-1574.984) * (-1576.155) (-1574.586) [-1575.060] (-1577.459) -- 0:00:19 706000 -- (-1572.820) (-1578.157) [-1575.489] (-1574.966) * (-1577.088) [-1575.181] (-1573.491) (-1573.421) -- 0:00:19 706500 -- [-1575.707] (-1578.830) (-1576.278) (-1573.287) * (-1575.517) (-1579.521) (-1574.503) [-1572.936] -- 0:00:19 707000 -- (-1574.101) (-1573.306) (-1573.227) [-1573.948] * (-1575.642) (-1576.035) (-1574.157) [-1574.112] -- 0:00:19 707500 -- (-1573.948) [-1574.598] (-1574.734) (-1573.754) * (-1576.632) (-1574.388) [-1573.884] (-1575.675) -- 0:00:19 708000 -- (-1574.205) (-1574.603) (-1576.310) [-1574.458] * (-1574.860) [-1575.009] (-1574.788) (-1579.593) -- 0:00:18 708500 -- [-1575.365] (-1574.510) (-1579.328) (-1574.605) * (-1574.127) (-1574.565) [-1576.535] (-1577.395) -- 0:00:18 709000 -- (-1574.067) [-1574.197] (-1577.033) (-1574.863) * (-1574.505) [-1574.849] (-1578.026) (-1577.635) -- 0:00:18 709500 -- [-1578.112] (-1574.645) (-1575.295) (-1576.752) * [-1576.026] (-1576.736) (-1578.941) (-1576.542) -- 0:00:18 710000 -- (-1576.065) (-1575.091) (-1579.769) [-1574.685] * (-1575.719) [-1575.649] (-1576.698) (-1574.989) -- 0:00:18 Average standard deviation of split frequencies: 0.009365 710500 -- (-1575.512) [-1573.766] (-1576.738) (-1577.363) * (-1575.645) (-1578.661) [-1573.837] (-1578.404) -- 0:00:18 711000 -- [-1576.155] (-1583.882) (-1576.000) (-1576.346) * (-1580.332) [-1575.462] (-1576.400) (-1576.628) -- 0:00:18 711500 -- (-1575.120) (-1575.879) [-1574.957] (-1574.589) * [-1577.239] (-1575.728) (-1573.930) (-1576.369) -- 0:00:18 712000 -- [-1575.199] (-1578.926) (-1573.505) (-1577.806) * (-1578.880) (-1582.940) [-1578.034] (-1574.344) -- 0:00:18 712500 -- [-1576.409] (-1578.793) (-1580.168) (-1577.018) * (-1577.358) (-1577.543) [-1574.615] (-1573.704) -- 0:00:18 713000 -- (-1574.571) (-1574.788) [-1576.041] (-1577.143) * (-1575.607) (-1574.155) (-1574.228) [-1573.383] -- 0:00:18 713500 -- (-1579.708) (-1574.317) [-1577.197] (-1573.219) * (-1576.017) (-1574.019) [-1579.147] (-1578.096) -- 0:00:18 714000 -- [-1578.898] (-1574.182) (-1577.661) (-1574.625) * (-1575.282) [-1576.166] (-1574.080) (-1578.133) -- 0:00:18 714500 -- (-1574.341) (-1577.797) [-1576.344] (-1578.665) * (-1572.899) (-1574.181) [-1577.808] (-1582.951) -- 0:00:18 715000 -- (-1575.794) (-1575.244) (-1574.570) [-1578.656] * [-1573.132] (-1576.243) (-1574.642) (-1585.385) -- 0:00:18 Average standard deviation of split frequencies: 0.009256 715500 -- (-1577.178) (-1575.244) (-1576.578) [-1574.363] * (-1574.051) (-1575.925) [-1573.213] (-1577.593) -- 0:00:18 716000 -- [-1574.736] (-1575.639) (-1574.707) (-1576.626) * (-1577.337) [-1576.900] (-1573.134) (-1579.045) -- 0:00:18 716500 -- (-1577.055) (-1576.343) [-1575.049] (-1577.600) * [-1573.693] (-1577.097) (-1573.528) (-1577.789) -- 0:00:18 717000 -- (-1576.730) (-1574.866) [-1574.079] (-1573.996) * (-1573.662) (-1577.070) (-1574.580) [-1573.318] -- 0:00:18 717500 -- (-1576.063) (-1575.250) (-1576.580) [-1573.521] * [-1574.702] (-1579.165) (-1575.036) (-1573.602) -- 0:00:18 718000 -- (-1574.271) [-1573.638] (-1576.719) (-1573.553) * (-1574.194) (-1576.265) [-1573.581] (-1574.742) -- 0:00:18 718500 -- (-1575.067) (-1575.385) [-1574.482] (-1576.534) * [-1574.975] (-1574.641) (-1576.345) (-1573.916) -- 0:00:18 719000 -- (-1574.134) (-1578.257) (-1576.090) [-1574.746] * (-1576.554) [-1575.873] (-1573.697) (-1575.563) -- 0:00:17 719500 -- [-1574.757] (-1576.759) (-1576.819) (-1576.938) * (-1577.834) (-1573.772) (-1575.936) [-1573.955] -- 0:00:17 720000 -- (-1573.789) [-1576.532] (-1576.106) (-1576.448) * [-1573.853] (-1575.444) (-1574.977) (-1574.307) -- 0:00:17 Average standard deviation of split frequencies: 0.009235 720500 -- (-1575.120) (-1575.466) (-1574.906) [-1576.615] * (-1574.162) (-1580.680) [-1575.435] (-1575.886) -- 0:00:18 721000 -- [-1573.736] (-1574.275) (-1576.445) (-1577.343) * (-1577.568) [-1573.522] (-1574.186) (-1574.244) -- 0:00:18 721500 -- (-1577.173) [-1574.251] (-1579.963) (-1575.877) * [-1576.611] (-1573.177) (-1574.380) (-1574.857) -- 0:00:18 722000 -- [-1578.362] (-1576.795) (-1577.035) (-1575.818) * (-1579.055) (-1573.086) (-1575.376) [-1577.104] -- 0:00:18 722500 -- (-1575.644) (-1577.854) [-1575.794] (-1576.125) * (-1578.470) (-1576.102) (-1573.820) [-1575.735] -- 0:00:18 723000 -- [-1573.560] (-1576.749) (-1576.762) (-1576.856) * (-1575.374) (-1579.633) [-1573.218] (-1574.167) -- 0:00:18 723500 -- (-1574.625) (-1575.563) (-1574.683) [-1573.859] * [-1573.261] (-1574.636) (-1574.745) (-1574.237) -- 0:00:17 724000 -- [-1573.770] (-1577.153) (-1575.738) (-1576.039) * [-1574.757] (-1574.339) (-1575.242) (-1573.705) -- 0:00:17 724500 -- (-1574.281) [-1573.400] (-1575.406) (-1574.299) * (-1574.757) (-1574.459) [-1574.870] (-1575.354) -- 0:00:17 725000 -- (-1574.919) [-1574.750] (-1578.120) (-1574.944) * (-1573.456) (-1575.260) [-1573.406] (-1573.970) -- 0:00:17 Average standard deviation of split frequencies: 0.009167 725500 -- (-1574.086) [-1575.250] (-1576.193) (-1573.414) * (-1574.123) (-1575.863) (-1575.863) [-1576.269] -- 0:00:17 726000 -- (-1573.340) (-1575.239) [-1575.994] (-1576.890) * (-1575.406) (-1573.866) [-1575.638] (-1578.698) -- 0:00:17 726500 -- [-1573.512] (-1575.454) (-1576.099) (-1575.428) * (-1573.414) (-1573.611) (-1579.685) [-1576.366] -- 0:00:17 727000 -- (-1574.937) (-1573.978) (-1576.660) [-1576.155] * (-1573.416) (-1573.701) [-1574.524] (-1573.997) -- 0:00:17 727500 -- (-1574.570) (-1575.545) [-1575.445] (-1575.397) * [-1574.303] (-1577.650) (-1576.929) (-1573.514) -- 0:00:17 728000 -- (-1574.261) (-1577.778) [-1573.170] (-1578.594) * (-1574.157) (-1576.124) [-1579.000] (-1574.998) -- 0:00:17 728500 -- (-1575.922) (-1574.550) (-1575.193) [-1576.605] * (-1573.992) (-1576.718) (-1578.477) [-1574.900] -- 0:00:17 729000 -- (-1575.357) [-1578.203] (-1577.692) (-1576.166) * (-1574.255) (-1576.284) (-1576.540) [-1573.581] -- 0:00:17 729500 -- (-1576.898) (-1577.055) (-1573.271) [-1575.185] * (-1575.544) (-1575.986) (-1577.368) [-1573.737] -- 0:00:17 730000 -- (-1582.744) [-1575.202] (-1574.282) (-1575.365) * (-1575.146) (-1577.364) [-1573.684] (-1578.343) -- 0:00:17 Average standard deviation of split frequencies: 0.009298 730500 -- (-1575.621) [-1576.521] (-1578.181) (-1575.099) * (-1573.544) (-1573.649) (-1577.843) [-1573.193] -- 0:00:17 731000 -- [-1573.756] (-1577.182) (-1576.377) (-1574.202) * (-1573.402) (-1576.678) (-1575.621) [-1574.161] -- 0:00:17 731500 -- (-1575.450) [-1575.358] (-1573.808) (-1574.425) * [-1573.356] (-1574.085) (-1575.275) (-1576.885) -- 0:00:17 732000 -- (-1573.884) (-1574.817) [-1573.863] (-1575.542) * [-1577.587] (-1574.719) (-1578.638) (-1579.228) -- 0:00:17 732500 -- (-1574.619) [-1575.809] (-1573.841) (-1575.365) * [-1578.902] (-1575.083) (-1579.688) (-1573.385) -- 0:00:17 733000 -- (-1576.406) (-1577.788) [-1573.580] (-1573.863) * (-1575.782) (-1575.156) (-1574.896) [-1573.386] -- 0:00:17 733500 -- (-1575.807) (-1578.173) [-1573.896] (-1574.932) * (-1574.874) (-1577.372) [-1581.030] (-1573.583) -- 0:00:17 734000 -- (-1575.941) (-1582.265) (-1574.042) [-1573.628] * (-1575.147) (-1577.464) [-1575.765] (-1574.498) -- 0:00:17 734500 -- [-1573.308] (-1590.506) (-1573.547) (-1574.571) * (-1573.410) (-1577.634) [-1575.268] (-1574.900) -- 0:00:16 735000 -- (-1577.525) [-1577.436] (-1574.246) (-1575.620) * (-1574.211) (-1577.023) (-1580.172) [-1574.668] -- 0:00:16 Average standard deviation of split frequencies: 0.008967 735500 -- (-1577.130) (-1573.843) [-1576.515] (-1574.029) * [-1574.797] (-1573.809) (-1575.780) (-1575.577) -- 0:00:16 736000 -- [-1573.443] (-1576.743) (-1582.206) (-1573.185) * (-1574.875) [-1573.660] (-1574.433) (-1580.001) -- 0:00:16 736500 -- (-1580.408) (-1577.759) (-1575.501) [-1573.043] * (-1575.220) (-1575.020) [-1573.441] (-1574.449) -- 0:00:17 737000 -- (-1574.067) (-1578.227) (-1576.553) [-1577.232] * [-1574.354] (-1575.437) (-1573.882) (-1574.192) -- 0:00:17 737500 -- [-1574.553] (-1578.871) (-1576.566) (-1577.487) * (-1575.093) [-1576.773] (-1574.564) (-1574.192) -- 0:00:17 738000 -- (-1574.351) [-1577.181] (-1579.838) (-1575.817) * (-1578.465) (-1578.052) (-1576.361) [-1576.084] -- 0:00:17 738500 -- [-1574.685] (-1577.607) (-1574.063) (-1576.906) * (-1578.840) [-1574.382] (-1573.563) (-1578.903) -- 0:00:16 739000 -- [-1573.696] (-1581.796) (-1575.575) (-1573.980) * (-1574.417) (-1574.790) [-1574.567] (-1575.594) -- 0:00:16 739500 -- (-1574.674) [-1576.922] (-1575.560) (-1574.640) * (-1574.491) (-1577.453) [-1573.686] (-1573.019) -- 0:00:16 740000 -- (-1576.360) (-1575.871) [-1576.654] (-1579.501) * (-1573.977) (-1576.805) [-1574.811] (-1573.048) -- 0:00:16 Average standard deviation of split frequencies: 0.008761 740500 -- (-1573.823) [-1573.608] (-1575.667) (-1576.179) * (-1573.676) (-1577.650) [-1574.382] (-1576.969) -- 0:00:16 741000 -- (-1574.302) (-1577.181) (-1578.380) [-1576.382] * (-1576.417) (-1580.740) (-1573.220) [-1574.065] -- 0:00:16 741500 -- (-1578.386) (-1577.170) [-1573.212] (-1574.988) * (-1576.787) (-1576.458) (-1573.196) [-1574.224] -- 0:00:16 742000 -- (-1574.656) (-1576.874) (-1577.357) [-1575.714] * (-1577.649) [-1574.151] (-1574.602) (-1573.535) -- 0:00:16 742500 -- (-1574.942) [-1577.299] (-1573.944) (-1574.661) * (-1575.238) (-1577.488) (-1577.744) [-1573.968] -- 0:00:16 743000 -- (-1576.099) [-1574.825] (-1580.847) (-1574.120) * (-1575.914) (-1575.510) (-1577.604) [-1573.012] -- 0:00:16 743500 -- (-1579.745) (-1572.740) (-1575.439) [-1576.496] * [-1574.197] (-1573.858) (-1579.039) (-1573.203) -- 0:00:16 744000 -- (-1574.779) (-1576.184) [-1574.997] (-1574.564) * [-1576.209] (-1575.556) (-1575.973) (-1576.069) -- 0:00:16 744500 -- (-1574.879) [-1575.627] (-1575.294) (-1580.298) * (-1576.343) (-1575.271) [-1574.997] (-1575.541) -- 0:00:16 745000 -- (-1574.127) (-1575.638) [-1573.482] (-1573.714) * (-1579.350) (-1574.110) [-1573.843] (-1575.802) -- 0:00:16 Average standard deviation of split frequencies: 0.008587 745500 -- (-1577.170) (-1574.324) [-1575.648] (-1573.940) * [-1575.266] (-1577.023) (-1575.963) (-1573.365) -- 0:00:16 746000 -- (-1575.428) [-1575.181] (-1574.449) (-1573.025) * (-1576.275) [-1573.798] (-1577.003) (-1577.627) -- 0:00:16 746500 -- [-1575.427] (-1573.342) (-1578.251) (-1573.228) * (-1574.772) (-1573.737) [-1574.515] (-1574.988) -- 0:00:16 747000 -- [-1576.406] (-1573.570) (-1575.584) (-1574.395) * (-1577.472) (-1573.892) (-1574.386) [-1576.405] -- 0:00:16 747500 -- (-1577.056) [-1573.391] (-1574.307) (-1575.635) * (-1577.603) (-1574.366) [-1574.856] (-1576.586) -- 0:00:16 748000 -- (-1578.515) (-1574.345) [-1574.635] (-1574.641) * (-1580.875) [-1575.561] (-1574.851) (-1574.172) -- 0:00:16 748500 -- (-1576.389) (-1576.549) (-1576.126) [-1575.292] * (-1579.450) [-1575.408] (-1574.674) (-1576.085) -- 0:00:16 749000 -- [-1573.247] (-1575.376) (-1575.112) (-1575.624) * (-1578.898) (-1576.406) (-1574.145) [-1578.066] -- 0:00:16 749500 -- (-1575.589) (-1574.482) [-1575.088] (-1574.987) * (-1576.997) (-1578.731) [-1574.117] (-1576.786) -- 0:00:16 750000 -- (-1573.522) (-1577.884) [-1573.638] (-1576.415) * (-1575.475) (-1581.024) (-1576.112) [-1578.132] -- 0:00:16 Average standard deviation of split frequencies: 0.008896 750500 -- (-1573.522) (-1579.298) (-1573.955) [-1574.127] * (-1574.028) (-1576.900) [-1577.509] (-1576.483) -- 0:00:15 751000 -- (-1573.567) (-1574.550) (-1575.102) [-1578.527] * (-1574.611) (-1573.213) (-1573.667) [-1573.676] -- 0:00:15 751500 -- [-1573.721] (-1575.309) (-1573.479) (-1577.452) * (-1573.599) [-1573.908] (-1573.746) (-1574.468) -- 0:00:15 752000 -- [-1573.847] (-1576.082) (-1573.536) (-1574.348) * (-1577.714) (-1574.517) [-1572.869] (-1573.205) -- 0:00:15 752500 -- (-1575.256) (-1574.309) [-1575.773] (-1577.286) * (-1573.434) (-1574.196) [-1573.251] (-1574.700) -- 0:00:16 753000 -- (-1575.440) (-1574.391) (-1579.063) [-1575.411] * (-1574.783) [-1574.575] (-1576.494) (-1574.848) -- 0:00:16 753500 -- (-1577.835) (-1574.065) (-1575.610) [-1573.835] * (-1575.528) (-1581.024) (-1575.432) [-1574.257] -- 0:00:16 754000 -- (-1576.299) (-1575.038) (-1574.513) [-1577.350] * [-1576.748] (-1573.138) (-1574.934) (-1575.909) -- 0:00:15 754500 -- (-1575.816) (-1576.852) [-1573.304] (-1576.017) * [-1575.992] (-1573.378) (-1575.426) (-1573.944) -- 0:00:15 755000 -- (-1579.608) [-1574.766] (-1574.215) (-1575.631) * [-1576.259] (-1573.775) (-1573.785) (-1574.485) -- 0:00:15 Average standard deviation of split frequencies: 0.008938 755500 -- (-1578.582) [-1579.037] (-1574.212) (-1574.975) * (-1575.998) (-1573.281) (-1573.774) [-1574.550] -- 0:00:15 756000 -- (-1573.631) (-1576.914) [-1574.943] (-1573.704) * (-1580.235) [-1573.563] (-1574.868) (-1574.448) -- 0:00:15 756500 -- (-1573.583) [-1574.464] (-1573.225) (-1574.365) * (-1577.231) (-1573.563) [-1575.647] (-1574.703) -- 0:00:15 757000 -- [-1573.991] (-1574.130) (-1574.506) (-1577.561) * (-1573.845) (-1574.616) (-1576.166) [-1573.956] -- 0:00:15 757500 -- (-1574.634) (-1575.745) [-1574.540] (-1576.057) * (-1574.909) [-1574.557] (-1576.878) (-1575.905) -- 0:00:15 758000 -- (-1577.150) (-1574.870) [-1573.680] (-1577.681) * [-1578.621] (-1576.768) (-1574.247) (-1574.573) -- 0:00:15 758500 -- (-1573.728) (-1573.682) (-1573.218) [-1578.659] * (-1576.635) (-1574.823) [-1576.496] (-1574.039) -- 0:00:15 759000 -- (-1574.030) (-1574.752) [-1583.506] (-1578.455) * (-1575.747) [-1575.073] (-1577.562) (-1576.881) -- 0:00:15 759500 -- [-1574.826] (-1573.987) (-1574.434) (-1573.722) * (-1574.200) (-1573.838) [-1574.313] (-1576.831) -- 0:00:15 760000 -- (-1574.723) (-1573.588) [-1574.197] (-1576.041) * (-1574.075) (-1575.085) (-1573.459) [-1577.217] -- 0:00:15 Average standard deviation of split frequencies: 0.008848 760500 -- (-1576.013) [-1574.408] (-1578.509) (-1575.209) * [-1573.630] (-1575.676) (-1574.343) (-1578.914) -- 0:00:15 761000 -- (-1574.545) [-1575.612] (-1574.527) (-1574.281) * (-1575.200) (-1575.563) [-1574.989] (-1576.026) -- 0:00:15 761500 -- (-1575.112) (-1573.537) [-1575.687] (-1576.140) * (-1578.673) [-1575.032] (-1575.669) (-1577.453) -- 0:00:15 762000 -- (-1581.757) [-1573.307] (-1577.693) (-1574.320) * [-1577.781] (-1576.102) (-1576.478) (-1575.950) -- 0:00:15 762500 -- (-1574.970) (-1575.455) (-1574.635) [-1576.971] * (-1576.985) (-1575.332) [-1576.990] (-1575.646) -- 0:00:15 763000 -- (-1575.353) (-1576.587) (-1575.231) [-1575.305] * (-1574.873) (-1575.741) [-1575.041] (-1574.036) -- 0:00:15 763500 -- (-1576.520) (-1575.263) (-1573.973) [-1576.427] * (-1575.265) (-1573.426) [-1576.830] (-1578.009) -- 0:00:15 764000 -- (-1575.257) (-1573.704) [-1573.394] (-1577.900) * (-1578.182) (-1574.193) [-1575.045] (-1574.695) -- 0:00:15 764500 -- (-1575.191) [-1573.536] (-1574.255) (-1576.446) * (-1574.499) [-1573.648] (-1573.963) (-1575.639) -- 0:00:15 765000 -- [-1578.187] (-1578.801) (-1576.310) (-1577.156) * (-1576.434) [-1576.774] (-1578.067) (-1574.063) -- 0:00:15 Average standard deviation of split frequencies: 0.008650 765500 -- (-1577.997) (-1577.340) [-1574.333] (-1576.914) * (-1575.035) [-1576.586] (-1577.577) (-1575.308) -- 0:00:15 766000 -- (-1575.347) (-1577.847) (-1575.527) [-1575.778] * (-1575.464) (-1575.876) [-1578.586] (-1577.052) -- 0:00:14 766500 -- (-1579.192) [-1574.276] (-1575.819) (-1576.067) * (-1575.191) (-1576.105) [-1575.557] (-1574.704) -- 0:00:14 767000 -- (-1578.774) (-1575.895) [-1575.480] (-1576.258) * [-1575.753] (-1574.144) (-1574.293) (-1573.270) -- 0:00:14 767500 -- (-1575.093) [-1574.685] (-1574.925) (-1575.638) * [-1575.835] (-1573.841) (-1574.799) (-1576.640) -- 0:00:14 768000 -- (-1573.346) [-1574.688] (-1574.624) (-1575.636) * (-1576.883) [-1573.876] (-1573.585) (-1575.272) -- 0:00:14 768500 -- (-1579.250) (-1574.932) (-1575.777) [-1574.810] * (-1574.639) (-1577.057) (-1574.463) [-1577.042] -- 0:00:15 769000 -- (-1574.627) (-1579.022) (-1575.872) [-1576.542] * (-1573.782) (-1576.439) [-1578.641] (-1573.441) -- 0:00:15 769500 -- (-1577.466) (-1576.125) [-1576.629] (-1575.736) * (-1575.460) (-1576.088) [-1575.279] (-1574.015) -- 0:00:14 770000 -- (-1577.720) (-1575.978) (-1576.077) [-1573.848] * (-1575.746) [-1575.339] (-1574.661) (-1575.567) -- 0:00:14 Average standard deviation of split frequencies: 0.008971 770500 -- (-1574.990) [-1575.738] (-1576.180) (-1575.191) * (-1577.409) [-1575.496] (-1579.733) (-1579.834) -- 0:00:14 771000 -- (-1574.159) (-1577.602) (-1575.433) [-1574.167] * (-1577.950) (-1576.182) [-1576.757] (-1580.354) -- 0:00:14 771500 -- (-1576.534) (-1577.618) (-1574.002) [-1573.412] * (-1578.910) [-1575.015] (-1575.986) (-1573.538) -- 0:00:14 772000 -- (-1574.536) (-1575.404) (-1573.056) [-1573.570] * (-1575.324) [-1573.971] (-1575.394) (-1574.524) -- 0:00:14 772500 -- (-1574.870) (-1576.319) [-1574.353] (-1574.967) * (-1575.827) (-1574.268) (-1577.773) [-1574.388] -- 0:00:14 773000 -- (-1573.703) [-1574.675] (-1578.018) (-1573.658) * [-1573.762] (-1575.731) (-1578.973) (-1573.904) -- 0:00:14 773500 -- (-1574.480) [-1573.164] (-1579.116) (-1578.572) * (-1574.668) (-1574.249) (-1574.441) [-1573.485] -- 0:00:14 774000 -- (-1576.023) (-1574.878) (-1576.317) [-1575.601] * (-1576.971) [-1576.127] (-1574.308) (-1574.029) -- 0:00:14 774500 -- (-1573.873) (-1574.388) (-1575.347) [-1577.218] * [-1575.433] (-1576.140) (-1575.701) (-1575.866) -- 0:00:14 775000 -- (-1575.337) (-1574.698) [-1574.598] (-1574.796) * [-1575.326] (-1574.071) (-1575.667) (-1574.015) -- 0:00:14 Average standard deviation of split frequencies: 0.008943 775500 -- (-1575.340) (-1577.293) (-1574.119) [-1577.934] * [-1573.174] (-1573.886) (-1576.254) (-1577.513) -- 0:00:14 776000 -- (-1576.020) [-1574.350] (-1575.845) (-1578.136) * [-1574.408] (-1576.192) (-1573.535) (-1575.553) -- 0:00:14 776500 -- (-1575.295) (-1574.300) (-1573.281) [-1574.177] * (-1574.706) (-1575.861) (-1573.785) [-1574.835] -- 0:00:14 777000 -- (-1580.054) (-1575.053) (-1573.370) [-1576.608] * (-1577.432) [-1575.376] (-1574.105) (-1577.166) -- 0:00:14 777500 -- (-1575.081) (-1579.731) (-1575.819) [-1576.673] * (-1573.360) [-1576.067] (-1578.570) (-1574.811) -- 0:00:14 778000 -- (-1576.198) (-1576.031) (-1575.705) [-1580.068] * (-1573.882) (-1575.877) (-1574.558) [-1575.750] -- 0:00:14 778500 -- (-1574.648) (-1574.547) (-1574.171) [-1575.514] * (-1578.216) (-1574.947) (-1573.366) [-1575.497] -- 0:00:14 779000 -- (-1577.383) (-1575.295) (-1573.538) [-1574.003] * (-1577.232) [-1574.580] (-1573.432) (-1575.794) -- 0:00:14 779500 -- (-1579.739) (-1575.397) (-1574.397) [-1573.661] * (-1575.567) (-1575.751) [-1573.644] (-1575.468) -- 0:00:14 780000 -- (-1577.667) [-1576.610] (-1577.565) (-1574.318) * (-1575.777) [-1577.323] (-1573.337) (-1573.441) -- 0:00:14 Average standard deviation of split frequencies: 0.009125 780500 -- (-1576.061) [-1574.099] (-1574.567) (-1574.269) * (-1573.277) (-1579.410) (-1573.683) [-1574.091] -- 0:00:14 781000 -- [-1575.853] (-1574.174) (-1573.527) (-1574.702) * [-1574.912] (-1576.709) (-1574.211) (-1572.898) -- 0:00:14 781500 -- [-1575.252] (-1574.764) (-1575.376) (-1574.106) * (-1578.282) (-1575.222) [-1574.155] (-1578.939) -- 0:00:13 782000 -- (-1575.043) [-1578.044] (-1575.974) (-1578.371) * [-1574.696] (-1576.611) (-1576.090) (-1576.080) -- 0:00:13 782500 -- (-1574.729) (-1578.081) (-1575.936) [-1574.623] * (-1573.143) [-1574.915] (-1579.603) (-1577.319) -- 0:00:13 783000 -- (-1576.255) (-1576.627) [-1573.731] (-1575.760) * (-1574.239) (-1576.737) [-1576.655] (-1575.310) -- 0:00:13 783500 -- (-1576.130) (-1578.444) (-1573.152) [-1576.942] * (-1573.235) (-1575.759) [-1574.612] (-1573.971) -- 0:00:13 784000 -- (-1575.560) (-1579.170) [-1573.490] (-1582.092) * [-1573.923] (-1576.162) (-1574.196) (-1575.691) -- 0:00:13 784500 -- (-1575.455) (-1579.233) [-1574.296] (-1577.171) * [-1575.595] (-1578.024) (-1576.947) (-1575.369) -- 0:00:14 785000 -- [-1576.315] (-1574.539) (-1578.736) (-1575.607) * (-1575.720) (-1575.625) (-1575.391) [-1574.246] -- 0:00:13 Average standard deviation of split frequencies: 0.009329 785500 -- [-1575.464] (-1576.053) (-1574.445) (-1576.775) * (-1576.007) (-1577.695) [-1573.846] (-1576.084) -- 0:00:13 786000 -- (-1577.709) (-1575.881) (-1573.676) [-1576.489] * (-1573.285) (-1583.837) [-1575.332] (-1580.792) -- 0:00:13 786500 -- [-1575.598] (-1574.240) (-1575.728) (-1575.188) * (-1574.060) (-1574.051) [-1574.244] (-1575.364) -- 0:00:13 787000 -- (-1575.996) (-1575.124) [-1576.110] (-1574.612) * (-1574.163) (-1575.243) [-1573.583] (-1573.951) -- 0:00:13 787500 -- (-1576.070) (-1574.885) [-1573.878] (-1576.625) * [-1575.548] (-1575.006) (-1575.129) (-1574.969) -- 0:00:13 788000 -- (-1575.184) [-1574.870] (-1578.861) (-1577.856) * (-1575.409) (-1574.613) (-1573.970) [-1573.842] -- 0:00:13 788500 -- (-1576.710) [-1575.281] (-1576.001) (-1580.893) * (-1577.510) (-1576.001) (-1580.343) [-1573.923] -- 0:00:13 789000 -- (-1573.063) (-1575.090) (-1578.251) [-1574.258] * (-1575.902) (-1577.217) (-1577.096) [-1574.704] -- 0:00:13 789500 -- (-1575.452) (-1576.268) (-1574.492) [-1576.012] * (-1576.853) (-1578.293) [-1574.977] (-1575.128) -- 0:00:13 790000 -- (-1581.383) (-1576.814) (-1576.420) [-1575.657] * [-1573.981] (-1578.864) (-1576.042) (-1576.234) -- 0:00:13 Average standard deviation of split frequencies: 0.009606 790500 -- (-1574.746) (-1574.887) [-1573.849] (-1578.059) * (-1576.229) (-1577.542) (-1575.537) [-1577.107] -- 0:00:13 791000 -- (-1573.665) (-1574.272) (-1575.599) [-1573.688] * (-1574.653) (-1575.828) [-1573.062] (-1576.028) -- 0:00:13 791500 -- [-1574.200] (-1575.187) (-1575.215) (-1574.814) * (-1574.138) (-1576.791) [-1574.447] (-1576.488) -- 0:00:13 792000 -- (-1574.661) (-1576.299) [-1574.407] (-1574.179) * (-1574.999) (-1577.410) (-1575.011) [-1573.810] -- 0:00:13 792500 -- (-1573.329) (-1574.991) [-1573.311] (-1576.184) * (-1574.851) (-1575.264) (-1576.647) [-1574.597] -- 0:00:13 793000 -- [-1575.031] (-1578.545) (-1573.671) (-1575.816) * (-1582.590) (-1576.934) (-1573.607) [-1574.639] -- 0:00:13 793500 -- (-1574.952) (-1575.169) [-1574.908] (-1574.195) * (-1579.668) [-1576.319] (-1573.910) (-1574.595) -- 0:00:13 794000 -- [-1574.955] (-1576.386) (-1573.784) (-1574.327) * [-1574.756] (-1577.101) (-1579.048) (-1575.842) -- 0:00:13 794500 -- [-1573.646] (-1577.472) (-1576.001) (-1576.288) * [-1577.139] (-1574.395) (-1574.838) (-1575.986) -- 0:00:13 795000 -- (-1576.221) (-1575.961) (-1575.302) [-1577.163] * (-1579.889) (-1574.501) [-1574.584] (-1574.096) -- 0:00:13 Average standard deviation of split frequencies: 0.009541 795500 -- (-1575.630) (-1580.347) [-1575.042] (-1581.124) * (-1578.970) (-1577.845) [-1574.842] (-1577.519) -- 0:00:13 796000 -- (-1574.019) [-1574.822] (-1575.641) (-1580.282) * (-1578.379) (-1577.558) [-1572.929] (-1575.284) -- 0:00:13 796500 -- (-1576.254) (-1579.711) (-1577.156) [-1573.134] * [-1573.537] (-1574.109) (-1573.043) (-1575.508) -- 0:00:13 797000 -- [-1574.440] (-1578.356) (-1576.820) (-1576.591) * (-1576.329) (-1575.538) (-1574.318) [-1574.563] -- 0:00:12 797500 -- (-1574.234) (-1575.310) (-1579.009) [-1575.443] * (-1575.741) (-1574.534) [-1574.358] (-1575.270) -- 0:00:12 798000 -- [-1574.603] (-1574.809) (-1578.132) (-1580.762) * (-1575.974) (-1573.784) [-1575.926] (-1575.520) -- 0:00:12 798500 -- [-1575.776] (-1574.404) (-1574.166) (-1580.786) * (-1578.608) [-1574.598] (-1575.569) (-1573.865) -- 0:00:12 799000 -- (-1573.874) [-1573.981] (-1574.112) (-1577.402) * (-1572.914) (-1574.887) (-1577.149) [-1574.105] -- 0:00:12 799500 -- (-1575.130) (-1574.049) (-1577.829) [-1573.795] * [-1574.844] (-1578.818) (-1576.020) (-1576.042) -- 0:00:12 800000 -- (-1576.771) (-1575.053) [-1578.137] (-1573.387) * [-1575.717] (-1576.960) (-1572.884) (-1575.245) -- 0:00:12 Average standard deviation of split frequencies: 0.009682 800500 -- (-1574.008) (-1574.815) [-1576.521] (-1576.433) * (-1575.393) [-1575.259] (-1574.700) (-1574.020) -- 0:00:12 801000 -- (-1573.948) (-1578.296) (-1575.227) [-1574.144] * (-1575.820) (-1574.201) [-1573.729] (-1574.021) -- 0:00:12 801500 -- (-1574.402) [-1575.658] (-1575.104) (-1574.765) * (-1580.852) (-1574.687) (-1573.635) [-1579.364] -- 0:00:12 802000 -- [-1574.028] (-1575.158) (-1575.724) (-1574.260) * (-1574.396) [-1575.118] (-1573.183) (-1580.078) -- 0:00:12 802500 -- (-1574.280) (-1574.019) (-1575.797) [-1573.258] * [-1574.549] (-1573.230) (-1573.993) (-1575.170) -- 0:00:12 803000 -- (-1573.814) [-1576.546] (-1580.908) (-1574.257) * (-1573.594) [-1577.247] (-1574.792) (-1573.968) -- 0:00:12 803500 -- (-1575.449) (-1574.957) [-1574.267] (-1575.480) * (-1575.079) (-1581.564) [-1575.111] (-1573.816) -- 0:00:12 804000 -- (-1574.878) (-1574.956) [-1573.867] (-1575.173) * (-1578.743) (-1576.082) (-1575.257) [-1575.439] -- 0:00:12 804500 -- (-1577.617) (-1574.034) (-1580.452) [-1576.848] * (-1575.639) (-1575.088) (-1575.114) [-1575.080] -- 0:00:12 805000 -- (-1574.233) [-1574.201] (-1576.270) (-1577.407) * [-1574.468] (-1577.216) (-1573.387) (-1575.233) -- 0:00:12 Average standard deviation of split frequencies: 0.009585 805500 -- [-1574.783] (-1576.952) (-1575.674) (-1578.411) * [-1574.701] (-1573.439) (-1573.991) (-1574.553) -- 0:00:12 806000 -- (-1574.625) (-1574.166) (-1576.903) [-1576.937] * (-1575.570) [-1575.658] (-1576.753) (-1574.966) -- 0:00:12 806500 -- (-1576.552) (-1574.237) [-1575.962] (-1573.860) * (-1572.992) (-1574.027) (-1575.675) [-1575.581] -- 0:00:12 807000 -- [-1575.783] (-1577.226) (-1576.760) (-1576.380) * (-1573.128) (-1574.347) (-1573.075) [-1574.608] -- 0:00:12 807500 -- (-1574.254) (-1574.756) (-1576.190) [-1576.750] * [-1574.435] (-1574.596) (-1573.486) (-1578.204) -- 0:00:12 808000 -- [-1572.847] (-1574.075) (-1574.316) (-1575.940) * [-1574.881] (-1573.972) (-1574.283) (-1579.140) -- 0:00:12 808500 -- (-1573.207) (-1576.464) (-1575.113) [-1577.722] * (-1575.231) (-1577.197) [-1574.300] (-1579.260) -- 0:00:12 809000 -- [-1573.499] (-1577.277) (-1573.305) (-1576.788) * (-1573.800) (-1578.776) (-1575.858) [-1576.758] -- 0:00:12 809500 -- (-1576.984) [-1576.896] (-1575.911) (-1574.796) * (-1576.554) (-1574.743) (-1574.189) [-1576.304] -- 0:00:12 810000 -- (-1581.216) [-1577.850] (-1575.664) (-1575.504) * [-1574.728] (-1579.446) (-1573.789) (-1575.710) -- 0:00:12 Average standard deviation of split frequencies: 0.009789 810500 -- [-1573.159] (-1578.083) (-1576.435) (-1576.323) * [-1576.005] (-1574.554) (-1576.245) (-1576.178) -- 0:00:12 811000 -- [-1575.420] (-1577.330) (-1578.349) (-1574.836) * (-1579.323) [-1574.048] (-1574.391) (-1576.251) -- 0:00:12 811500 -- (-1574.636) [-1575.539] (-1575.855) (-1573.998) * (-1574.665) [-1573.663] (-1578.461) (-1573.665) -- 0:00:12 812000 -- [-1574.508] (-1574.413) (-1577.905) (-1575.581) * (-1575.481) (-1574.844) (-1574.325) [-1575.461] -- 