--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 25 13:23:01 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/346/PGRP-LB-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1692.83         -1704.06
2      -1692.97         -1702.35
--------------------------------------
TOTAL    -1692.90         -1703.53
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.509316    0.007044    0.359800    0.679892    0.500719   1202.45   1338.89    1.000
r(A<->C){all}   0.170758    0.001571    0.095516    0.247501    0.168197   1006.81   1016.53    1.000
r(A<->G){all}   0.197671    0.002124    0.113098    0.287850    0.194573    838.12    939.26    1.000
r(A<->T){all}   0.125383    0.002457    0.037241    0.223956    0.121201    798.88    816.36    1.002
r(C<->G){all}   0.091126    0.000620    0.046639    0.141531    0.089217    759.34    950.59    1.000
r(C<->T){all}   0.290206    0.002857    0.188865    0.395164    0.287919    776.53    813.18    1.000
r(G<->T){all}   0.124855    0.001628    0.052527    0.204650    0.122711    802.35    861.93    1.000
pi(A){all}      0.211329    0.000222    0.181623    0.240371    0.210996   1152.34   1181.95    1.000
pi(C){all}      0.343335    0.000302    0.307559    0.375774    0.343214    721.27   1069.15    1.001
pi(G){all}      0.279740    0.000281    0.247211    0.312450    0.279161   1062.70   1170.61    1.000
pi(T){all}      0.165596    0.000186    0.137426    0.191083    0.165414    749.18    996.92    1.001
alpha{1,2}      0.098621    0.003076    0.000341    0.187798    0.100953   1085.13   1155.32    1.000
alpha{3}        1.959812    0.576557    0.739869    3.481837    1.832250   1391.28   1446.14    1.000
pinvar{all}     0.308807    0.012414    0.080070    0.496071    0.315026    880.50    900.15    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1532.872708
Model 2: PositiveSelection	-1532.75116
Model 0: one-ratio	-1547.550018
Model 3: discrete	-1532.567386
Model 7: beta	-1534.322648
Model 8: beta&w>1	-1532.582913


Model 0 vs 1	29.354619999999613

Model 2 vs 1	0.24309600000015053

Model 8 vs 7	3.4794700000002194
>C1
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGVSSTTAPVVPHVHPQAA
APQKPHQSPPAAPKVooooo
>C2
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGESSTAAPVVPHVHAQAA
APQTPHQSPPAAPKVooooo
>C3
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGVSSTAAPVVPHVHAQAA
APQTPHQSPPAAPKVooooo
>C4
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
ATQTPLAQSPPAAPKVoooo
>C5
MQQANLGTARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVCYSTP
DCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAHAPKY
NDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLLGHRQ
VRDTECPGGRLFAEISSWPHFTHINDTEGVSSTKAPVEPHVHPQAATQQT
PPKSPPAAPKVooooooooo
>C6
MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGSTPVPIEPHAHPQAASQ
TPPQSPPQSPPHAPAAAPKV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=232 

C1              MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
C2              MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
C3              MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
C4              MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
C5              MQQANLG----TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
C6              MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
                **:****    ******************:**:**************.**

C1              YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
C2              YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
C3              YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
C4              YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
C5              YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH
C6              YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
                *:**:**********************************:******:***

C1              APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
C2              APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
C3              APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
C4              APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
C5              APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL
C6              APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
                ******:***********************::**:***************

C1              GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQA
C2              GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQA
C3              GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQA
C4              GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
C5              GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQA
C6              GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQA
                ********************.******:. ::*    * .*: **.*.:*

C1              AAP---QKPHQSPP----AAPKVooooo----
C2              AAP---QTPHQSPP----AAPKVooooo----
C3              AAP---QTPHQSPP----AAPKVooooo----
C4              ATQ---TPLAQSPP----AAPKVoooo-----
C5              ATQ---QTPPKSPP----AAPKVooooooooo
C6              ASQTPPQSPPQSPPHAPAAAPKV---------
                *:        :***    *****         