0:00:12 812500 -- (-1574.864) [-1573.978] (-1580.441) (-1578.209) * [-1576.658] (-1573.068) (-1578.659) (-1576.725) -- 0:00:12 813000 -- (-1573.967) (-1574.153) (-1574.383) [-1574.846] * (-1574.872) [-1573.898] (-1575.362) (-1574.977) -- 0:00:11 813500 -- (-1573.694) (-1576.410) (-1575.819) [-1574.334] * (-1576.449) (-1578.564) (-1575.863) [-1574.398] -- 0:00:11 814000 -- [-1576.082] (-1576.298) (-1573.297) (-1575.223) * [-1575.766] (-1575.788) (-1573.612) (-1573.890) -- 0:00:11 814500 -- (-1575.806) [-1573.646] (-1573.896) (-1575.250) * [-1574.613] (-1575.205) (-1574.654) (-1577.435) -- 0:00:11 815000 -- (-1575.293) (-1573.242) [-1575.956] (-1575.151) * (-1574.082) (-1576.322) (-1573.807) [-1574.859] -- 0:00:11 Average standard deviation of split frequencies: 0.009372 815500 -- (-1576.778) (-1573.700) [-1574.692] (-1574.363) * (-1574.067) (-1575.648) [-1574.107] (-1574.367) -- 0:00:11 816000 -- (-1575.437) [-1574.544] (-1575.294) (-1578.351) * (-1573.623) (-1574.270) [-1575.101] (-1573.985) -- 0:00:11 816500 -- (-1577.820) (-1576.280) [-1576.701] (-1573.786) * [-1574.463] (-1573.923) (-1575.479) (-1576.287) -- 0:00:11 817000 -- (-1575.867) (-1576.804) [-1572.880] (-1573.851) * [-1574.434] (-1575.348) (-1572.933) (-1575.709) -- 0:00:11 817500 -- (-1573.775) [-1574.777] (-1576.716) (-1578.405) * (-1576.094) (-1577.558) [-1574.920] (-1575.645) -- 0:00:11 818000 -- (-1573.997) [-1573.927] (-1575.958) (-1578.307) * (-1573.504) (-1575.602) (-1579.187) [-1577.637] -- 0:00:11 818500 -- [-1574.605] (-1573.851) (-1575.624) (-1574.787) * (-1574.759) [-1574.953] (-1579.272) (-1575.402) -- 0:00:11 819000 -- [-1573.933] (-1573.956) (-1577.113) (-1573.611) * (-1575.353) [-1575.267] (-1573.937) (-1576.400) -- 0:00:11 819500 -- (-1574.307) [-1574.277] (-1576.804) (-1573.363) * (-1574.263) (-1576.691) [-1574.580] (-1577.226) -- 0:00:11 820000 -- (-1574.000) (-1577.403) [-1574.812] (-1576.660) * (-1578.420) (-1576.235) (-1575.561) [-1574.287] -- 0:00:11 Average standard deviation of split frequencies: 0.009223 820500 -- (-1576.417) (-1574.527) [-1575.108] (-1577.872) * [-1574.850] (-1576.369) (-1574.236) (-1575.777) -- 0:00:11 821000 -- (-1575.153) (-1573.915) (-1574.702) [-1573.573] * (-1574.990) (-1575.753) [-1577.273] (-1574.940) -- 0:00:11 821500 -- (-1574.502) (-1574.870) (-1574.195) [-1573.182] * (-1577.325) (-1576.626) [-1577.551] (-1574.349) -- 0:00:11 822000 -- (-1574.515) (-1574.480) (-1576.953) [-1574.296] * (-1575.475) [-1576.360] (-1574.985) (-1573.697) -- 0:00:11 822500 -- (-1573.166) (-1574.711) [-1576.279] (-1574.669) * (-1573.868) (-1577.538) (-1574.213) [-1578.326] -- 0:00:11 823000 -- [-1577.241] (-1573.471) (-1575.855) (-1573.614) * (-1577.091) (-1578.831) [-1576.265] (-1577.118) -- 0:00:11 823500 -- (-1573.054) (-1574.765) [-1574.532] (-1574.297) * (-1574.123) [-1583.260] (-1576.234) (-1574.723) -- 0:00:11 824000 -- (-1572.965) (-1576.423) (-1574.910) [-1575.519] * (-1574.040) [-1578.764] (-1576.138) (-1575.087) -- 0:00:11 824500 -- (-1577.101) (-1578.665) [-1576.284] (-1574.508) * [-1574.846] (-1574.416) (-1575.013) (-1575.625) -- 0:00:11 825000 -- (-1576.965) (-1576.800) [-1576.794] (-1574.022) * [-1574.466] (-1576.428) (-1576.015) (-1575.557) -- 0:00:11 Average standard deviation of split frequencies: 0.009417 825500 -- (-1573.803) (-1574.016) [-1575.878] (-1575.662) * (-1574.592) (-1576.531) (-1573.948) [-1574.246] -- 0:00:11 826000 -- (-1577.099) (-1573.760) (-1575.137) [-1575.460] * (-1576.321) [-1577.215] (-1573.603) (-1575.961) -- 0:00:11 826500 -- (-1576.250) [-1574.465] (-1573.809) (-1579.196) * (-1575.839) (-1578.408) [-1574.147] (-1574.869) -- 0:00:11 827000 -- (-1577.088) [-1573.871] (-1573.453) (-1576.479) * [-1575.579] (-1576.700) (-1575.521) (-1577.220) -- 0:00:11 827500 -- (-1580.061) (-1575.009) (-1573.733) [-1576.235] * (-1575.113) (-1577.517) [-1574.649] (-1577.302) -- 0:00:11 828000 -- (-1574.766) [-1574.123] (-1575.435) (-1574.950) * (-1575.301) (-1578.351) (-1574.459) [-1576.480] -- 0:00:11 828500 -- (-1573.009) (-1574.962) [-1576.556] (-1574.425) * (-1574.358) (-1579.039) (-1575.687) [-1574.527] -- 0:00:10 829000 -- (-1579.486) (-1573.422) (-1576.238) [-1573.501] * (-1572.988) (-1574.963) [-1574.721] (-1576.415) -- 0:00:10 829500 -- (-1577.586) (-1574.353) (-1574.771) [-1573.728] * (-1573.831) (-1576.218) (-1574.164) [-1577.922] -- 0:00:10 830000 -- (-1579.172) [-1573.480] (-1573.905) (-1576.322) * [-1574.121] (-1573.095) (-1573.778) (-1580.832) -- 0:00:10 Average standard deviation of split frequencies: 0.009458 830500 -- (-1574.783) (-1577.894) (-1574.101) [-1575.151] * (-1573.857) [-1577.324] (-1576.949) (-1574.879) -- 0:00:10 831000 -- [-1573.815] (-1573.821) (-1573.824) (-1573.809) * (-1580.020) (-1579.957) [-1575.806] (-1575.639) -- 0:00:10 831500 -- (-1573.150) (-1574.103) (-1576.546) [-1574.746] * (-1580.126) (-1578.733) [-1576.292] (-1574.978) -- 0:00:10 832000 -- (-1575.140) (-1573.531) (-1576.543) [-1575.456] * [-1577.205] (-1574.003) (-1576.773) (-1575.894) -- 0:00:10 832500 -- (-1575.138) (-1580.008) [-1574.494] (-1573.679) * (-1577.571) (-1577.679) [-1577.002] (-1577.749) -- 0:00:10 833000 -- (-1575.822) (-1577.525) (-1575.761) [-1573.779] * (-1577.312) [-1574.738] (-1575.181) (-1576.222) -- 0:00:10 833500 -- (-1576.115) [-1577.505] (-1575.788) (-1573.427) * (-1576.896) [-1575.915] (-1573.326) (-1574.665) -- 0:00:10 834000 -- (-1576.967) (-1576.930) [-1574.367] (-1573.417) * (-1574.983) [-1574.404] (-1574.297) (-1574.400) -- 0:00:10 834500 -- [-1578.410] (-1575.764) (-1577.306) (-1573.642) * (-1575.977) [-1575.491] (-1575.203) (-1573.482) -- 0:00:10 835000 -- (-1574.148) (-1574.807) [-1574.282] (-1577.674) * (-1574.337) (-1578.677) [-1573.476] (-1576.474) -- 0:00:10 Average standard deviation of split frequencies: 0.009931 835500 -- (-1573.930) [-1575.098] (-1575.117) (-1575.462) * (-1577.683) (-1578.269) [-1573.706] (-1576.282) -- 0:00:10 836000 -- [-1575.869] (-1573.966) (-1574.591) (-1576.011) * [-1574.843] (-1574.389) (-1574.387) (-1576.202) -- 0:00:10 836500 -- [-1574.379] (-1574.480) (-1574.669) (-1575.241) * (-1577.645) [-1574.207] (-1573.906) (-1579.557) -- 0:00:10 837000 -- (-1574.570) [-1576.170] (-1573.392) (-1575.829) * [-1573.599] (-1573.736) (-1576.163) (-1574.850) -- 0:00:10 837500 -- (-1577.259) (-1577.546) [-1573.710] (-1574.796) * [-1575.211] (-1575.394) (-1575.413) (-1575.162) -- 0:00:10 838000 -- (-1575.121) (-1580.471) [-1574.631] (-1577.190) * (-1573.404) [-1574.125] (-1574.290) (-1577.876) -- 0:00:10 838500 -- (-1574.717) (-1576.548) (-1574.096) [-1575.843] * (-1579.433) [-1578.728] (-1577.481) (-1576.635) -- 0:00:10 839000 -- (-1573.312) (-1579.057) [-1574.133] (-1575.803) * (-1578.346) [-1575.484] (-1577.328) (-1575.890) -- 0:00:10 839500 -- (-1572.922) (-1575.901) (-1574.969) [-1574.647] * (-1576.980) (-1577.315) [-1575.142] (-1575.273) -- 0:00:10 840000 -- (-1575.547) (-1577.218) [-1575.597] (-1574.226) * [-1575.109] (-1574.504) (-1574.487) (-1576.581) -- 0:00:10 Average standard deviation of split frequencies: 0.010249 840500 -- (-1576.061) (-1573.821) [-1579.549] (-1573.983) * (-1575.152) (-1576.193) [-1576.115] (-1574.949) -- 0:00:10 841000 -- (-1574.400) (-1573.615) (-1578.787) [-1574.867] * (-1576.313) [-1573.300] (-1581.252) (-1578.017) -- 0:00:10 841500 -- (-1573.824) [-1576.949] (-1578.910) (-1574.094) * (-1577.085) [-1575.364] (-1575.555) (-1576.808) -- 0:00:10 842000 -- (-1574.438) (-1574.100) [-1576.404] (-1573.487) * (-1578.364) (-1575.796) [-1575.163] (-1578.185) -- 0:00:10 842500 -- [-1575.027] (-1573.513) (-1575.786) (-1575.616) * [-1577.579] (-1575.986) (-1575.322) (-1576.125) -- 0:00:10 843000 -- [-1577.387] (-1575.993) (-1576.160) (-1576.829) * (-1575.326) (-1574.054) [-1575.564] (-1576.766) -- 0:00:10 843500 -- (-1576.678) (-1574.693) [-1575.174] (-1574.675) * (-1574.424) [-1574.915] (-1576.943) (-1574.776) -- 0:00:10 844000 -- (-1576.194) (-1575.461) (-1575.183) [-1574.992] * [-1574.907] (-1574.490) (-1574.632) (-1573.306) -- 0:00:09 844500 -- [-1574.818] (-1579.222) (-1577.339) (-1576.992) * [-1575.205] (-1577.422) (-1573.287) (-1575.837) -- 0:00:09 845000 -- [-1574.951] (-1579.306) (-1575.515) (-1579.462) * (-1579.387) [-1576.711] (-1573.110) (-1575.265) -- 0:00:09 Average standard deviation of split frequencies: 0.010123 845500 -- (-1573.878) (-1574.877) (-1576.254) [-1574.186] * (-1575.397) (-1575.324) [-1574.913] (-1575.561) -- 0:00:09 846000 -- (-1574.426) (-1575.765) (-1575.947) [-1573.705] * (-1574.342) (-1576.078) (-1578.677) [-1577.364] -- 0:00:09 846500 -- [-1575.285] (-1575.627) (-1574.305) (-1573.757) * (-1574.230) (-1576.308) (-1575.538) [-1575.008] -- 0:00:09 847000 -- (-1575.004) (-1573.830) [-1575.011] (-1573.377) * (-1574.011) (-1575.089) [-1577.175] (-1574.403) -- 0:00:09 847500 -- [-1578.953] (-1575.661) (-1578.578) (-1574.948) * [-1573.958] (-1577.893) (-1576.551) (-1573.467) -- 0:00:09 848000 -- [-1573.963] (-1575.998) (-1578.602) (-1574.390) * (-1574.237) (-1573.934) (-1573.802) [-1575.313] -- 0:00:09 848500 -- (-1579.159) (-1573.540) (-1579.482) [-1573.246] * (-1577.213) [-1579.895] (-1575.057) (-1576.412) -- 0:00:09 849000 -- (-1577.674) [-1574.225] (-1576.217) (-1573.867) * (-1573.046) (-1573.418) (-1575.998) [-1575.246] -- 0:00:09 849500 -- (-1575.722) (-1574.098) [-1576.430] (-1574.171) * (-1578.209) [-1575.322] (-1573.871) (-1574.619) -- 0:00:09 850000 -- (-1577.348) (-1574.986) (-1580.480) [-1573.152] * (-1573.455) [-1578.055] (-1573.881) (-1574.812) -- 0:00:09 Average standard deviation of split frequencies: 0.010129 850500 -- [-1575.176] (-1576.482) (-1573.424) (-1574.705) * [-1573.098] (-1575.620) (-1573.359) (-1575.195) -- 0:00:09 851000 -- (-1576.216) [-1574.959] (-1576.220) (-1579.130) * (-1573.266) (-1578.358) (-1575.292) [-1575.460] -- 0:00:09 851500 -- [-1574.451] (-1575.099) (-1576.048) (-1573.471) * (-1575.405) (-1577.935) (-1576.504) [-1578.263] -- 0:00:09 852000 -- (-1574.552) [-1574.860] (-1579.889) (-1580.338) * (-1576.886) (-1577.479) (-1577.074) [-1574.810] -- 0:00:09 852500 -- [-1573.786] (-1574.619) (-1575.607) (-1576.124) * (-1576.950) (-1576.493) (-1574.596) [-1573.799] -- 0:00:09 853000 -- (-1573.321) [-1576.002] (-1575.039) (-1575.748) * (-1575.758) [-1573.018] (-1574.280) (-1575.326) -- 0:00:09 853500 -- (-1573.382) (-1574.361) (-1574.622) [-1577.271] * (-1575.900) [-1573.987] (-1576.702) (-1573.764) -- 0:00:09 854000 -- (-1573.450) [-1574.311] (-1577.186) (-1577.915) * (-1573.835) (-1573.790) (-1576.285) [-1575.143] -- 0:00:09 854500 -- (-1574.356) (-1573.778) [-1574.994] (-1574.266) * (-1573.240) (-1574.491) [-1573.881] (-1575.201) -- 0:00:09 855000 -- (-1581.220) (-1576.303) [-1574.285] (-1574.973) * (-1575.340) (-1573.717) (-1575.296) [-1576.921] -- 0:00:09 Average standard deviation of split frequencies: 0.010127 855500 -- (-1576.965) (-1576.210) [-1573.916] (-1574.885) * (-1578.212) (-1578.859) [-1574.840] (-1576.224) -- 0:00:09 856000 -- (-1579.061) (-1573.424) (-1573.656) [-1573.258] * (-1575.993) [-1578.129] (-1575.603) (-1575.780) -- 0:00:09 856500 -- (-1579.415) (-1574.388) [-1573.979] (-1577.617) * (-1572.899) (-1573.803) (-1575.944) [-1574.424] -- 0:00:09 857000 -- (-1576.505) (-1573.809) [-1576.037] (-1576.203) * (-1575.968) [-1575.059] (-1576.036) (-1574.624) -- 0:00:09 857500 -- (-1574.696) (-1575.420) [-1573.141] (-1575.744) * (-1574.595) (-1573.868) [-1575.027] (-1573.668) -- 0:00:09 858000 -- (-1573.594) [-1577.871] (-1572.946) (-1577.018) * (-1573.112) [-1574.649] (-1574.504) (-1577.470) -- 0:00:09 858500 -- [-1574.038] (-1573.768) (-1574.983) (-1579.676) * (-1574.921) (-1575.468) [-1573.889] (-1577.334) -- 0:00:09 859000 -- (-1575.516) (-1573.863) (-1575.390) [-1577.572] * (-1577.283) (-1577.133) (-1576.105) [-1579.942] -- 0:00:09 859500 -- (-1579.481) (-1575.496) (-1577.618) [-1576.497] * [-1577.777] (-1574.099) (-1578.356) (-1578.752) -- 0:00:08 860000 -- (-1580.273) (-1573.776) [-1574.727] (-1574.542) * (-1575.759) (-1577.104) [-1576.474] (-1578.294) -- 0:00:08 Average standard deviation of split frequencies: 0.010559 860500 -- (-1577.776) [-1574.939] (-1577.852) (-1575.107) * [-1575.815] (-1575.366) (-1575.859) (-1573.404) -- 0:00:08 861000 -- (-1575.841) (-1575.548) (-1576.473) [-1577.828] * (-1575.236) (-1574.326) [-1574.471] (-1578.765) -- 0:00:08 861500 -- (-1574.813) (-1575.947) (-1579.010) [-1575.487] * (-1574.736) [-1575.801] (-1573.618) (-1573.582) -- 0:00:08 862000 -- (-1574.011) [-1575.301] (-1579.137) (-1577.050) * (-1574.134) (-1575.065) (-1576.507) [-1573.336] -- 0:00:08 862500 -- (-1574.683) [-1572.883] (-1574.255) (-1578.050) * [-1574.094] (-1576.329) (-1576.433) (-1575.666) -- 0:00:08 863000 -- (-1574.892) [-1572.875] (-1574.911) (-1574.921) * (-1573.668) (-1574.857) [-1576.598] (-1575.662) -- 0:00:08 863500 -- (-1574.200) (-1573.980) [-1573.599] (-1575.926) * [-1573.676] (-1575.373) (-1573.560) (-1575.027) -- 0:00:08 864000 -- [-1575.502] (-1576.106) (-1578.501) (-1574.355) * (-1574.003) (-1576.288) (-1575.328) [-1578.754] -- 0:00:08 864500 -- (-1579.938) (-1575.657) [-1574.177] (-1575.825) * (-1575.046) (-1576.279) (-1577.536) [-1577.905] -- 0:00:08 865000 -- (-1577.228) [-1575.685] (-1574.265) (-1576.925) * (-1573.620) (-1575.796) [-1574.024] (-1578.760) -- 0:00:08 Average standard deviation of split frequencies: 0.009949 865500 -- (-1575.215) (-1574.188) [-1574.448] (-1575.013) * [-1575.887] (-1575.902) (-1577.696) (-1579.039) -- 0:00:08 866000 -- [-1574.060] (-1576.272) (-1576.661) (-1574.156) * (-1574.186) [-1574.408] (-1579.179) (-1573.771) -- 0:00:08 866500 -- (-1576.056) (-1574.660) [-1574.694] (-1573.213) * (-1575.184) (-1577.336) [-1579.564] (-1574.406) -- 0:00:08 867000 -- [-1574.368] (-1575.647) (-1574.063) (-1573.812) * (-1574.816) (-1578.924) [-1573.746] (-1576.991) -- 0:00:08 867500 -- (-1579.174) (-1574.335) (-1573.612) [-1573.780] * (-1576.152) (-1574.363) [-1573.621] (-1575.226) -- 0:00:08 868000 -- (-1579.762) [-1576.756] (-1577.585) (-1575.830) * (-1575.146) (-1576.094) (-1574.213) [-1573.949] -- 0:00:08 868500 -- [-1575.945] (-1575.343) (-1575.649) (-1578.333) * [-1577.424] (-1574.535) (-1575.088) (-1576.149) -- 0:00:08 869000 -- (-1577.298) (-1574.456) [-1574.770] (-1576.087) * (-1579.518) (-1576.729) (-1576.186) [-1576.841] -- 0:00:08 869500 -- (-1576.896) (-1579.434) [-1575.564] (-1575.075) * (-1573.566) (-1580.002) [-1574.020] (-1574.643) -- 0:00:08 870000 -- (-1577.532) (-1574.681) [-1574.828] (-1573.961) * [-1573.970] (-1575.989) (-1574.980) (-1575.703) -- 0:00:08 Average standard deviation of split frequencies: 0.009565 870500 -- (-1577.715) (-1577.521) (-1578.322) [-1576.715] * (-1573.642) (-1573.297) (-1581.520) [-1574.489] -- 0:00:08 871000 -- (-1573.792) [-1576.911] (-1575.113) (-1575.876) * [-1573.551] (-1572.947) (-1575.769) (-1578.021) -- 0:00:08 871500 -- (-1581.355) (-1574.587) (-1573.745) [-1576.249] * [-1574.270] (-1574.906) (-1573.328) (-1574.749) -- 0:00:08 872000 -- (-1573.394) (-1575.015) [-1574.706] (-1573.632) * (-1575.213) (-1575.227) (-1575.476) [-1575.190] -- 0:00:08 872500 -- [-1573.461] (-1577.292) (-1576.728) (-1576.837) * (-1576.058) (-1577.553) [-1573.641] (-1574.342) -- 0:00:08 873000 -- [-1575.631] (-1573.904) (-1576.376) (-1573.900) * (-1576.382) (-1575.804) [-1573.956] (-1574.019) -- 0:00:08 873500 -- [-1577.476] (-1576.700) (-1578.290) (-1574.943) * (-1573.705) (-1574.642) [-1578.679] (-1573.936) -- 0:00:08 874000 -- [-1580.969] (-1573.746) (-1578.769) (-1574.996) * (-1573.978) (-1574.108) (-1574.238) [-1575.813] -- 0:00:08 874500 -- (-1576.313) [-1573.702] (-1577.513) (-1574.803) * (-1576.119) (-1575.487) [-1575.046] (-1574.483) -- 0:00:08 875000 -- (-1576.521) (-1575.570) (-1573.572) [-1573.424] * (-1576.838) [-1577.656] (-1575.724) (-1574.348) -- 0:00:08 Average standard deviation of split frequencies: 0.008999 875500 -- [-1574.049] (-1576.401) (-1575.565) (-1574.034) * (-1577.194) [-1574.940] (-1578.282) (-1578.268) -- 0:00:07 876000 -- (-1574.175) (-1576.295) (-1575.662) [-1573.870] * (-1575.459) (-1575.093) (-1577.519) [-1573.395] -- 0:00:07 876500 -- [-1574.153] (-1574.569) (-1573.040) (-1573.885) * (-1581.298) [-1574.034] (-1576.401) (-1575.706) -- 0:00:07 877000 -- (-1574.064) [-1574.911] (-1575.654) (-1573.793) * (-1580.260) [-1575.004] (-1573.865) (-1580.474) -- 0:00:07 877500 -- [-1574.812] (-1578.295) (-1574.956) (-1574.555) * (-1578.053) (-1575.831) [-1579.713] (-1573.980) -- 0:00:07 878000 -- (-1576.885) [-1575.022] (-1573.850) (-1573.185) * (-1575.850) (-1574.317) [-1575.007] (-1575.652) -- 0:00:07 878500 -- (-1574.360) (-1577.513) [-1573.573] (-1574.186) * (-1577.539) (-1573.613) [-1574.074] (-1576.930) -- 0:00:07 879000 -- (-1575.309) (-1575.564) [-1576.857] (-1579.719) * (-1575.250) [-1574.756] (-1575.066) (-1576.762) -- 0:00:07 879500 -- (-1577.159) (-1579.223) (-1575.272) [-1575.618] * (-1573.974) [-1575.841] (-1574.070) (-1574.918) -- 0:00:07 880000 -- [-1575.585] (-1578.011) (-1575.068) (-1577.703) * (-1577.736) (-1574.783) [-1574.678] (-1573.334) -- 0:00:07 Average standard deviation of split frequencies: 0.008832 880500 -- (-1574.006) (-1575.555) (-1575.464) [-1573.718] * (-1579.240) (-1575.309) [-1573.418] (-1573.781) -- 0:00:07 881000 -- [-1573.844] (-1575.544) (-1575.728) (-1574.666) * (-1576.309) (-1574.726) [-1576.392] (-1575.123) -- 0:00:07 881500 -- (-1576.334) [-1573.948] (-1574.294) (-1575.782) * (-1575.115) (-1578.959) [-1576.398] (-1574.510) -- 0:00:07 882000 -- [-1577.770] (-1574.524) (-1574.640) (-1574.178) * (-1579.289) (-1578.144) [-1574.105] (-1577.319) -- 0:00:07 882500 -- [-1575.748] (-1573.121) (-1575.065) (-1578.249) * [-1573.426] (-1576.073) (-1575.548) (-1575.285) -- 0:00:07 883000 -- (-1574.060) (-1573.111) (-1575.638) [-1574.070] * [-1573.308] (-1576.488) (-1574.831) (-1574.037) -- 0:00:07 883500 -- (-1574.626) [-1573.814] (-1574.454) (-1575.154) * (-1573.489) (-1577.147) [-1573.026] (-1573.398) -- 0:00:07 884000 -- (-1575.722) (-1575.719) (-1574.605) [-1576.036] * (-1574.474) (-1576.054) [-1574.536] (-1574.717) -- 0:00:07 884500 -- (-1575.247) (-1579.309) [-1575.109] (-1576.615) * (-1580.720) [-1577.343] (-1575.174) (-1573.632) -- 0:00:07 885000 -- (-1577.207) [-1574.048] (-1573.609) (-1573.786) * (-1573.810) (-1578.824) (-1575.100) [-1573.634] -- 0:00:07 Average standard deviation of split frequencies: 0.008838 885500 -- (-1578.169) (-1579.802) [-1576.818] (-1580.491) * (-1578.923) (-1577.316) (-1574.236) [-1574.293] -- 0:00:07 886000 -- [-1576.704] (-1580.145) (-1575.430) (-1574.425) * (-1573.837) [-1575.517] (-1573.743) (-1574.350) -- 0:00:07 886500 -- (-1576.508) (-1581.082) (-1575.836) [-1579.383] * (-1575.116) (-1582.027) [-1573.105] (-1573.979) -- 0:00:07 887000 -- (-1577.818) [-1575.252] (-1575.106) (-1576.538) * (-1573.967) [-1573.141] (-1578.112) (-1575.872) -- 0:00:07 887500 -- (-1577.068) (-1573.719) (-1574.438) [-1574.030] * (-1575.242) [-1574.141] (-1575.209) (-1575.318) -- 0:00:07 888000 -- (-1574.952) [-1573.719] (-1575.477) (-1575.422) * (-1574.417) [-1574.892] (-1575.149) (-1572.999) -- 0:00:07 888500 -- (-1576.528) (-1576.121) [-1577.113] (-1573.379) * [-1573.992] (-1575.973) (-1573.771) (-1574.146) -- 0:00:07 889000 -- (-1576.245) (-1575.802) [-1578.241] (-1573.883) * [-1576.796] (-1576.738) (-1574.559) (-1574.547) -- 0:00:07 889500 -- (-1574.998) (-1574.872) (-1573.648) [-1574.397] * [-1575.291] (-1578.176) (-1576.584) (-1577.093) -- 0:00:07 890000 -- (-1576.717) (-1575.869) [-1574.369] (-1574.475) * (-1573.852) (-1577.905) [-1575.406] (-1574.609) -- 0:00:07 Average standard deviation of split frequencies: 0.008968 890500 -- (-1574.549) (-1583.278) (-1575.554) [-1572.836] * (-1574.759) (-1575.382) (-1575.476) [-1574.859] -- 0:00:07 891000 -- [-1575.556] (-1575.871) (-1574.690) (-1577.063) * (-1575.226) [-1574.884] (-1574.330) (-1575.317) -- 0:00:06 891500 -- (-1575.245) (-1574.195) [-1573.897] (-1574.569) * [-1579.416] (-1576.727) (-1573.392) (-1575.138) -- 0:00:06 892000 -- [-1574.562] (-1575.094) (-1574.715) (-1575.087) * (-1574.168) [-1574.598] (-1573.858) (-1574.767) -- 0:00:06 892500 -- [-1576.450] (-1575.486) (-1574.036) (-1579.134) * (-1574.335) (-1575.408) (-1573.795) [-1574.437] -- 0:00:06 893000 -- (-1574.053) [-1576.725] (-1574.804) (-1575.078) * (-1576.753) (-1576.287) (-1576.049) [-1573.580] -- 0:00:06 893500 -- [-1574.119] (-1576.886) (-1573.404) (-1577.372) * (-1573.974) (-1575.813) (-1573.132) [-1573.739] -- 0:00:06 894000 -- (-1575.180) (-1575.135) [-1573.843] (-1578.431) * [-1575.355] (-1574.644) (-1576.017) (-1574.936) -- 0:00:06 894500 -- [-1574.348] (-1575.771) (-1573.961) (-1578.623) * (-1581.468) (-1574.861) (-1576.737) [-1574.893] -- 0:00:06 895000 -- (-1575.542) (-1573.179) [-1573.830] (-1577.460) * (-1574.864) [-1576.091] (-1576.711) (-1576.736) -- 0:00:06 Average standard deviation of split frequencies: 0.008973 895500 -- (-1573.962) [-1575.860] (-1574.310) (-1576.037) * (-1573.151) [-1573.278] (-1576.297) (-1574.271) -- 0:00:06 896000 -- (-1576.153) (-1576.039) (-1573.727) [-1575.687] * (-1574.891) (-1575.195) [-1576.935] (-1574.265) -- 0:00:06 896500 -- (-1575.875) (-1576.586) (-1573.995) [-1577.800] * (-1577.850) [-1574.922] (-1574.780) (-1573.825) -- 0:00:06 897000 -- (-1573.828) (-1574.107) (-1574.581) [-1577.153] * (-1574.105) (-1572.964) [-1573.597] (-1575.404) -- 0:00:06 897500 -- (-1573.954) [-1573.657] (-1575.955) (-1576.373) * (-1575.083) (-1573.099) [-1575.503] (-1576.584) -- 0:00:06 898000 -- [-1577.964] (-1575.451) (-1574.441) (-1574.623) * (-1578.970) (-1573.574) (-1574.367) [-1575.327] -- 0:00:06 898500 -- (-1576.641) [-1574.643] (-1576.583) (-1576.501) * [-1574.100] (-1575.477) (-1574.117) (-1578.153) -- 0:00:06 899000 -- (-1575.316) [-1574.359] (-1576.829) (-1577.786) * [-1573.892] (-1575.365) (-1575.458) (-1573.456) -- 0:00:06 899500 -- [-1575.362] (-1575.023) (-1574.333) (-1574.038) * (-1581.358) (-1574.519) [-1574.410] (-1573.628) -- 0:00:06 900000 -- (-1574.091) [-1575.144] (-1574.953) (-1574.355) * (-1578.882) (-1576.578) (-1573.880) [-1573.668] -- 0:00:06 Average standard deviation of split frequencies: 0.009014 900500 -- (-1575.469) [-1574.066] (-1578.563) (-1573.572) * [-1574.999] (-1574.307) (-1575.094) (-1574.931) -- 0:00:06 901000 -- (-1576.398) (-1577.598) [-1576.292] (-1577.559) * (-1575.928) [-1577.286] (-1575.316) (-1575.297) -- 0:00:06 901500 -- (-1575.790) [-1577.518] (-1577.531) (-1578.844) * (-1576.909) (-1574.825) [-1578.272] (-1575.642) -- 0:00:06 902000 -- [-1574.367] (-1577.604) (-1574.619) (-1574.753) * (-1574.504) (-1575.154) (-1573.565) [-1576.894] -- 0:00:06 902500 -- (-1576.619) (-1578.807) [-1575.423] (-1575.212) * (-1574.473) (-1575.850) (-1576.182) [-1576.716] -- 0:00:06 903000 -- (-1576.520) (-1579.207) (-1576.306) [-1575.474] * (-1573.215) [-1576.305] (-1574.824) (-1574.586) -- 0:00:06 903500 -- (-1577.762) (-1573.950) (-1576.021) [-1573.861] * (-1575.452) (-1573.979) (-1576.664) [-1574.171] -- 0:00:06 904000 -- (-1574.493) (-1578.349) [-1576.177] (-1575.696) * (-1576.108) (-1573.439) (-1573.446) [-1574.573] -- 0:00:06 904500 -- (-1574.810) [-1574.473] (-1575.224) (-1574.642) * (-1578.066) [-1573.073] (-1573.213) (-1577.661) -- 0:00:06 905000 -- (-1574.616) [-1574.695] (-1574.394) (-1574.832) * [-1575.462] (-1576.142) (-1576.504) (-1574.630) -- 0:00:06 Average standard deviation of split frequencies: 0.009163 905500 -- (-1579.617) (-1575.461) [-1574.059] (-1575.280) * (-1577.628) (-1573.892) [-1572.970] (-1578.286) -- 0:00:06 906000 -- (-1579.615) (-1576.718) [-1574.323] (-1580.275) * (-1576.162) [-1572.907] (-1574.917) (-1576.643) -- 0:00:06 906500 -- (-1574.515) [-1577.450] (-1575.574) (-1579.303) * (-1577.040) [-1573.067] (-1577.577) (-1574.626) -- 0:00:05 907000 -- [-1573.548] (-1578.744) (-1576.336) (-1574.777) * (-1576.695) (-1573.024) [-1577.375] (-1574.411) -- 0:00:05 907500 -- (-1573.857) (-1575.541) [-1578.636] (-1575.219) * (-1576.211) (-1576.956) (-1576.616) [-1575.611] -- 0:00:05 908000 -- (-1578.737) [-1573.940] (-1574.599) (-1574.317) * (-1575.693) (-1573.527) [-1576.312] (-1578.436) -- 0:00:05 908500 -- (-1575.556) (-1574.795) (-1574.037) [-1573.595] * (-1574.103) (-1574.126) (-1576.045) [-1575.081] -- 0:00:05 909000 -- (-1573.863) (-1577.911) [-1575.817] (-1574.745) * (-1573.608) (-1573.896) (-1574.334) [-1574.022] -- 0:00:05 909500 -- (-1573.863) [-1576.084] (-1575.938) (-1576.128) * (-1573.334) [-1574.877] (-1581.662) (-1574.321) -- 0:00:05 910000 -- (-1574.111) (-1575.256) [-1574.683] (-1575.286) * (-1573.339) [-1574.600] (-1577.077) (-1574.275) -- 0:00:05 Average standard deviation of split frequencies: 0.009174 910500 -- (-1574.995) (-1574.745) [-1575.784] (-1574.950) * (-1574.875) (-1576.969) [-1575.087] (-1574.109) -- 0:00:05 911000 -- [-1577.847] (-1575.173) (-1575.556) (-1577.747) * (-1576.522) (-1575.096) (-1573.050) [-1574.550] -- 0:00:05 911500 -- (-1579.632) [-1573.237] (-1574.344) (-1576.206) * [-1574.866] (-1577.682) (-1573.516) (-1576.897) -- 0:00:05 912000 -- (-1579.632) (-1575.945) (-1575.855) [-1576.547] * (-1575.874) (-1577.052) [-1573.365] (-1579.141) -- 0:00:05 912500 -- (-1575.667) (-1580.660) [-1573.234] (-1574.599) * (-1574.357) [-1575.850] (-1578.545) (-1576.034) -- 0:00:05 913000 -- (-1573.473) (-1579.676) [-1574.978] (-1575.412) * [-1573.748] (-1575.813) (-1577.119) (-1576.234) -- 0:00:05 913500 -- [-1575.178] (-1576.737) (-1577.232) (-1575.864) * (-1574.035) [-1573.069] (-1583.142) (-1573.958) -- 0:00:05 914000 -- [-1574.855] (-1575.816) (-1574.185) (-1577.114) * (-1575.482) (-1573.706) (-1576.203) [-1574.074] -- 0:00:05 914500 -- [-1573.547] (-1576.261) (-1575.456) (-1578.590) * (-1576.372) (-1576.870) [-1578.716] (-1573.288) -- 0:00:05 915000 -- (-1575.728) (-1578.129) (-1574.281) [-1577.039] * [-1574.294] (-1575.201) (-1577.154) (-1574.725) -- 0:00:05 Average standard deviation of split frequencies: 0.009178 915500 -- (-1575.022) [-1578.794] (-1574.019) (-1577.121) * (-1577.519) (-1575.186) (-1575.510) [-1577.592] -- 0:00:05 916000 -- (-1576.818) (-1575.712) [-1574.333] (-1578.156) * (-1573.779) (-1573.960) [-1573.684] (-1575.280) -- 0:00:05 916500 -- (-1574.823) [-1575.852] (-1573.289) (-1574.061) * (-1575.215) (-1573.807) (-1576.757) [-1577.357] -- 0:00:05 917000 -- (-1578.705) (-1577.425) [-1573.755] (-1577.609) * (-1575.651) (-1577.536) [-1575.708] (-1578.647) -- 0:00:05 917500 -- (-1581.019) (-1584.033) (-1577.253) [-1574.968] * (-1575.224) (-1574.636) [-1573.784] (-1578.505) -- 0:00:05 918000 -- (-1575.012) [-1578.575] (-1575.995) (-1576.567) * [-1575.258] (-1573.227) (-1575.895) (-1575.951) -- 0:00:05 918500 -- (-1578.060) (-1578.947) (-1575.317) [-1576.321] * (-1575.103) (-1574.011) [-1575.163] (-1574.631) -- 0:00:05 919000 -- (-1574.452) (-1579.526) [-1577.894] (-1576.181) * (-1574.387) (-1576.734) (-1574.808) [-1577.264] -- 0:00:05 919500 -- (-1574.600) [-1577.281] (-1575.926) (-1579.397) * [-1574.371] (-1575.119) (-1573.656) (-1575.339) -- 0:00:05 920000 -- [-1576.440] (-1576.974) (-1573.696) (-1574.274) * [-1573.293] (-1576.614) (-1573.604) (-1577.539) -- 0:00:05 Average standard deviation of split frequencies: 0.008989 920500 -- (-1576.394) [-1575.191] (-1576.795) (-1576.151) * (-1573.295) (-1573.515) (-1575.457) [-1573.966] -- 0:00:05 921000 -- (-1574.712) (-1578.854) (-1576.958) [-1575.277] * (-1573.048) [-1574.125] (-1573.244) (-1581.913) -- 0:00:05 921500 -- (-1575.775) [-1578.707] (-1574.934) (-1575.104) * (-1574.079) (-1573.900) (-1575.979) [-1575.954] -- 0:00:05 922000 -- (-1577.336) (-1577.802) (-1573.946) [-1575.777] * [-1575.746] (-1579.060) (-1578.762) (-1575.686) -- 0:00:04 922500 -- [-1573.152] (-1575.894) (-1574.011) (-1577.529) * (-1575.873) (-1574.260) [-1575.485] (-1575.237) -- 0:00:04 923000 -- (-1573.671) [-1575.871] (-1573.815) (-1575.687) * (-1575.758) (-1573.716) [-1577.104] (-1577.563) -- 0:00:04 923500 -- (-1574.916) [-1574.798] (-1575.103) (-1577.678) * (-1576.140) [-1577.478] (-1576.486) (-1575.876) -- 0:00:04 924000 -- (-1575.167) [-1574.143] (-1575.837) (-1575.231) * (-1575.407) (-1575.425) (-1575.219) [-1574.712] -- 0:00:04 924500 -- (-1576.088) [-1574.512] (-1576.410) (-1574.235) * (-1575.846) (-1575.445) (-1574.465) [-1573.625] -- 0:00:04 925000 -- (-1575.190) [-1573.682] (-1576.408) (-1576.448) * [-1575.118] (-1574.532) (-1580.286) (-1574.104) -- 0:00:04 Average standard deviation of split frequencies: 0.009022 925500 -- [-1574.887] (-1575.716) (-1575.461) (-1576.758) * (-1578.217) (-1575.807) (-1574.712) [-1573.947] -- 0:00:04 926000 -- (-1575.661) (-1573.513) (-1574.025) [-1575.908] * (-1578.302) (-1575.756) [-1577.398] (-1573.590) -- 0:00:04 926500 -- (-1574.585) (-1574.510) (-1575.260) [-1574.105] * (-1575.938) [-1573.026] (-1578.882) (-1573.441) -- 0:00:04 927000 -- (-1573.724) (-1574.736) [-1575.696] (-1573.050) * (-1575.121) [-1574.378] (-1574.507) (-1575.311) -- 0:00:04 927500 -- (-1574.661) (-1574.016) [-1573.304] (-1574.908) * (-1574.445) (-1574.196) (-1577.954) [-1574.917] -- 0:00:04 928000 -- (-1573.555) (-1574.381) (-1574.945) [-1575.379] * (-1575.641) (-1573.208) [-1574.501] (-1576.450) -- 0:00:04 928500 -- (-1575.400) (-1574.752) [-1574.100] (-1574.905) * (-1574.789) (-1576.317) [-1578.815] (-1575.084) -- 0:00:04 929000 -- (-1577.602) [-1574.567] (-1573.155) (-1576.046) * (-1574.318) (-1574.765) (-1577.880) [-1573.447] -- 0:00:04 929500 -- (-1577.644) (-1573.274) (-1573.204) [-1576.909] * (-1576.735) (-1573.994) [-1576.209] (-1573.163) -- 0:00:04 930000 -- [-1574.173] (-1574.025) (-1576.069) (-1581.617) * (-1579.122) (-1575.062) [-1573.862] (-1573.210) -- 0:00:04 Average standard deviation of split frequencies: 0.009202 930500 -- [-1575.231] (-1574.116) (-1577.484) (-1576.911) * (-1576.730) [-1573.532] (-1573.892) (-1573.205) -- 0:00:04 931000 -- (-1576.563) [-1573.694] (-1573.445) (-1579.457) * [-1573.575] (-1574.000) (-1576.776) (-1575.088) -- 0:00:04 931500 -- (-1578.028) (-1577.087) [-1576.109] (-1574.263) * (-1575.764) (-1574.726) (-1573.366) [-1574.098] -- 0:00:04 932000 -- (-1576.294) [-1574.390] (-1575.833) (-1576.273) * (-1574.401) (-1573.977) [-1575.063] (-1579.852) -- 0:00:04 932500 -- (-1575.899) (-1574.547) [-1576.845] (-1573.616) * [-1576.613] (-1573.794) (-1574.792) (-1574.787) -- 0:00:04 933000 -- (-1575.107) [-1575.032] (-1574.113) (-1573.791) * [-1574.252] (-1573.659) (-1573.841) (-1573.815) -- 0:00:04 933500 -- (-1574.799) (-1573.630) [-1576.777] (-1573.179) * (-1575.687) (-1575.978) [-1575.806] (-1574.823) -- 0:00:04 934000 -- [-1576.993] (-1573.285) (-1574.640) (-1574.537) * (-1575.844) (-1575.128) [-1573.821] (-1576.379) -- 0:00:04 934500 -- (-1573.574) (-1574.470) (-1576.305) [-1577.609] * (-1573.455) (-1574.840) [-1573.822] (-1577.215) -- 0:00:04 935000 -- (-1576.106) (-1575.256) [-1574.919] (-1575.551) * [-1574.589] (-1574.674) (-1576.469) (-1573.385) -- 0:00:04 Average standard deviation of split frequencies: 0.009401 935500 -- (-1574.900) (-1575.693) (-1574.926) [-1573.536] * (-1574.938) [-1577.170] (-1574.118) (-1573.080) -- 0:00:04 936000 -- [-1576.655] (-1574.520) (-1576.357) (-1573.722) * [-1576.703] (-1577.194) (-1581.065) (-1573.346) -- 0:00:04 936500 -- [-1577.447] (-1576.118) (-1577.844) (-1574.977) * [-1573.908] (-1577.894) (-1575.451) (-1574.471) -- 0:00:04 937000 -- [-1575.350] (-1575.300) (-1576.976) (-1576.082) * [-1575.392] (-1576.888) (-1574.215) (-1575.108) -- 0:00:04 937500 -- [-1576.294] (-1575.272) (-1575.111) (-1574.319) * (-1574.717) (-1577.995) (-1575.147) [-1576.089] -- 0:00:04 938000 -- (-1573.666) (-1582.546) [-1575.316] (-1573.745) * (-1573.867) (-1577.639) [-1574.919] (-1577.506) -- 0:00:03 938500 -- (-1574.867) (-1580.027) [-1575.740] (-1574.985) * [-1577.280] (-1577.313) (-1573.086) (-1577.436) -- 0:00:03 939000 -- (-1575.307) (-1574.679) (-1577.978) [-1574.183] * (-1573.665) [-1574.667] (-1572.734) (-1578.527) -- 0:00:03 939500 -- (-1573.777) (-1576.844) (-1576.358) [-1573.779] * (-1577.675) (-1576.628) [-1573.937] (-1576.186) -- 0:00:03 940000 -- (-1574.019) (-1578.409) [-1579.074] (-1575.613) * (-1574.561) (-1574.044) [-1574.611] (-1577.614) -- 0:00:03 Average standard deviation of split frequencies: 0.009215 940500 -- (-1575.742) [-1576.389] (-1575.195) (-1576.071) * [-1575.705] (-1575.931) (-1577.441) (-1575.766) -- 0:00:03 941000 -- (-1576.509) [-1579.748] (-1576.330) (-1573.374) * (-1574.819) [-1575.160] (-1581.137) (-1574.505) -- 0:00:03 941500 -- [-1579.119] (-1574.404) (-1573.566) (-1579.512) * (-1578.710) [-1573.593] (-1573.450) (-1574.848) -- 0:00:03 942000 -- (-1576.030) (-1574.671) (-1573.879) [-1574.315] * (-1573.906) (-1575.284) (-1575.355) [-1574.910] -- 0:00:03 942500 -- (-1576.243) (-1574.289) (-1574.759) [-1573.459] * (-1574.355) (-1574.758) [-1574.193] (-1573.997) -- 0:00:03 943000 -- (-1576.039) [-1574.940] (-1576.531) (-1576.291) * (-1575.551) [-1573.328] (-1575.140) (-1575.682) -- 0:00:03 943500 -- (-1573.763) (-1573.664) (-1575.902) [-1576.835] * (-1574.903) (-1575.568) (-1575.433) [-1577.277] -- 0:00:03 944000 -- (-1573.788) [-1573.742] (-1576.361) (-1573.944) * (-1574.252) (-1573.829) (-1574.344) [-1573.147] -- 0:00:03 944500 -- (-1575.187) (-1574.498) (-1576.977) [-1573.100] * [-1575.153] (-1576.719) (-1574.956) (-1573.161) -- 0:00:03 945000 -- (-1574.598) (-1576.375) (-1574.225) [-1574.766] * [-1574.439] (-1579.490) (-1575.391) (-1573.224) -- 0:00:03 Average standard deviation of split frequencies: 0.009468 945500 -- (-1575.988) (-1575.483) (-1576.638) [-1574.384] * (-1573.706) (-1574.683) [-1576.063] (-1576.493) -- 0:00:03 946000 -- (-1576.777) (-1574.119) (-1576.373) [-1579.117] * [-1573.103] (-1573.512) (-1576.438) (-1584.165) -- 0:00:03 946500 -- [-1575.293] (-1575.741) (-1574.717) (-1574.646) * (-1574.564) (-1573.440) [-1573.450] (-1574.884) -- 0:00:03 947000 -- (-1577.071) (-1576.670) (-1576.662) [-1573.224] * (-1577.405) [-1573.348] (-1573.501) (-1574.963) -- 0:00:03 947500 -- (-1579.266) [-1574.639] (-1573.852) (-1576.520) * (-1577.511) (-1574.335) (-1574.424) [-1575.491] -- 0:00:03 948000 -- (-1573.575) (-1577.879) (-1573.123) [-1577.163] * [-1576.019] (-1576.509) (-1573.393) (-1578.314) -- 0:00:03 948500 -- [-1573.799] (-1575.370) (-1574.713) (-1574.384) * [-1573.552] (-1576.775) (-1574.977) (-1578.521) -- 0:00:03 949000 -- (-1579.295) [-1574.223] (-1573.170) (-1574.553) * [-1574.046] (-1575.756) (-1574.421) (-1577.442) -- 0:00:03 949500 -- [-1573.493] (-1575.638) (-1573.590) (-1575.968) * (-1575.161) [-1578.328] (-1574.168) (-1576.412) -- 0:00:03 950000 -- (-1574.218) [-1575.984] (-1573.210) (-1574.545) * [-1574.106] (-1573.651) (-1580.235) (-1575.338) -- 0:00:03 Average standard deviation of split frequencies: 0.009394 950500 -- (-1574.749) (-1575.106) [-1573.541] (-1574.279) * [-1577.815] (-1575.288) (-1579.286) (-1573.204) -- 0:00:03 951000 -- (-1575.170) (-1574.483) (-1575.032) [-1574.418] * (-1575.609) (-1574.205) [-1576.314] (-1575.313) -- 0:00:03 951500 -- [-1576.876] (-1575.730) (-1576.557) (-1577.482) * (-1574.135) (-1574.435) (-1574.609) [-1578.457] -- 0:00:03 952000 -- (-1574.526) (-1575.273) (-1575.423) [-1575.895] * (-1579.186) (-1574.137) [-1575.913] (-1573.250) -- 0:00:03 952500 -- (-1577.937) [-1576.838] (-1578.634) (-1575.838) * (-1575.794) (-1576.990) [-1577.407] (-1573.692) -- 0:00:03 953000 -- [-1579.098] (-1578.682) (-1579.020) (-1574.596) * [-1573.529] (-1575.551) (-1574.575) (-1573.199) -- 0:00:03 953500 -- (-1578.903) (-1577.882) [-1575.813] (-1573.575) * (-1576.294) [-1576.265] (-1576.830) (-1574.498) -- 0:00:02 954000 -- (-1579.145) (-1575.214) (-1576.029) [-1574.540] * (-1575.468) (-1575.624) (-1576.517) [-1574.721] -- 0:00:02 954500 -- (-1573.885) [-1574.579] (-1576.351) (-1577.871) * (-1577.005) [-1578.050] (-1574.253) (-1573.345) -- 0:00:02 955000 -- [-1573.817] (-1578.510) (-1573.274) (-1576.292) * (-1574.001) [-1574.105] (-1574.884) (-1577.935) -- 0:00:02 Average standard deviation of split frequencies: 0.009588 955500 -- (-1574.241) (-1576.802) (-1578.305) [-1573.875] * (-1574.276) [-1575.173] (-1575.719) (-1575.685) -- 0:00:02 956000 -- (-1575.526) (-1576.428) (-1575.260) [-1573.994] * (-1574.459) [-1574.935] (-1577.523) (-1577.595) -- 0:00:02 956500 -- (-1573.940) (-1574.238) [-1577.382] (-1574.028) * (-1573.884) [-1574.806] (-1578.535) (-1574.031) -- 0:00:02 957000 -- (-1573.845) (-1574.366) (-1573.618) [-1574.644] * (-1574.266) (-1580.015) [-1575.677] (-1574.263) -- 0:00:02 957500 -- [-1576.989] (-1575.105) (-1577.677) (-1574.674) * [-1573.584] (-1576.648) (-1573.236) (-1576.169) -- 0:00:02 958000 -- (-1575.004) (-1577.397) [-1574.616] (-1575.414) * (-1575.432) (-1574.533) [-1574.361] (-1575.298) -- 0:00:02 958500 -- [-1575.909] (-1576.424) (-1574.366) (-1575.453) * (-1576.608) (-1576.031) [-1573.890] (-1575.647) -- 0:00:02 959000 -- (-1575.332) (-1579.079) (-1576.818) [-1573.955] * (-1577.802) [-1575.489] (-1576.127) (-1574.136) -- 0:00:02 959500 -- [-1573.914] (-1579.304) (-1576.253) (-1576.261) * (-1576.656) (-1576.013) [-1575.719] (-1575.069) -- 0:00:02 960000 -- (-1577.564) (-1576.417) [-1576.917] (-1574.280) * (-1574.741) (-1576.672) (-1575.528) [-1575.210] -- 0:00:02 Average standard deviation of split frequencies: 0.009705 960500 -- (-1576.537) (-1575.892) (-1575.974) [-1573.897] * (-1576.808) [-1573.597] (-1576.688) (-1577.832) -- 0:00:02 961000 -- (-1579.245) (-1573.859) (-1577.179) [-1574.138] * [-1575.769] (-1573.776) (-1578.348) (-1576.252) -- 0:00:02 961500 -- (-1574.363) [-1575.280] (-1573.769) (-1574.646) * [-1574.180] (-1574.968) (-1576.022) (-1575.001) -- 0:00:02 962000 -- (-1577.151) (-1575.950) [-1574.800] (-1575.334) * [-1575.531] (-1575.419) (-1573.422) (-1575.064) -- 0:00:02 962500 -- (-1579.091) [-1576.412] (-1575.885) (-1574.934) * (-1573.565) [-1575.362] (-1575.834) (-1579.729) -- 0:00:02 963000 -- (-1575.123) [-1577.355] (-1575.890) (-1576.895) * (-1575.487) (-1574.332) [-1574.323] (-1578.329) -- 0:00:02 963500 -- (-1574.427) [-1574.085] (-1575.091) (-1579.416) * [-1573.645] (-1574.784) (-1575.219) (-1575.450) -- 0:00:02 964000 -- (-1575.972) (-1573.027) [-1575.572] (-1577.079) * (-1573.548) [-1574.511] (-1573.975) (-1577.144) -- 0:00:02 964500 -- [-1573.993] (-1575.353) (-1577.093) (-1574.755) * (-1574.726) [-1577.172] (-1574.731) (-1578.285) -- 0:00:02 965000 -- (-1574.612) (-1574.651) (-1576.120) [-1574.315] * (-1575.662) (-1575.101) (-1577.634) [-1574.151] -- 0:00:02 Average standard deviation of split frequencies: 0.009597 965500 -- (-1575.090) [-1576.090] (-1578.802) (-1574.025) * (-1575.656) [-1577.336] (-1577.021) (-1575.671) -- 0:00:02 966000 -- (-1575.011) (-1577.587) (-1574.498) [-1576.379] * (-1573.340) [-1573.978] (-1574.451) (-1575.851) -- 0:00:02 966500 -- (-1579.098) [-1575.911] (-1574.707) (-1577.234) * [-1573.385] (-1573.993) (-1574.056) (-1577.622) -- 0:00:02 967000 -- [-1574.317] (-1575.243) (-1576.392) (-1577.416) * [-1575.932] (-1574.416) (-1574.265) (-1577.488) -- 0:00:02 967500 -- (-1576.207) (-1574.026) [-1575.668] (-1577.289) * (-1575.527) (-1574.105) [-1574.294] (-1573.873) -- 0:00:02 968000 -- [-1573.834] (-1574.834) (-1578.076) (-1575.830) * (-1578.186) (-1575.017) [-1573.090] (-1576.416) -- 0:00:02 968500 -- (-1576.764) (-1573.553) [-1576.698] (-1576.694) * (-1576.836) [-1574.180] (-1577.219) (-1576.850) -- 0:00:02 969000 -- (-1577.269) (-1573.681) (-1574.052) [-1576.495] * (-1576.881) [-1574.223] (-1575.883) (-1577.248) -- 0:00:01 969500 -- (-1575.304) (-1574.043) (-1585.368) [-1576.165] * [-1579.218] (-1575.061) (-1576.213) (-1577.558) -- 0:00:01 970000 -- (-1576.125) (-1574.094) (-1575.331) [-1577.076] * (-1577.481) (-1577.804) [-1576.652] (-1575.160) -- 0:00:01 Average standard deviation of split frequencies: 0.009146 970500 -- (-1575.092) [-1578.521] (-1575.547) (-1577.393) * (-1573.591) (-1576.310) [-1575.935] (-1574.811) -- 0:00:01 971000 -- (-1575.011) (-1575.193) [-1576.406] (-1575.224) * (-1573.568) [-1574.391] (-1575.780) (-1573.558) -- 0:00:01 971500 -- (-1576.684) [-1573.059] (-1576.456) (-1574.304) * (-1574.767) (-1573.363) [-1573.484] (-1576.610) -- 0:00:01 972000 -- [-1573.448] (-1574.926) (-1576.786) (-1574.831) * (-1575.168) [-1575.249] (-1577.465) (-1574.742) -- 0:00:01 972500 -- (-1574.079) [-1575.031] (-1575.098) (-1576.211) * (-1574.604) [-1573.764] (-1576.815) (-1575.784) -- 0:00:01 973000 -- (-1577.010) (-1575.184) (-1574.451) [-1573.769] * [-1574.509] (-1575.500) (-1575.282) (-1576.435) -- 0:00:01 973500 -- (-1574.899) (-1573.979) (-1573.934) [-1573.780] * (-1573.533) [-1574.343] (-1574.832) (-1576.586) -- 0:00:01 974000 -- (-1575.845) [-1575.613] (-1573.802) (-1574.947) * [-1575.013] (-1579.669) (-1575.161) (-1578.230) -- 0:00:01 974500 -- (-1575.812) (-1578.153) [-1573.718] (-1575.074) * (-1573.973) [-1575.049] (-1575.120) (-1574.214) -- 0:00:01 975000 -- [-1575.160] (-1575.952) (-1573.949) (-1575.410) * (-1574.256) [-1574.104] (-1575.682) (-1577.403) -- 0:00:01 Average standard deviation of split frequencies: 0.009231 975500 -- (-1576.249) (-1574.110) (-1573.197) [-1575.976] * [-1574.153] (-1574.124) (-1573.905) (-1575.164) -- 0:00:01 976000 -- (-1577.801) [-1576.036] (-1574.717) (-1576.846) * (-1574.772) (-1574.311) [-1577.797] (-1574.961) -- 0:00:01 976500 -- (-1577.207) [-1575.833] (-1578.000) (-1574.679) * [-1574.134] (-1576.899) (-1575.088) (-1573.430) -- 0:00:01 977000 -- (-1573.831) (-1573.115) [-1574.941] (-1580.311) * (-1574.080) (-1573.714) [-1576.909] (-1575.311) -- 0:00:01 977500 -- [-1574.925] (-1576.527) (-1575.260) (-1580.909) * (-1574.616) [-1576.502] (-1573.775) (-1574.594) -- 0:00:01 978000 -- [-1574.615] (-1575.801) (-1577.145) (-1576.922) * [-1576.390] (-1575.009) (-1574.338) (-1574.606) -- 0:00:01 978500 -- (-1578.033) (-1573.927) [-1574.012] (-1573.909) * (-1574.291) (-1576.826) [-1576.332] (-1576.742) -- 0:00:01 979000 -- (-1575.114) (-1573.732) (-1575.679) [-1575.210] * (-1574.654) [-1579.656] (-1577.137) (-1574.305) -- 0:00:01 979500 -- (-1575.956) (-1576.550) [-1575.912] (-1574.812) * (-1576.172) [-1577.655] (-1575.216) (-1576.241) -- 0:00:01 980000 -- (-1574.452) (-1575.835) (-1573.694) [-1573.010] * (-1576.156) [-1577.003] (-1576.864) (-1575.529) -- 0:00:01 Average standard deviation of split frequencies: 0.009160 980500 -- [-1574.433] (-1575.219) (-1575.909) (-1576.425) * (-1577.099) (-1578.351) (-1573.578) [-1574.992] -- 0:00:01 981000 -- (-1575.532) [-1577.055] (-1575.162) (-1574.551) * (-1581.378) (-1574.619) (-1574.385) [-1575.045] -- 0:00:01 981500 -- (-1574.761) (-1577.732) (-1574.067) [-1575.136] * (-1577.485) (-1574.712) (-1575.706) [-1578.093] -- 0:00:01 982000 -- (-1574.328) (-1577.498) (-1573.829) [-1574.412] * (-1577.168) [-1575.969] (-1578.367) (-1578.774) -- 0:00:01 982500 -- (-1575.269) (-1578.062) (-1575.482) [-1573.569] * [-1573.621] (-1575.108) (-1577.747) (-1578.551) -- 0:00:01 983000 -- (-1573.318) (-1579.086) (-1577.613) [-1574.030] * [-1573.541] (-1574.788) (-1574.676) (-1577.125) -- 0:00:01 983500 -- (-1575.896) [-1575.660] (-1574.625) (-1579.184) * [-1574.528] (-1574.253) (-1575.231) (-1575.801) -- 0:00:01 984000 -- (-1573.562) [-1574.187] (-1575.052) (-1577.580) * (-1573.120) (-1575.303) [-1574.752] (-1575.887) -- 0:00:01 984500 -- [-1575.660] (-1575.870) (-1575.150) (-1575.246) * (-1574.134) (-1579.665) [-1575.210] (-1574.468) -- 0:00:00 985000 -- (-1577.573) (-1576.393) [-1575.456] (-1573.539) * (-1574.055) [-1576.605] (-1574.595) (-1574.502) -- 0:00:00 Average standard deviation of split frequencies: 0.008951 985500 -- (-1579.340) (-1577.200) (-1575.610) [-1573.517] * (-1573.977) (-1574.740) [-1574.729] (-1577.583) -- 0:00:00 986000 -- (-1576.281) (-1576.598) (-1577.077) [-1573.922] * [-1573.915] (-1579.322) (-1574.700) (-1576.783) -- 0:00:00 986500 -- (-1575.420) (-1573.772) (-1578.400) [-1573.962] * (-1578.747) (-1576.999) [-1574.188] (-1574.469) -- 0:00:00 987000 -- (-1575.183) (-1575.075) [-1574.873] (-1574.199) * (-1578.322) [-1574.072] (-1577.357) (-1573.987) -- 0:00:00 987500 -- (-1576.514) (-1574.870) [-1576.998] (-1577.194) * (-1574.611) [-1578.123] (-1577.127) (-1579.001) -- 0:00:00 988000 -- [-1576.581] (-1574.153) (-1576.719) (-1576.148) * [-1573.433] (-1579.198) (-1575.065) (-1580.785) -- 0:00:00 988500 -- [-1576.344] (-1573.243) (-1577.327) (-1574.673) * (-1574.252) (-1579.734) [-1574.080] (-1573.957) -- 0:00:00 989000 -- (-1576.433) [-1573.946] (-1574.019) (-1573.777) * (-1574.481) [-1574.754] (-1573.525) (-1574.346) -- 0:00:00 989500 -- [-1575.055] (-1574.939) (-1574.629) (-1578.678) * (-1576.085) [-1574.024] (-1574.332) (-1574.705) -- 0:00:00 990000 -- (-1574.270) (-1574.453) (-1575.850) [-1576.726] * (-1576.732) [-1573.880] (-1577.080) (-1578.319) -- 0:00:00 Average standard deviation of split frequencies: 0.008935 990500 -- (-1574.398) (-1573.911) [-1574.123] (-1574.905) * (-1575.164) (-1576.792) [-1575.181] (-1574.702) -- 0:00:00 991000 -- (-1578.844) (-1574.161) (-1575.780) [-1576.459] * (-1574.445) [-1573.752] (-1574.121) (-1575.778) -- 0:00:00 991500 -- [-1574.357] (-1574.681) (-1574.913) (-1576.063) * (-1573.611) [-1573.752] (-1574.149) (-1574.427) -- 0:00:00 992000 -- (-1576.385) (-1574.949) (-1577.568) [-1577.346] * [-1573.604] (-1574.709) (-1574.539) (-1575.441) -- 0:00:00 992500 -- (-1575.843) [-1575.347] (-1582.330) (-1576.358) * [-1573.333] (-1574.569) (-1575.215) (-1574.019) -- 0:00:00 993000 -- (-1575.526) [-1573.363] (-1578.490) (-1574.059) * (-1574.390) (-1579.361) (-1579.986) [-1574.552] -- 0:00:00 993500 -- [-1576.204] (-1573.631) (-1575.224) (-1573.358) * (-1575.364) (-1574.949) (-1574.956) [-1575.070] -- 0:00:00 994000 -- [-1575.118] (-1575.822) (-1574.743) (-1573.758) * (-1574.876) (-1576.230) (-1578.310) [-1575.591] -- 0:00:00 994500 -- (-1575.734) (-1575.160) [-1575.279] (-1574.375) * [-1578.767] (-1573.464) (-1574.700) (-1579.473) -- 0:00:00 995000 -- (-1575.569) (-1575.273) (-1573.757) [-1575.214] * (-1577.227) (-1577.038) [-1575.654] (-1576.994) -- 0:00:00 Average standard deviation of split frequencies: 0.008914 995500 -- (-1573.916) [-1576.145] (-1574.316) (-1577.342) * [-1576.570] (-1579.092) (-1573.492) (-1578.334) -- 0:00:00 996000 -- (-1580.996) [-1575.780] (-1573.421) (-1576.779) * (-1579.265) [-1578.875] (-1574.970) (-1577.727) -- 0:00:00 996500 -- [-1574.038] (-1576.972) (-1578.392) (-1578.323) * (-1577.471) [-1578.180] (-1574.804) (-1575.148) -- 0:00:00 997000 -- [-1575.662] (-1575.237) (-1580.392) (-1575.749) * [-1574.945] (-1577.454) (-1573.737) (-1575.817) -- 0:00:00 997500 -- (-1574.608) [-1574.420] (-1577.708) (-1575.994) * (-1574.874) (-1580.854) (-1575.882) [-1574.324] -- 0:00:00 998000 -- [-1575.608] (-1574.359) (-1576.921) (-1575.809) * [-1574.105] (-1574.806) (-1577.957) (-1576.194) -- 0:00:00 998500 -- (-1575.448) [-1576.375] (-1577.558) (-1576.448) * (-1575.047) [-1574.431] (-1574.892) (-1576.047) -- 0:00:00 999000 -- [-1575.979] (-1574.046) (-1575.204) (-1574.506) * [-1574.936] (-1575.802) (-1574.116) (-1574.994) -- 0:00:00 999500 -- (-1575.276) (-1573.602) [-1576.108] (-1574.215) * (-1573.357) [-1574.420] (-1574.370) (-1579.088) -- 0:00:00 1000000 -- (-1576.144) (-1574.470) [-1573.952] (-1573.525) * (-1574.196) (-1574.514) (-1574.554) [-1575.215] -- 0:00:00 Average standard deviation of split frequencies: 0.008820 Analysis completed in 1 mins 4 seconds Analysis used 62.89 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1572.74 Likelihood of best state for "cold" chain of run 2 was -1572.74 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 76.2 % ( 67 %) Dirichlet(Revmat{all}) 99.9 % ( 99 %) Slider(Revmat{all}) 24.8 % ( 21 %) Dirichlet(Pi{all}) 26.9 % ( 23 %) Slider(Pi{all}) 79.1 % ( 57 %) Multiplier(Alpha{1,2}) 77.8 % ( 51 %) Multiplier(Alpha{3}) 16.9 % ( 22 %) Slider(Pinvar{all}) 98.6 % (100 %) ExtSPR(Tau{all},V{all}) 70.3 % ( 67 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.3 % ( 29 %) Multiplier(V{all}) 97.4 % ( 98 %) Nodeslider(V{all}) 30.6 % ( 20 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.3 % ( 74 %) Dirichlet(Revmat{all}) 99.9 % ( 99 %) Slider(Revmat{all}) 25.2 % ( 30 %) Dirichlet(Pi{all}) 26.7 % ( 26 %) Slider(Pi{all}) 78.8 % ( 63 %) Multiplier(Alpha{1,2}) 78.1 % ( 51 %) Multiplier(Alpha{3}) 16.7 % ( 31 %) Slider(Pinvar{all}) 98.7 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 69 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.6 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 24 %) Multiplier(V{all}) 97.4 % ( 96 %) Nodeslider(V{all}) 30.7 % ( 24 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166312 0.82 0.67 3 | 165874 166845 0.84 4 | 166931 167433 166605 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166369 0.82 0.67 3 | 166985 166803 0.84 4 | 166305 167109 166429 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1574.44 | 2 | | 1 | |1 1 2 1 2 | | 2 12 1 2 2 1 2 1 | |2 1 2 1 2 2 22 2 | | 2 1 2 12 2 1 1 2 | | 1 121 * 21 2* 21 1 111 2| | 2*1 1 2 2 1 1 2 2 2 1 2 1 | | 1 2 2 2 1 22 1 11 2 1 2 1 1 21 | | 1 * 1 2 1 1 2 1 1 2 1 1| | 21 1 2 | | 1 2 1 21 21 2 1 | | 22 22 1 | | 2 2 2 | | 1 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1576.04 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1574.50 -1578.73 2 -1574.48 -1577.57 -------------------------------------- TOTAL -1574.49 -1578.31 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.891196 0.092298 0.306645 1.445593 0.861556 1242.51 1363.71 1.000 r(A<->C){all} 0.154712 0.016761 0.000037 0.412553 0.121136 187.08 217.27 1.001 r(A<->G){all} 0.170565 0.019405 0.000144 0.450456 0.133912 165.49 206.08 1.003 r(A<->T){all} 0.168206 0.019955 0.000011 0.454360 0.130920 124.47 209.64 1.002 r(C<->G){all} 0.162247 0.018398 0.000004 0.444997 0.127371 191.20 250.93 1.000 r(C<->T){all} 0.171286 0.019738 0.000067 0.453325 0.134819 229.14 251.73 1.000 r(G<->T){all} 0.172984 0.021226 0.000092 0.461301 0.134608 199.15 242.23 1.001 pi(A){all} 0.193666 0.000133 0.171620 0.216255 0.193490 1258.01 1344.81 1.000 pi(C){all} 0.265035 0.000168 0.240586 0.290471 0.264447 1325.93 1368.03 1.001 pi(G){all} 0.307512 0.000194 0.279216 0.333921 0.307182 1209.04 1272.57 1.000 pi(T){all} 0.233787 0.000152 0.209482 0.257182 0.233645 1339.25 1366.33 1.000 alpha{1,2} 0.431762 0.222051 0.000190 1.344371 0.270514 1081.08 1155.22 1.000 alpha{3} 0.470134 0.245529 0.000103 1.453562 0.316371 1020.81 1162.49 1.003 pinvar{all} 0.998687 0.000002 0.995973 0.999999 0.999156 968.69 974.97 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .***.* 8 -- ..**** 9 -- .**... 10 -- ....** 11 -- .**.** 12 -- .*.*** 13 -- .*...* 14 -- ...*.* 15 -- .****. 16 -- ..**.. 17 -- ..*.*. 18 -- ..*..* 19 -- .*.*.. 20 -- ...**. 21 -- .*..*. 22 -- ..*.** 23 -- .***.. 24 -- ..***. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 462 0.153897 0.010364 0.146569 0.161226 2 8 458 0.152565 0.004711 0.149234 0.155896 2 9 456 0.151899 0.024497 0.134577 0.169221 2 10 430 0.143238 0.010364 0.135909 0.150566 2 11 430 0.143238 0.011306 0.135243 0.151233 2 12 429 0.142905 0.012719 0.133911 0.151899 2 13 428 0.142572 0.011306 0.134577 0.150566 2 14 427 0.142239 0.008009 0.136576 0.147901 2 15 427 0.142239 0.002355 0.140573 0.143904 2 16 425 0.141572 0.000471 0.141239 0.141905 2 17 417 0.138907 0.001413 0.137908 0.139907 2 18 415 0.138241 0.007066 0.133245 0.143238 2 19 410 0.136576 0.011306 0.128581 0.144570 2 20 408 0.135909 0.003769 0.133245 0.138574 2 21 398 0.132578 0.001884 0.131246 0.133911 2 22 290 0.096602 0.009422 0.089940 0.103264 2 23 284 0.094604 0.015075 0.083944 0.105263 2 24 281 0.093604 0.012719 0.084610 0.102598 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.096297 0.009673 0.000002 0.293858 0.065383 1.000 2 length{all}[2] 0.100496 0.009803 0.000056 0.303816 0.069255 1.000 2 length{all}[3] 0.098963 0.010005 0.000061 0.291540 0.067231 1.000 2 length{all}[4] 0.097543 0.009523 0.000034 0.294620 0.066985 1.001 2 length{all}[5] 0.100195 0.010906 0.000023 0.308673 0.068839 1.000 2 length{all}[6] 0.098833 0.009571 0.000057 0.297122 0.069460 1.000 2 length{all}[7] 0.098161 0.010374 0.000362 0.310234 0.063207 0.998 2 length{all}[8] 0.101576 0.012489 0.000236 0.307112 0.064942 1.002 2 length{all}[9] 0.101330 0.011153 0.000218 0.317842 0.071073 0.998 2 length{all}[10] 0.101486 0.011812 0.000023 0.341584 0.067723 0.998 2 length{all}[11] 0.099228 0.010683 0.000323 0.301061 0.065322 1.001 2 length{all}[12] 0.095872 0.010558 0.000061 0.307200 0.058072 0.998 2 length{all}[13] 0.095428 0.008275 0.000200 0.297310 0.070350 0.999 2 length{all}[14] 0.093451 0.008322 0.000567 0.304969 0.065586 1.001 2 length{all}[15] 0.095480 0.008031 0.000115 0.281572 0.068515 0.999 2 length{all}[16] 0.101515 0.011145 0.000234 0.327648 0.065853 0.998 2 length{all}[17] 0.103755 0.009091 0.000164 0.303815 0.078099 0.998 2 length{all}[18] 0.102301 0.010030 0.000023 0.307799 0.070995 0.998 2 length{all}[19] 0.103241 0.010570 0.000115 0.318278 0.073828 0.999 2 length{all}[20] 0.105867 0.011102 0.000333 0.309309 0.076872 0.999 2 length{all}[21] 0.096037 0.009642 0.000014 0.312240 0.062471 0.998 2 length{all}[22] 0.096547 0.010559 0.001514 0.326351 0.068018 1.001 2 length{all}[23] 0.099692 0.009828 0.000428 0.295468 0.064555 0.998 2 length{all}[24] 0.091548 0.007712 0.000024 0.274521 0.058019 0.997 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008820 Maximum standard deviation of split frequencies = 0.024497 Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999 Maximum PSRF for parameter values = 1.002 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /-------------------------------------------------------------------- C1 (1) | |------------------------------------------------------------------------ C2 (2) | |---------------------------------------------------------------------- C3 (3) + |--------------------------------------------------------------------- C4 (4) | |----------------------------------------------------------------------- C5 (5) | \------------------------------------------------------------------------ C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 43 trees 90 % credible set contains 90 trees 95 % credible set contains 97 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1146 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 60 patterns at 382 / 382 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 60 patterns at 382 / 382 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 58560 bytes for conP 5280 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.072793 0.051409 0.093344 0.066463 0.019521 0.036996 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1660.962405 Iterating by ming2 Initial: fx= 1660.962405 x= 0.07279 0.05141 0.09334 0.06646 0.01952 0.03700 0.30000 1.30000 1 h-m-p 0.0000 0.0001 917.9456 ++ 1617.276393 m 0.0001 13 | 1/8 2 h-m-p 0.0007 0.0062 59.1742 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 839.6237 ++ 1584.463777 m 0.0000 44 | 2/8 4 h-m-p 0.0008 0.0103 41.5803 -----------.. | 2/8 5 h-m-p 0.0000 0.0000 752.2985 ++ 1562.690155 m 0.0000 75 | 3/8 6 h-m-p 0.0009 0.0191 29.3078 -----------.. | 3/8 7 h-m-p 0.0000 0.0000 652.3536 ++ 1545.546543 m 0.0000 106 | 4/8 8 h-m-p 0.0010 0.0455 20.3948 -----------.. | 4/8 9 h-m-p 0.0000 0.0000 533.4802 ++ 1540.723566 m 0.0000 137 | 5/8 10 h-m-p 0.0005 0.1096 13.3433 -----------.. | 5/8 11 h-m-p 0.0000 0.0001 376.9797 ++ 1532.869169 m 0.0001 168 | 6/8 12 h-m-p 0.1284 8.0000 0.0000 +++ 1532.869169 m 8.0000 180 | 6/8 13 h-m-p 0.0160 8.0000 0.0103 -------N 1532.869169 0 0.0000 200 | 6/8 14 h-m-p 0.0160 8.0000 0.0000 Y 1532.869169 0 0.0160 213 | 6/8 15 h-m-p 0.0160 8.0000 0.0000 +++++ 1532.869169 m 8.0000 229 | 6/8 16 h-m-p 0.0020 1.0006 0.3007 --------C 1532.869169 0 0.0000 250 | 6/8 17 h-m-p 0.0160 8.0000 0.0000 +++++ 1532.869169 m 8.0000 266 | 6/8 18 h-m-p 0.0090 4.4980 0.0669 -------------.. | 6/8 19 h-m-p 0.0160 8.0000 0.0000 +++++ 1532.869169 m 8.0000 306 | 6/8 20 h-m-p 0.0054 2.6857 0.3914 -------Y 1532.869169 0 0.0000 326 | 6/8 21 h-m-p 0.0160 8.0000 0.0005 +++++ 1532.869169 m 8.0000 342 | 6/8 22 h-m-p 0.0125 6.2445 0.9759 -------------.. | 6/8 23 h-m-p 0.0160 8.0000 0.0000 +++++ 1532.869169 m 8.0000 382 | 6/8 24 h-m-p 0.0010 0.5036 2.1281 -----------.. | 6/8 25 h-m-p 0.0160 8.0000 0.0000 +++++ 1532.869169 m 8.0000 418 | 6/8 26 h-m-p 0.0235 8.0000 0.0088 +++++ 1532.869167 m 8.0000 434 | 6/8 27 h-m-p 0.0555 1.2859 1.2647 ----------N 1532.869167 0 0.0000 457 | 6/8 28 h-m-p 0.0160 8.0000 0.0000 +++++ 1532.869167 m 8.0000 471 | 6/8 29 h-m-p 0.0065 3.2648 0.1278 +++++ 1532.869157 m 3.2648 487 | 7/8 30 h-m-p 0.4811 8.0000 0.5712 -----------C 1532.869157 0 0.0000 511 | 7/8 31 h-m-p 0.0160 8.0000 0.0001 --Y 1532.869157 0 0.0003 525 | 7/8 32 h-m-p 0.0160 8.0000 0.0003 -------------.. | 7/8 33 h-m-p 0.0160 8.0000 0.0001 +++++ 1532.869157 m 8.0000 563 | 7/8 34 h-m-p 0.0160 8.0000 0.4270 ---------C 1532.869157 0 0.0000 584 | 7/8 35 h-m-p 0.0160 8.0000 0.0002 -----Y 1532.869157 0 0.0000 601 | 7/8 36 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/8 37 h-m-p 0.0160 8.0000 0.0001 +++++ 1532.869157 m 8.0000 639 | 7/8 38 h-m-p 0.0160 8.0000 0.5898 ---------C 1532.869157 0 0.0000 660 | 7/8 39 h-m-p 0.0160 8.0000 0.0000 ---C 1532.869157 0 0.0001 675 | 7/8 40 h-m-p 0.0160 8.0000 0.0000 +++++ 1532.869157 m 8.0000 690 | 7/8 41 h-m-p 0.0025 1.2520 0.7591 +++++ 1532.868983 m 1.2520 705 | 8/8 42 h-m-p 0.0160 8.0000 0.0000 Y 1532.868983 0 0.0160 717 | 8/8 43 h-m-p 0.0160 8.0000 0.0000 Y 1532.868983 0 0.0160 728 Out.. lnL = -1532.868983 729 lfun, 729 eigenQcodon, 4374 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.090114 0.016716 0.063483 0.026904 0.065423 0.040551 0.000100 0.733616 0.150933 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 16.907348 np = 9 lnL0 = -1641.040611 Iterating by ming2 Initial: fx= 1641.040611 x= 0.09011 0.01672 0.06348 0.02690 0.06542 0.04055 0.00011 0.73362 0.15093 1 h-m-p 0.0000 0.0000 835.2304 ++ 1639.923415 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0002 539.3482 ++ 1605.410877 m 0.0002 26 | 2/9 3 h-m-p 0.0000 0.0001 353.9315 ++ 1592.024924 m 0.0001 38 | 3/9 4 h-m-p 0.0000 0.0002 400.5402 ++ 1573.093474 m 0.0002 50 | 4/9 5 h-m-p 0.0000 0.0000 1514.7925 ++ 1568.595958 m 0.0000 62 | 5/9 6 h-m-p 0.0001 0.0007 84.8107 ++ 1563.184006 m 0.0007 74 | 6/9 7 h-m-p 0.0000 0.0002 266.0346 ++ 1553.388104 m 0.0002 86 | 7/9 8 h-m-p 0.0010 0.0125 16.4641 ++ 1542.157984 m 0.0125 98 | 8/9 9 h-m-p 0.0285 8.0000 1.0949 --------------.. | 8/9 10 h-m-p 0.0000 0.0001 362.2448 ++ 1532.868983 m 0.0001 134 | 9/9 11 h-m-p 0.0160 8.0000 0.0000 Y 1532.868983 0 0.0160 146 | 9/9 12 h-m-p 0.0160 8.0000 0.0000 Y 1532.868983 0 0.0160 158 Out.. lnL = -1532.868983 159 lfun, 477 eigenQcodon, 1908 P(t) Time used: 0:02 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 initial w for M2:NSpselection reset. 0.083030 0.042449 0.107713 0.070473 0.103138 0.034281 0.000100 1.229394 0.516685 0.499205 2.156825 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 9.817349 np = 11 lnL0 = -1690.105629 Iterating by ming2 Initial: fx= 1690.105629 x= 0.08303 0.04245 0.10771 0.07047 0.10314 0.03428 0.00011 1.22939 0.51668 0.49920 2.15682 1 h-m-p 0.0000 0.0000 830.0533 ++ 1688.938400 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0005 425.1834 +++ 1614.172575 m 0.0005 31 | 2/11 3 h-m-p 0.0000 0.0000 826.6377 ++ 1601.298004 m 0.0000 45 | 3/11 4 h-m-p 0.0001 0.0008 294.0467 ++ 1559.496433 m 0.0008 59 | 4/11 5 h-m-p 0.0000 0.0000 34110046.9759 ++ 1546.852551 m 0.0000 73 | 5/11 6 h-m-p 0.0000 0.0000 2210.5282 ++ 1546.467239 m 0.0000 87 | 6/11 7 h-m-p 0.0002 0.0158 11.7103 ----------.. | 6/11 8 h-m-p 0.0000 0.0000 513.7959 ++ 1534.321981 m 0.0000 123 | 7/11 9 h-m-p 0.0160 8.0000 6.0519 -------------.. | 7/11 10 h-m-p 0.0000 0.0000 375.0987 ++ 1532.869135 m 0.0000 162 | 8/11 11 h-m-p 0.0160 8.0000 0.0000 +++++ 1532.869135 m 8.0000 179 | 8/11 12 h-m-p 0.0527 8.0000 0.0015 ++++ 1532.869135 m 8.0000 198 | 8/11 13 h-m-p 0.0160 8.0000 9.6061 ------------C 1532.869135 0 0.0000 227 | 8/11 14 h-m-p 0.0160 8.0000 0.0002 +++++ 1532.869135 m 8.0000 244 | 8/11 15 h-m-p 0.0160 8.0000 1.0577 -------------.. | 8/11 16 h-m-p 0.0160 8.0000 0.0000 +++++ 1532.869135 m 8.0000 289 | 8/11 17 h-m-p 0.0160 8.0000 1.3039 -----------N 1532.869135 0 0.0000 317 | 8/11 18 h-m-p 0.0160 8.0000 0.0013 +++++ 1532.869135 m 8.0000 334 | 8/11 19 h-m-p 0.0160 8.0000 1.6098 ----------C 1532.869135 0 0.0000 361 | 8/11 20 h-m-p 0.0160 8.0000 0.0001 +++++ 1532.869135 m 8.0000 378 | 8/11 21 h-m-p 0.0160 8.0000 9.0043 ------------Y 1532.869135 0 0.0000 407 | 8/11 22 h-m-p 0.0160 8.0000 0.0000 -N 1532.869135 0 0.0005 422 | 8/11 23 h-m-p 0.0160 8.0000 0.0000 --N 1532.869135 0 0.0003 441 Out.. lnL = -1532.869135 442 lfun, 1768 eigenQcodon, 7956 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1532.886638 S = -1532.863832 -0.008752 Calculating f(w|X), posterior probabilities of site classes. did 10 / 60 patterns 0:04 did 20 / 60 patterns 0:04 did 30 / 60 patterns 0:04 did 40 / 60 patterns 0:04 did 50 / 60 patterns 0:04 did 60 / 60 patterns 0:04 Time used: 0:04 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.081379 0.094884 0.094539 0.017847 0.087959 0.090743 0.000100 0.476890 1.498242 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 20.801948 np = 9 lnL0 = -1698.174710 Iterating by ming2 Initial: fx= 1698.174710 x= 0.08138 0.09488 0.09454 0.01785 0.08796 0.09074 0.00011 0.47689 1.49824 1 h-m-p 0.0000 0.0000 822.3942 ++ 1697.690226 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0037 96.2910 +++++ 1670.192267 m 0.0037 29 | 2/9 3 h-m-p 0.0002 0.0010 185.6285 ++ 1558.455510 m 0.0010 41 | 3/9 4 h-m-p 0.0005 0.0023 26.9565 ++ 1556.070993 m 0.0023 53 | 4/9 5 h-m-p 0.0000 0.0000 230.2054 ++ 1554.915392 m 0.0000 65 | 5/9 6 h-m-p 0.0000 0.0010 48.4815 +++ 1551.309647 m 0.0010 78 | 6/9 7 h-m-p 0.0008 0.0039 21.8602 -----------.. | 6/9 8 h-m-p 0.0000 0.0001 356.7809 ++ 1532.869011 m 0.0001 111 | 7/9 9 h-m-p 1.6000 8.0000 0.0000 ++ 1532.869011 m 8.0000 123 | 7/9 10 h-m-p 0.0964 8.0000 0.0006 ---------C 1532.869011 0 0.0000 146 Out.. lnL = -1532.869011 147 lfun, 1617 eigenQcodon, 8820 P(t) Time used: 0:06 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 initial w for M8:NSbetaw>1 reset. 0.015522 0.018826 0.105855 0.091312 0.019447 0.096385 0.000100 0.900000 0.506585 1.544557 2.033649 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 15.901844 np = 11 lnL0 = -1650.392582 Iterating by ming2 Initial: fx= 1650.392582 x= 0.01552 0.01883 0.10585 0.09131 0.01945 0.09639 0.00011 0.90000 0.50659 1.54456 2.03365 1 h-m-p 0.0000 0.0000 763.1329 ++ 1649.824707 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0001 629.4428 ++ 1619.826210 m 0.0001 30 | 2/11 3 h-m-p 0.0000 0.0000 357.0172 ++ 1614.366421 m 0.0000 44 | 3/11 4 h-m-p 0.0000 0.0001 145.5170 ++ 1613.117175 m 0.0001 58 | 4/11 5 h-m-p 0.0000 0.0004 578.7933 +++ 1539.392081 m 0.0004 73 | 5/11 6 h-m-p 0.0001 0.0004 184.7225 ++ 1535.812451 m 0.0004 87 | 6/11 7 h-m-p 0.0000 0.0002 1176.3787 ++ 1534.154360 m 0.0002 101 | 7/11 8 h-m-p 0.0035 0.0461 29.0676 ------------.. | 7/11 9 h-m-p 0.0000 0.0000 373.3885 ++ 1532.869113 m 0.0000 139 | 8/11 10 h-m-p 0.0400 8.0000 0.0000 ++++ 1532.869113 m 8.0000 155 | 8/11 11 h-m-p 0.0160 8.0000 0.0173 ------N 1532.869113 0 0.0000 178 | 8/11 12 h-m-p 0.0160 8.0000 0.0000 --Y 1532.869113 0 0.0003 197 | 8/11 13 h-m-p 0.0160 8.0000 0.0009 +++++ 1532.869113 m 8.0000 217 | 8/11 14 h-m-p 0.0107 5.3642 0.8293 --------Y 1532.869113 0 0.0000 242 | 8/11 15 h-m-p 0.0160 8.0000 0.0000 --Y 1532.869113 0 0.0003 261 | 8/11 16 h-m-p 0.0160 8.0000 0.0001 ----N 1532.869113 0 0.0000 282 Out.. lnL = -1532.869113 283 lfun, 3396 eigenQcodon, 18678 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1532.901641 S = -1532.864744 -0.016297 Calculating f(w|X), posterior probabilities of site classes. did 10 / 60 patterns 0:11 did 20 / 60 patterns 0:11 did 30 / 60 patterns 0:11 did 40 / 60 patterns 0:11 did 50 / 60 patterns 0:12 did 60 / 60 patterns 0:12 Time used: 0:12 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=382 NC_011896_1_WP_010907550_1_133_MLBR_RS00660 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR NC_002677_1_NP_301225_1_97_ML0131 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR ************************************************** NC_011896_1_WP_010907550_1_133_MLBR_RS00660 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG NC_002677_1_NP_301225_1_97_ML0131 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG ************************************************** NC_011896_1_WP_010907550_1_133_MLBR_RS00660 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE NC_002677_1_NP_301225_1_97_ML0131 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ************************************************** NC_011896_1_WP_010907550_1_133_MLBR_RS00660 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR NC_002677_1_NP_301225_1_97_ML0131 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR ************************************************** NC_011896_1_WP_010907550_1_133_MLBR_RS00660 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR NC_002677_1_NP_301225_1_97_ML0131 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR ************************************************** NC_011896_1_WP_010907550_1_133_MLBR_RS00660 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD NC_002677_1_NP_301225_1_97_ML0131 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD ************************************************** NC_011896_1_WP_010907550_1_133_MLBR_RS00660 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL NC_002677_1_NP_301225_1_97_ML0131 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL ************************************************** NC_011896_1_WP_010907550_1_133_MLBR_RS00660 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL NC_002677_1_NP_301225_1_97_ML0131 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 VVINGSLVNSSLRKTVSALLPHARVLRGLKKL ********************************
>NC_011896_1_WP_010907550_1_133_MLBR_RS00660 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG >NC_002677_1_NP_301225_1_97_ML0131 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG >NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG >NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG >NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG >NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 GTGGCTGGATTTCGTTTCGGCTTTGTTGATGCGCTTGTGCATACGCTATT TCCACCAAGCCTGCCGGCGCGGGCCAGTATCGTGTCCGGCGCAGTACTGG GCGCTGATTCGTACTGGGTCGGCGATCATTTGAACGCGCTGGTGCCGCGT TCAGTCGCAACACCTAAATACCTCGGAGTTGCGGCGAAGGTGGTACCCAA GATCGACGCCAACTATGAGCCGTGGACGATGCTGGGAAACCTCGCCGCTG GGAATCGGCTCAACGGCCTGCGACTGGGTGTGTGCGTCACTGACGCTGGT CGCCGCAATCCAGCAGTCACGGCGCAAGCCGCTGCTACTCTGCATCTACT TACCCGGGGCAAAGCCATGCTTGGTATCGGTGTTGGGGAGCGTGAAGGCA ACGAGCCTTACGGCGTAGAGTGGACAAAGCCCGTTGCGCGGTTCCAAGAA GCTTTGGCTACAATTCGCGCGTTGTGGGATTCAAACGGGGAACTGGTTTC GCGTGAATCTCAATTCTTTCCTCTACATAACGCCTTGTTCGATCTTCCGC CATATCGTGGGAAATGGCCCGAAATCTGGGTCGCGGCACACGGGCCGCGG ATGCTGCAGGCCACTGGACGCTATGCCGACGCCTGGATTCCGATTGTTTT GGTTCGTCCCACCGACTACAGTTGTGCACTCGAAGTTGTGCGTACCGCGG CGTCCGACGCTGGACGTGACCCAATGTCGATTACCCCTGCTGCTGTGCGC GGTATCATCACTGGTCGGACTCGCGATGACGTGGATGAGGCGTTGGACTC TGTCCTCGTGAGAATGATCGCGCTCGGAGTACCTGGGGAAGCTTGGGCGC GCCACGGTGTTGAGCATCCAATGGGAGCCGATTTCGCTGGTGTGCAGGAC ATCATTCCTCAAACCATAGATGAGGAGACAGTTGTGTCATATGCGGCTAA AGTCCCGGCCGCACTTATGAAAGAAGTCCTTTTTAGTGGGACGCCTGAGG AAGTCATCGATCAAGTAGCGGAATGGCGCGATCACGGCCTGAAGTATCTA GTTGTTATCAACGGCAGTCTAGTTAACTCGAGTTTGCGTAAGACTGTTTC GGCGCTCCTGCCGCACGCCAGGGTACTGCGTGGACTCAAGAAACTG