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  220 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  220 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [7802]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [7802]--->[7386]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.333 Mb, Max= 30.644 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQA
AAP---QKPHQSPP----AAPKVooooo----
>C2
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQA
AAP---QTPHQSPP----AAPKVooooo----
>C3
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQA
AAP---QTPHQSPP----AAPKVooooo----
>C4
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
ATQ---TPLAQSPP----AAPKVoooo-----
>C5
MQQANLG----TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH
APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQA
ATQ---QTPPKSPP----AAPKVooooooooo
>C6
MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQA
ASQTPPQSPPQSPPHAPAAAPKV---------

FORMAT of file /tmp/tmp6191815364378228873aln Not Supported[FATAL:T-COFFEE]
>C1
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQA
AAP---QKPHQSPP----AAPKVooooo----
>C2
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQA
AAP---QTPHQSPP----AAPKVooooo----
>C3
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQA
AAP---QTPHQSPP----AAPKVooooo----
>C4
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
ATQ---TPLAQSPP----AAPKVoooo-----
>C5
MQQANLG----TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH
APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQA
ATQ---QTPPKSPP----AAPKVooooooooo
>C6
MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQA
ASQTPPQSPPQSPPHAPAAAPKV---------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:232 S:95 BS:232
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 95.45 C1	 C2	 95.45
TOP	    1    0	 95.45 C2	 C1	 95.45
BOT	    0    2	 97.27 C1	 C3	 97.27
TOP	    2    0	 97.27 C3	 C1	 97.27
BOT	    0    3	 91.78 C1	 C4	 91.78
TOP	    3    0	 91.78 C4	 C1	 91.78
BOT	    0    4	 95.37 C1	 C5	 95.37
TOP	    4    0	 95.37 C5	 C1	 95.37
BOT	    0    5	 92.02 C1	 C6	 92.02
TOP	    5    0	 92.02 C6	 C1	 92.02
BOT	    1    2	 98.18 C2	 C3	 98.18
TOP	    2    1	 98.18 C3	 C2	 98.18
BOT	    1    3	 91.78 C2	 C4	 91.78
TOP	    3    1	 91.78 C4	 C2	 91.78
BOT	    1    4	 92.13 C2	 C5	 92.13
TOP	    4    1	 92.13 C5	 C2	 92.13
BOT	    1    5	 90.61 C2	 C6	 90.61
TOP	    5    1	 90.61 C6	 C2	 90.61
BOT	    2    3	 92.69 C3	 C4	 92.69
TOP	    3    2	 92.69 C4	 C3	 92.69
BOT	    2    4	 93.98 C3	 C5	 93.98
TOP	    4    2	 93.98 C5	 C3	 93.98
BOT	    2    5	 92.02 C3	 C6	 92.02
TOP	    5    2	 92.02 C6	 C3	 92.02
BOT	    3    4	 91.16 C4	 C5	 91.16
TOP	    4    3	 91.16 C5	 C4	 91.16
BOT	    3    5	 88.73 C4	 C6	 88.73
TOP	    5    3	 88.73 C6	 C4	 88.73
BOT	    4    5	 91.87 C5	 C6	 91.87
TOP	    5    4	 91.87 C6	 C5	 91.87
AVG	 0	 C1	  *	 94.38
AVG	 1	 C2	  *	 93.63
AVG	 2	 C3	  *	 94.83
AVG	 3	 C4	  *	 91.23
AVG	 4	 C5	  *	 92.90
AVG	 5	 C6	  *	 91.05
TOT	 TOT	  *	 93.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTGTC
C2              ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC
C3              ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC
C4              ATGCAGCAGGCAAATCTGGGCGATGGTGTGGCCACCGCCCGACTGCTGTC
C5              ATGCAGCAGGCGAATCTGGGC------------ACCGCCCGGCTTCTGTC
C6              ATGCAGCATGCGAATTTGGGCGATGGAGCGGCCACCGCTCGACTTCTGTC
                ******** **.*** *****            ***** ** ** ** **

C1              CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGAGCACTTCCAGG
C2              CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCTGTGGACCACTTCCAGG
C3              CCGATCCGACTGGGGTGCACGGCTGCCCAAGTCCGTGGAGCACTTCCAGG
C4              CAGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGACCACTTTCAGG
C5              CCGATCCGACTGGGGTGCCCGCCTGCCCAAGTCCGTGGAGCACTTTCAAG
C6              CCGCTCCGACTGGGGCGCCCGTCTGCCCAAGTCCGTGGAGCACTTCGAGG
                *.*.*********** **.** *********** ***** *****  *.*

C1              GTCCCGCGCCCTACGTCATCATCCATCACTCGTACATGCCGGCCGTGTGC
C2              GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCGGCCGTGTGC
C3              GACCAGCGCCTTACGTCATCATCCACCACTCGTATATGCCGGCCGTGTGC
C4              GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCAGGCGTGTGC
C5              GACCCGCGCCCTACGTGATCATCCACCACTCGTACATGCCAGCCGTGTGC
C6              GTCCCGCCCCCTACGTGATCATCCACCACTCTTACATGCCGGCGGTGTGC
                *:**.** ** ***** ******** ***** ** *****.*  ******

C1              TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
C2              TACTCCACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
C3              TACTCAACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTTCA
C4              TACTCCACTCCGGAGTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
C5              TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
C6              TATACCACTCCCGACTGCATGAAGAGCATGCGCGACATGCAGGACTTCCA
                ** :*.***** ** ***************** ************** **

C1              TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
C2              TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
C3              TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
C4              CCAGCTGGAGCGCGGATGGAACGATATCGGATATAGCTTTGGCATCGGCG
C5              CCAGCTGGAGCGCGGTTGGAACGATATCGGATATAGCTTTGGCATCGGCG
C6              CCAGCTGGAGCGCGGTTGGAACGACATCGGCTATAGCTTCGGCATCGGCG
                 **************:******** ** ** ******** **********

C1              GCGATGGCATGATTTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
C2              GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
C3              GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
C4              GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCGTCGGAGCTCAT
C5              GCGATGGCATGATCTACGCAGGCAGGGGATTCAATGTCATCGGAGCTCAT
C6              GCGATGGCATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGCTCAT
                ************* ***.*.**.*********** ** .***********

C1              GCACCCAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG
C2              GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
C3              GCACCGAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG
C4              GCGCCGAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
C5              GCGCCGAAGTACAATGACAGGAGCGTGGGCATCGTGCTGATCGGAGATTG
C6              GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
                **.** *************.************ *****************

C1              GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
C2              GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
C3              GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
C4              GAGAACTGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAGGAACCTGA
C5              GAGAACTGAACTTCCGCCCAAGCAGATGCTGGATGCGGCCAAGGACCTGA
C6              GAGAACTGAACTGCCGCCCAAACAGATGCTGGACGCGGCCAAAAACCTGA
                ****** ***** ********.*********** *******...******

C1              TCGCCTTTGGCGTTTTCAAGGGCTACATTGACCCTGCCTACAAGCTGCTG
C2              TCGCCTTCGGAGTTTTCAAGGGCTACATTGACCCCGCCTACAAACTGCTG
C3              TCGCCTTCGGCGTTTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
C4              TCTCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
C5              TCGCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
C6              TCGCCTTCGGCGTGTTCAAGGGCTACATTGACCCCGCATACAAGCTGCTG
                ** **** ** ** ******************** **.*****.******

C1              GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTGTTCGC
C2              GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTCTTCGC
C3              GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTCTTCGC
C4              GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTGTTTGC
C5              GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGGGGCCGCCTGTTTGC
C6              GGCCACCGACAGGTTCGTGACACCGAGTGTCCCGGAGGCAGGCTGTTCGC
                ************** ** ** *********** ** ***.* ** ** **

C1              CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG
C2              CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCAGCGACGGCG
C3              CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCG
C4              CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAGCGAAACCGAAGGCG
C5              CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG
C6              GGAGATCTCCGGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCA
                 *********.********************.***.**..* ***.***.

C1              TC---AGCAGCACCACGGCGCCCGTCGTGCCCCACGTCCATCCACAGGCG
C2              AG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG
C3              TG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG
C4              TAGTTAGCAGCACTGCTGCGCCCGTCGAGCCCCACGTCCATCCAAAGGCG
C5              TT---AGCAGTACGAAGGCGCCGGTCGAGCCCCACGTCCATCCACAGGCG
C6              GC---------ACCCCCGTCCCCATTGAACCGCACGCACATCCCCAGGCG
                           **  . *  ** .* *:.** ** * .*** *..*****

C1              GCAGCACCA---------CAAAAGCCGCACCAATCCCCGCCA--------
C2              GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA--------
C3              GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA--------
C4              GCAACACAA---------ACGCCACTCGCCCAATCCCCGCCA--------
C5              GCAACACAA---------CAAACGCCGCCCAAATCCCCGCCA--------
C6              GCGTCCCAAACGCCACCCCAATCACCACCCCAATCGCCACCCCATGCCCC
                **. *.*.*         ... ..*   .*.**** **.**.        