>NC_011896_1_WP_010907550_1_133_MLBR_RS00660 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >NC_002677_1_NP_301225_1_97_ML0131 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL >NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 VAGFRFGFVDALVHTLFPPSLPARASIVSGAVLGADSYWVGDHLNALVPR SVATPKYLGVAAKVVPKIDANYEPWTMLGNLAAGNRLNGLRLGVCVTDAG RRNPAVTAQAAATLHLLTRGKAMLGIGVGEREGNEPYGVEWTKPVARFQE ALATIRALWDSNGELVSRESQFFPLHNALFDLPPYRGKWPEIWVAAHGPR MLQATGRYADAWIPIVLVRPTDYSCALEVVRTAASDAGRDPMSITPAAVR GIITGRTRDDVDEALDSVLVRMIALGVPGEAWARHGVEHPMGADFAGVQD IIPQTIDEETVVSYAAKVPAALMKEVLFSGTPEEVIDQVAEWRDHGLKYL VVINGSLVNSSLRKTVSALLPHARVLRGLKKL
#NEXUS [ID: 0282519931] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907550_1_133_MLBR_RS00660 NC_002677_1_NP_301225_1_97_ML0131 NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 ; end; begin trees; translate 1 NC_011896_1_WP_010907550_1_133_MLBR_RS00660, 2 NC_002677_1_NP_301225_1_97_ML0131, 3 NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020, 4 NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080, 5 NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680, 6 NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06538331,2:0.06925534,3:0.06723093,4:0.06698543,5:0.06883928,6:0.06945987); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06538331,2:0.06925534,3:0.06723093,4:0.06698543,5:0.06883928,6:0.06945987); end;
Estimated marginal likelihoods for runs sampled in files "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1574.50 -1578.73 2 -1574.48 -1577.57 -------------------------------------- TOTAL -1574.49 -1578.31 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/3res/ML0131/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.891196 0.092298 0.306645 1.445593 0.861556 1242.51 1363.71 1.000 r(A<->C){all} 0.154712 0.016761 0.000037 0.412553 0.121136 187.08 217.27 1.001 r(A<->G){all} 0.170565 0.019405 0.000144 0.450456 0.133912 165.49 206.08 1.003 r(A<->T){all} 0.168206 0.019955 0.000011 0.454360 0.130920 124.47 209.64 1.002 r(C<->G){all} 0.162247 0.018398 0.000004 0.444997 0.127371 191.20 250.93 1.000 r(C<->T){all} 0.171286 0.019738 0.000067 0.453325 0.134819 229.14 251.73 1.000 r(G<->T){all} 0.172984 0.021226 0.000092 0.461301 0.134608 199.15 242.23 1.001 pi(A){all} 0.193666 0.000133 0.171620 0.216255 0.193490 1258.01 1344.81 1.000 pi(C){all} 0.265035 0.000168 0.240586 0.290471 0.264447 1325.93 1368.03 1.001 pi(G){all} 0.307512 0.000194 0.279216 0.333921 0.307182 1209.04 1272.57 1.000 pi(T){all} 0.233787 0.000152 0.209482 0.257182 0.233645 1339.25 1366.33 1.000 alpha{1,2} 0.431762 0.222051 0.000190 1.344371 0.270514 1081.08 1155.22 1.000 alpha{3} 0.470134 0.245529 0.000103 1.453562 0.316371 1020.81 1162.49 1.003 pinvar{all} 0.998687 0.000002 0.995973 0.999999 0.999156 968.69 974.97 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0131/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 382 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 5 5 5 5 5 5 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 5 5 5 5 5 5 | Cys TGT 1 1 1 1 1 1 TTC 5 5 5 5 5 5 | TCC 2 2 2 2 2 2 | TAC 4 4 4 4 4 4 | TGC 1 1 1 1 1 1 Leu TTA 0 0 0 0 0 0 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 7 7 7 7 7 7 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 9 9 9 9 9 9 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 6 6 6 6 6 6 | Pro CCT 7 7 7 7 7 7 | His CAT 5 5 5 5 5 5 | Arg CGT 10 10 10 10 10 10 CTC 8 8 8 8 8 8 | CCC 4 4 4 4 4 4 | CAC 4 4 4 4 4 4 | CGC 8 8 8 8 8 8 CTA 5 5 5 5 5 5 | CCA 6 6 6 6 6 6 | Gln CAA 5 5 5 5 5 5 | CGA 1 1 1 1 1 1 CTG 13 13 13 13 13 13 | CCG 8 8 8 8 8 8 | CAG 2 2 2 2 2 2 | CGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 5 5 5 5 5 | Thr ACT 6 6 6 6 6 6 | Asn AAT 2 2 2 2 2 2 | Ser AGT 5 5 5 5 5 5 ATC 10 10 10 10 10 10 | ACC 5 5 5 5 5 5 | AAC 9 9 9 9 9 9 | AGC 1 1 1 1 1 1 ATA 1 1 1 1 1 1 | ACA 4 4 4 4 4 4 | Lys AAA 6 6 6 6 6 6 | Arg AGA 1 1 1 1 1 1 Met ATG 7 7 7 7 7 7 | ACG 4 4 4 4 4 4 | AAG 6 6 6 6 6 6 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 14 14 14 14 14 14 | Ala GCT 14 14 14 14 14 14 | Asp GAT 11 11 11 11 11 11 | Gly GGT 8 8 8 8 8 8 GTC 9 9 9 9 9 9 | GCC 12 12 12 12 12 12 | GAC 9 9 9 9 9 9 | GGC 10 10 10 10 10 10 GTA 6 6 6 6 6 6 | GCA 6 6 6 6 6 6 | Glu GAA 10 10 10 10 10 10 | GGA 8 8 8 8 8 8 GTG 12 12 12 12 12 12 | GCG 17 17 17 17 17 17 | GAG 9 9 9 9 9 9 | GGG 7 7 7 7 7 7 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907550_1_133_MLBR_RS00660 position 1: T:0.12827 C:0.25654 A:0.19110 G:0.42408 position 2: T:0.29581 C:0.27487 A:0.22775 G:0.20157 position 3: T:0.27749 C:0.26440 A:0.16230 G:0.29581 Average T:0.23386 C:0.26527 A:0.19372 G:0.30716 #2: NC_002677_1_NP_301225_1_97_ML0131 position 1: T:0.12827 C:0.25654 A:0.19110 G:0.42408 position 2: T:0.29581 C:0.27487 A:0.22775 G:0.20157 position 3: T:0.27749 C:0.26440 A:0.16230 G:0.29581 Average T:0.23386 C:0.26527 A:0.19372 G:0.30716 #3: NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020 position 1: T:0.12827 C:0.25654 A:0.19110 G:0.42408 position 2: T:0.29581 C:0.27487 A:0.22775 G:0.20157 position 3: T:0.27749 C:0.26440 A:0.16230 G:0.29581 Average T:0.23386 C:0.26527 A:0.19372 G:0.30716 #4: NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080 position 1: T:0.12827 C:0.25654 A:0.19110 G:0.42408 position 2: T:0.29581 C:0.27487 A:0.22775 G:0.20157 position 3: T:0.27749 C:0.26440 A:0.16230 G:0.29581 Average T:0.23386 C:0.26527 A:0.19372 G:0.30716 #5: NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680 position 1: T:0.12827 C:0.25654 A:0.19110 G:0.42408 position 2: T:0.29581 C:0.27487 A:0.22775 G:0.20157 position 3: T:0.27749 C:0.26440 A:0.16230 G:0.29581 Average T:0.23386 C:0.26527 A:0.19372 G:0.30716 #6: NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705 position 1: T:0.12827 C:0.25654 A:0.19110 G:0.42408 position 2: T:0.29581 C:0.27487 A:0.22775 G:0.20157 position 3: T:0.27749 C:0.26440 A:0.16230 G:0.29581 Average T:0.23386 C:0.26527 A:0.19372 G:0.30716 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 30 | Ser S TCT 12 | Tyr Y TAT 30 | Cys C TGT 6 TTC 30 | TCC 12 | TAC 24 | TGC 6 Leu L TTA 0 | TCA 18 | *** * TAA 0 | *** * TGA 0 TTG 42 | TCG 30 | TAG 0 | Trp W TGG 54 ------------------------------------------------------------------------------ Leu L CTT 36 | Pro P CCT 42 | His H CAT 30 | Arg R CGT 60 CTC 48 | CCC 24 | CAC 24 | CGC 48 CTA 30 | CCA 36 | Gln Q CAA 30 | CGA 6 CTG 78 | CCG 48 | CAG 12 | CGG 36 ------------------------------------------------------------------------------ Ile I ATT 30 | Thr T ACT 36 | Asn N AAT 12 | Ser S AGT 30 ATC 60 | ACC 30 | AAC 54 | AGC 6 ATA 6 | ACA 24 | Lys K AAA 36 | Arg R AGA 6 Met M ATG 42 | ACG 24 | AAG 36 | AGG 6 ------------------------------------------------------------------------------ Val V GTT 84 | Ala A GCT 84 | Asp D GAT 66 | Gly G GGT 48 GTC 54 | GCC 72 | GAC 54 | GGC 60 GTA 36 | GCA 36 | Glu E GAA 60 | GGA 48 GTG 72 | GCG 102 | GAG 54 | GGG 42 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.12827 C:0.25654 A:0.19110 G:0.42408 position 2: T:0.29581 C:0.27487 A:0.22775 G:0.20157 position 3: T:0.27749 C:0.26440 A:0.16230 G:0.29581 Average T:0.23386 C:0.26527 A:0.19372 G:0.30716 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1532.868983 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907550_1_133_MLBR_RS00660: 0.000004, NC_002677_1_NP_301225_1_97_ML0131: 0.000004, NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020: 0.000004, NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080: 0.000004, NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680: 0.000004, NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 omega (dN/dS) = 0.00010 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 843.1 302.9 0.0001 0.0000 0.0000 0.0 0.0 7..2 0.000 843.1 302.9 0.0001 0.0000 0.0000 0.0 0.0 7..3 0.000 843.1 302.9 0.0001 0.0000 0.0000 0.0 0.0 7..4 0.000 843.1 302.9 0.0001 0.0000 0.0000 0.0 0.0 7..5 0.000 843.1 302.9 0.0001 0.0000 0.0000 0.0 0.0 7..6 0.000 843.1 302.9 0.0001 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1532.868983 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907550_1_133_MLBR_RS00660: 0.000004, NC_002677_1_NP_301225_1_97_ML0131: 0.000004, NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020: 0.000004, NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080: 0.000004, NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680: 0.000004, NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 843.1 302.9 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 843.1 302.9 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 843.1 302.9 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 843.1 302.9 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 843.1 302.9 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 843.1 302.9 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:02 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1532.869135 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.586315 0.251853 0.000001 2.253011 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907550_1_133_MLBR_RS00660: 0.000004, NC_002677_1_NP_301225_1_97_ML0131: 0.000004, NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020: 0.000004, NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080: 0.000004, NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680: 0.000004, NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.58631 0.25185 0.16183 w: 0.00000 1.00000 2.25301 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 843.1 302.9 0.6165 0.0000 0.0000 0.0 0.0 7..2 0.000 843.1 302.9 0.6165 0.0000 0.0000 0.0 0.0 7..3 0.000 843.1 302.9 0.6165 0.0000 0.0000 0.0 0.0 7..4 0.000 843.1 302.9 0.6165 0.0000 0.0000 0.0 0.0 7..5 0.000 843.1 302.9 0.6165 0.0000 0.0000 0.0 0.0 7..6 0.000 843.1 302.9 0.6165 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907550_1_133_MLBR_RS00660) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907550_1_133_MLBR_RS00660) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:04 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1532.869011 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.074638 1.302543 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907550_1_133_MLBR_RS00660: 0.000004, NC_002677_1_NP_301225_1_97_ML0131: 0.000004, NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020: 0.000004, NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080: 0.000004, NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680: 0.000004, NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.07464 q = 1.30254 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00002 0.00022 0.00210 0.01436 0.07825 0.38162 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 843.1 302.9 0.0477 0.0000 0.0000 0.0 0.0 7..2 0.000 843.1 302.9 0.0477 0.0000 0.0000 0.0 0.0 7..3 0.000 843.1 302.9 0.0477 0.0000 0.0000 0.0 0.0 7..4 0.000 843.1 302.9 0.0477 0.0000 0.0000 0.0 0.0 7..5 0.000 843.1 302.9 0.0477 0.0000 0.0000 0.0 0.0 7..6 0.000 843.1 302.9 0.0477 0.0000 0.0000 0.0 0.0 Time used: 0:06 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1532.869113 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.811554 0.005000 1.636049 2.256986 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907550_1_133_MLBR_RS00660: 0.000004, NC_002677_1_NP_301225_1_97_ML0131: 0.000004, NZ_LVXE01000070_1_WP_010907550_1_2577_A3216_RS13020: 0.000004, NZ_LYPH01000036_1_WP_010907550_1_1477_A8144_RS07080: 0.000004, NZ_CP029543_1_WP_010907550_1_130_DIJ64_RS00680: 0.000004, NZ_AP014567_1_WP_010907550_1_135_JK2ML_RS00705: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.81155 p = 0.00500 q = 1.63605 (p1 = 0.18845) w = 2.25699 MLEs of dN/dS (w) for site classes (K=11) p: 0.08116 0.08116 0.08116 0.08116 0.08116 0.08116 0.08116 0.08116 0.08116 0.08116 0.18845 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.25699 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 843.1 302.9 0.4253 0.0000 0.0000 0.0 0.0 7..2 0.000 843.1 302.9 0.4253 0.0000 0.0000 0.0 0.0 7..3 0.000 843.1 302.9 0.4253 0.0000 0.0000 0.0 0.0 7..4 0.000 843.1 302.9 0.4253 0.0000 0.0000 0.0 0.0 7..5 0.000 843.1 302.9 0.4253 0.0000 0.0000 0.0 0.0 7..6 0.000 843.1 302.9 0.4253 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907550_1_133_MLBR_RS00660) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907550_1_133_MLBR_RS00660) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.097 Time used: 0:12
Model 1: NearlyNeutral -1532.868983 Model 2: PositiveSelection -1532.869135 Model 0: one-ratio -1532.868983 Model 7: beta -1532.869011 Model 8: beta&w>1 -1532.869113 Model 0 vs 1 0.0 Model 2 vs 1 3.0399999968722113E-4 Model 8 vs 7 2.0399999993969686E-4