C1              ----GCTGCGCCCAAGGTC---------------------------
C2              ----GCTGCGCCCAAGGTC---------------------------
C3              ----GCTGCGCCCAAGGTC---------------------------
C4              ----GCTGCGCCCAAGGTC---------------------------
C5              ----GCTGCGCCCAAGGTC---------------------------
C6              GGCAGCTGCGCCCAAGGTC---------------------------
                    ***************                           



>C1
ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTGTC
CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGAGCACTTCCAGG
GTCCCGCGCCCTACGTCATCATCCATCACTCGTACATGCCGGCCGTGTGC
TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
GCGATGGCATGATTTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCACCCAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG
GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
TCGCCTTTGGCGTTTTCAAGGGCTACATTGACCCTGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTGTTCGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG
TC---AGCAGCACCACGGCGCCCGTCGTGCCCCACGTCCATCCACAGGCG
GCAGCACCA---------CAAAAGCCGCACCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>C2
ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC
CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCTGTGGACCACTTCCAGG
GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCGGCCGTGTGC
TACTCCACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
TCGCCTTCGGAGTTTTCAAGGGCTACATTGACCCCGCCTACAAACTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTCTTCGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCAGCGACGGCG
AG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG
GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>C3
ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC
CCGATCCGACTGGGGTGCACGGCTGCCCAAGTCCGTGGAGCACTTCCAGG
GACCAGCGCCTTACGTCATCATCCACCACTCGTATATGCCGGCCGTGTGC
TACTCAACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTTCA
TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCACCGAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG
GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
TCGCCTTCGGCGTTTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTCTTCGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCG
TG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG
GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>C4
ATGCAGCAGGCAAATCTGGGCGATGGTGTGGCCACCGCCCGACTGCTGTC
CAGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGACCACTTTCAGG
GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCAGGCGTGTGC
TACTCCACTCCGGAGTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
CCAGCTGGAGCGCGGATGGAACGATATCGGATATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCGTCGGAGCTCAT
GCGCCGAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACTGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAGGAACCTGA
TCTCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTGTTTGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAGCGAAACCGAAGGCG
TAGTTAGCAGCACTGCTGCGCCCGTCGAGCCCCACGTCCATCCAAAGGCG
GCAACACAA---------ACGCCACTCGCCCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>C5
ATGCAGCAGGCGAATCTGGGC------------ACCGCCCGGCTTCTGTC
CCGATCCGACTGGGGTGCCCGCCTGCCCAAGTCCGTGGAGCACTTTCAAG
GACCCGCGCCCTACGTGATCATCCACCACTCGTACATGCCAGCCGTGTGC
TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
CCAGCTGGAGCGCGGTTGGAACGATATCGGATATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACGCAGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCGCCGAAGTACAATGACAGGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACTGAACTTCCGCCCAAGCAGATGCTGGATGCGGCCAAGGACCTGA
TCGCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGGGGCCGCCTGTTTGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG
TT---AGCAGTACGAAGGCGCCGGTCGAGCCCCACGTCCATCCACAGGCG
GCAACACAA---------CAAACGCCGCCCAAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>C6
ATGCAGCATGCGAATTTGGGCGATGGAGCGGCCACCGCTCGACTTCTGTC
CCGCTCCGACTGGGGCGCCCGTCTGCCCAAGTCCGTGGAGCACTTCGAGG
GTCCCGCCCCCTACGTGATCATCCACCACTCTTACATGCCGGCGGTGTGC
TATACCACTCCCGACTGCATGAAGAGCATGCGCGACATGCAGGACTTCCA
CCAGCTGGAGCGCGGTTGGAACGACATCGGCTATAGCTTCGGCATCGGCG
GCGATGGCATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGCTCAT
GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACTGAACTGCCGCCCAAACAGATGCTGGACGCGGCCAAAAACCTGA
TCGCCTTCGGCGTGTTCAAGGGCTACATTGACCCCGCATACAAGCTGCTG
GGCCACCGACAGGTTCGTGACACCGAGTGTCCCGGAGGCAGGCTGTTCGC
GGAGATCTCCGGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCA
GC---------ACCCCCGTCCCCATTGAACCGCACGCACATCCCCAGGCG
GCGTCCCAAACGCCACCCCAATCACCACCCCAATCGCCACCCCATGCCCC
GGCAGCTGCGCCCAAGGTC---------------------------
>C1
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGVoSSTTAPVVPHVHPQA
AAPoooQKPHQSPPooooAAPKV
>C2
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGEoSSTAAPVVPHVHAQA
AAPoooQTPHQSPPooooAAPKV
>C3
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGVoSSTAAPVVPHVHAQA
AAPoooQTPHQSPPooooAAPKV
>C4
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
ATQoooTPLAQSPPooooAAPKV
>C5
MQQANLGooooTARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH
APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGVoSSTKAPVEPHVHPQA
ATQoooQTPPKSPPooooAAPKV
>C6
MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGSoooTPVPIEPHAHPQA
ASQTPPQSPPQSPPHAPAAAPKV


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 696 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1480079811
      Setting output file names to "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 567488990
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 6645016897
      Seed = 1282586157
      Swapseed = 1480079811
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 28 unique site patterns
      Division 2 has 28 unique site patterns
      Division 3 has 65 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2044.535926 -- -24.965149
         Chain 2 -- -2077.650327 -- -24.965149
         Chain 3 -- -2038.599855 -- -24.965149
         Chain 4 -- -2068.082413 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2021.346237 -- -24.965149
         Chain 2 -- -2069.651949 -- -24.965149
         Chain 3 -- -2049.858693 -- -24.965149
         Chain 4 -- -2022.631952 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2044.536] (-2077.650) (-2038.600) (-2068.082) * [-2021.346] (-2069.652) (-2049.859) (-2022.632) 
        500 -- (-1730.807) (-1722.737) (-1741.067) [-1724.252] * (-1728.323) (-1718.568) (-1720.354) [-1722.097] -- 0:00:00
       1000 -- [-1713.063] (-1710.874) (-1732.786) (-1716.685) * (-1727.172) (-1716.345) (-1706.883) [-1714.003] -- 0:00:00
       1500 -- [-1701.782] (-1710.231) (-1718.433) (-1713.358) * [-1699.985] (-1706.755) (-1701.689) (-1716.656) -- 0:11:05
       2000 -- [-1697.049] (-1698.747) (-1709.961) (-1712.839) * (-1695.503) (-1696.068) [-1700.174] (-1706.626) -- 0:08:19
       2500 -- (-1698.653) (-1689.693) [-1701.475] (-1705.923) * (-1692.789) [-1693.810] (-1708.245) (-1700.220) -- 0:06:39
       3000 -- (-1696.401) (-1698.300) (-1695.784) [-1693.907] * (-1700.816) (-1696.566) [-1698.884] (-1694.279) -- 0:05:32
       3500 -- (-1698.478) (-1697.665) (-1699.716) [-1695.095] * (-1696.373) [-1692.720] (-1700.549) (-1700.688) -- 0:04:44
       4000 -- (-1690.187) (-1696.872) (-1693.325) [-1694.946] * (-1694.128) (-1695.967) (-1696.117) [-1697.184] -- 0:04:09
       4500 -- (-1699.197) (-1696.242) (-1698.799) [-1695.276] * (-1694.271) (-1698.749) [-1699.063] (-1699.009) -- 0:03:41
       5000 -- (-1696.191) (-1692.540) (-1700.004) [-1690.885] * (-1695.012) (-1698.009) (-1693.230) [-1694.901] -- 0:06:38

      Average standard deviation of split frequencies: 0.031427

       5500 -- (-1697.991) (-1692.096) [-1690.922] (-1694.553) * (-1699.046) (-1698.775) [-1695.528] (-1696.605) -- 0:06:01
       6000 -- (-1693.384) [-1696.952] (-1690.194) (-1699.761) * (-1697.647) (-1700.547) (-1694.680) [-1695.529] -- 0:05:31
       6500 -- (-1694.065) (-1698.959) (-1695.272) [-1693.405] * (-1692.725) (-1698.473) (-1695.013) [-1698.580] -- 0:05:05
       7000 -- [-1691.192] (-1692.637) (-1699.433) (-1693.825) * (-1691.461) (-1693.028) (-1696.927) [-1700.074] -- 0:04:43
       7500 -- [-1696.411] (-1699.575) (-1697.962) (-1693.821) * (-1701.545) [-1694.324] (-1692.452) (-1697.793) -- 0:04:24
       8000 -- (-1698.389) (-1695.299) (-1704.578) [-1695.004] * (-1691.911) (-1696.820) (-1691.837) [-1696.605] -- 0:04:08
       8500 -- [-1697.512] (-1696.159) (-1698.122) (-1696.023) * (-1698.446) (-1697.413) (-1691.445) [-1699.568] -- 0:03:53
       9000 -- (-1697.726) (-1698.202) (-1704.055) [-1695.384] * [-1694.682] (-1696.663) (-1704.753) (-1706.166) -- 0:05:30
       9500 -- (-1697.373) (-1693.327) (-1709.067) [-1693.096] * [-1693.321] (-1704.635) (-1696.870) (-1696.942) -- 0:05:12
      10000 -- (-1704.788) (-1690.152) (-1698.172) [-1696.187] * (-1698.708) (-1697.223) [-1692.849] (-1697.327) -- 0:04:57

      Average standard deviation of split frequencies: 0.106066

      10500 -- (-1698.868) [-1701.751] (-1695.082) (-1702.198) * (-1700.775) (-1702.346) [-1695.362] (-1698.398) -- 0:04:42
      11000 -- (-1699.787) [-1697.392] (-1695.500) (-1700.097) * [-1698.232] (-1702.589) (-1697.543) (-1694.820) -- 0:04:29
      11500 -- (-1713.204) (-1697.779) [-1698.343] (-1694.725) * [-1697.171] (-1702.424) (-1700.029) (-1707.725) -- 0:04:17
      12000 -- (-1693.225) (-1693.721) (-1701.028) [-1693.741] * (-1696.495) (-1701.338) [-1696.745] (-1705.136) -- 0:04:07
      12500 -- (-1695.587) (-1699.564) (-1702.640) [-1688.595] * (-1693.951) (-1705.829) [-1692.399] (-1706.294) -- 0:03:57
      13000 -- (-1699.142) (-1705.827) (-1700.571) [-1690.844] * (-1702.310) (-1702.735) [-1699.895] (-1706.831) -- 0:05:03
      13500 -- (-1713.743) (-1694.510) [-1698.036] (-1691.663) * [-1692.158] (-1698.251) (-1695.214) (-1696.520) -- 0:04:52
      14000 -- (-1705.731) (-1699.571) (-1699.144) [-1693.694] * (-1693.111) [-1691.172] (-1710.172) (-1701.218) -- 0:04:41
      14500 -- (-1703.611) (-1699.501) (-1705.520) [-1693.255] * (-1693.744) [-1697.168] (-1701.658) (-1708.557) -- 0:04:31
      15000 -- [-1695.974] (-1698.024) (-1704.244) (-1695.404) * (-1705.668) (-1696.974) [-1696.189] (-1698.537) -- 0:04:22

      Average standard deviation of split frequencies: 0.047140

      15500 -- (-1703.614) (-1695.085) (-1696.187) [-1692.366] * (-1694.538) (-1694.393) [-1694.618] (-1700.236) -- 0:04:14
      16000 -- (-1694.748) (-1697.177) [-1698.662] (-1699.241) * (-1704.041) (-1698.181) (-1688.641) [-1694.221] -- 0:04:06
      16500 -- (-1695.794) [-1692.782] (-1700.604) (-1699.198) * (-1697.866) (-1694.289) (-1699.967) [-1696.165] -- 0:03:58
      17000 -- (-1701.816) (-1697.599) (-1696.675) [-1695.100] * (-1693.965) (-1697.617) [-1695.342] (-1693.978) -- 0:04:49
      17500 -- (-1693.815) (-1703.735) (-1702.924) [-1696.547] * (-1691.091) [-1695.808] (-1695.383) (-1696.868) -- 0:04:40
      18000 -- (-1694.893) [-1692.623] (-1693.837) (-1702.718) * (-1697.312) (-1695.227) (-1692.924) [-1694.187] -- 0:04:32
      18500 -- (-1693.316) (-1693.648) [-1699.015] (-1696.668) * [-1698.591] (-1694.275) (-1698.899) (-1692.440) -- 0:04:25
      19000 -- (-1695.497) (-1693.158) [-1694.062] (-1701.879) * [-1696.446] (-1696.070) (-1693.800) (-1697.522) -- 0:04:18
      19500 -- (-1693.972) [-1700.329] (-1691.467) (-1701.505) * [-1700.837] (-1702.061) (-1693.105) (-1695.807) -- 0:04:11
      20000 -- (-1701.559) (-1691.211) [-1694.584] (-1702.025) * (-1696.667) [-1696.737] (-1694.923) (-1702.126) -- 0:04:05

      Average standard deviation of split frequencies: 0.068430

      20500 -- (-1693.004) (-1689.821) [-1695.580] (-1702.579) * (-1706.326) (-1696.972) [-1695.214] (-1697.267) -- 0:03:58
      21000 -- (-1704.231) [-1693.028] (-1699.778) (-1702.262) * (-1693.617) (-1696.094) (-1695.538) [-1697.917] -- 0:04:39
      21500 -- (-1703.563) (-1696.856) (-1697.266) [-1694.298] * (-1697.695) [-1695.992] (-1698.353) (-1701.555) -- 0:04:33
      22000 -- (-1700.639) [-1697.883] (-1697.627) (-1694.751) * [-1697.474] (-1702.185) (-1697.189) (-1704.008) -- 0:04:26
      22500 -- (-1707.525) [-1692.248] (-1694.819) (-1695.861) * [-1694.421] (-1701.059) (-1712.916) (-1705.075) -- 0:04:20
      23000 -- (-1699.581) (-1700.407) (-1698.764) [-1695.163] * [-1693.987] (-1701.687) (-1699.238) (-1693.774) -- 0:04:14
      23500 -- [-1695.701] (-1699.822) (-1692.086) (-1698.750) * (-1698.902) (-1705.013) (-1702.823) [-1699.469] -- 0:04:09
      24000 -- (-1695.988) (-1701.383) [-1695.992] (-1701.587) * (-1695.651) [-1696.005] (-1697.936) (-1703.145) -- 0:04:04
      24500 -- (-1693.789) (-1695.788) [-1697.475] (-1704.515) * [-1697.335] (-1697.791) (-1699.196) (-1699.606) -- 0:03:58
      25000 -- (-1702.064) (-1697.711) (-1707.361) [-1704.870] * (-1694.960) [-1699.257] (-1698.458) (-1692.921) -- 0:04:33

      Average standard deviation of split frequencies: 0.072524

      25500 -- (-1695.441) [-1700.013] (-1705.377) (-1694.070) * (-1696.907) (-1698.902) (-1691.205) [-1692.896] -- 0:04:27
      26000 -- (-1696.291) (-1699.835) (-1697.910) [-1696.235] * (-1702.886) (-1701.953) [-1696.470] (-1696.149) -- 0:04:22
      26500 -- (-1700.062) [-1697.310] (-1694.039) (-1705.898) * (-1706.218) (-1700.068) [-1696.917] (-1698.551) -- 0:04:17
      27000 -- (-1700.565) [-1694.878] (-1692.610) (-1696.256) * [-1700.108] (-1700.815) (-1698.170) (-1695.863) -- 0:04:12
      27500 -- (-1700.878) (-1695.812) [-1690.877] (-1697.056) * (-1692.878) (-1695.954) [-1700.616] (-1700.429) -- 0:04:07
      28000 -- (-1698.188) (-1705.362) (-1693.819) [-1696.375] * (-1695.257) [-1695.479] (-1699.720) (-1700.725) -- 0:04:03
      28500 -- [-1694.363] (-1702.162) (-1696.536) (-1696.622) * (-1691.254) [-1695.641] (-1697.753) (-1711.406) -- 0:03:58
      29000 -- (-1695.246) (-1700.198) (-1690.169) [-1695.432] * (-1702.274) [-1699.603] (-1706.882) (-1698.355) -- 0:04:27
      29500 -- (-1693.771) [-1694.181] (-1693.118) (-1693.051) * (-1697.435) [-1695.194] (-1703.068) (-1695.493) -- 0:04:23
      30000 -- [-1693.495] (-1699.861) (-1700.956) (-1693.574) * (-1699.944) (-1695.060) (-1696.911) [-1694.660] -- 0:04:18

      Average standard deviation of split frequencies: 0.030744

      30500 -- [-1692.052] (-1701.193) (-1695.060) (-1693.473) * (-1696.659) (-1691.416) [-1689.237] (-1694.871) -- 0:04:14
      31000 -- [-1698.380] (-1701.249) (-1694.081) (-1699.684) * (-1698.460) [-1695.712] (-1697.805) (-1694.653) -- 0:04:10
      31500 -- [-1698.841] (-1702.749) (-1693.757) (-1702.690) * (-1699.463) (-1695.170) [-1693.748] (-1702.034) -- 0:04:05
      32000 -- (-1702.428) (-1695.335) [-1692.476] (-1696.563) * (-1699.837) (-1703.861) (-1696.506) [-1697.208] -- 0:04:02
      32500 -- (-1702.873) (-1698.064) (-1701.001) [-1690.412] * (-1700.847) (-1700.533) (-1695.452) [-1698.257] -- 0:03:58
      33000 -- (-1699.002) (-1694.879) [-1695.054] (-1700.387) * [-1697.685] (-1701.465) (-1696.909) (-1699.849) -- 0:04:23
      33500 -- (-1698.894) [-1697.414] (-1700.152) (-1693.245) * (-1700.925) (-1697.223) (-1700.207) [-1699.823] -- 0:04:19
      34000 -- (-1696.871) [-1694.585] (-1704.985) (-1702.413) * [-1696.347] (-1707.290) (-1701.923) (-1697.156) -- 0:04:15
      34500 -- (-1700.862) (-1696.595) [-1696.893] (-1696.630) * [-1698.792] (-1698.130) (-1698.405) (-1698.337) -- 0:04:11
      35000 -- (-1699.356) [-1697.883] (-1697.845) (-1699.810) * (-1693.535) (-1696.417) (-1706.351) [-1696.794] -- 0:04:08

      Average standard deviation of split frequencies: 0.036010

      35500 -- (-1703.902) [-1699.450] (-1693.526) (-1704.223) * (-1696.060) (-1694.991) [-1695.326] (-1697.820) -- 0:04:04
      36000 -- [-1696.320] (-1704.948) (-1701.715) (-1704.310) * (-1697.228) (-1696.473) (-1700.503) [-1697.205] -- 0:04:01
      36500 -- [-1694.878] (-1707.767) (-1702.496) (-1692.421) * (-1699.875) (-1702.455) [-1696.015] (-1693.694) -- 0:04:23
      37000 -- [-1697.517] (-1700.460) (-1697.584) (-1701.573) * (-1699.525) (-1692.136) (-1696.801) [-1690.678] -- 0:04:20
      37500 -- (-1708.270) (-1702.840) [-1691.573] (-1699.608) * [-1693.099] (-1702.963) (-1697.815) (-1696.381) -- 0:04:16
      38000 -- (-1699.315) (-1702.571) [-1698.466] (-1692.192) * [-1697.213] (-1702.383) (-1693.177) (-1696.353) -- 0:04:13
      38500 -- [-1699.486] (-1693.068) (-1703.371) (-1698.066) * (-1696.820) (-1696.771) [-1696.844] (-1700.307) -- 0:04:09
      39000 -- (-1694.619) (-1700.741) (-1703.803) [-1695.198] * (-1700.396) (-1701.342) (-1695.449) [-1694.425] -- 0:04:06
      39500 -- (-1703.561) [-1695.701] (-1703.933) (-1694.661) * (-1696.219) [-1694.589] (-1698.916) (-1705.399) -- 0:04:03
      40000 -- (-1696.945) (-1696.957) [-1695.536] (-1697.812) * (-1694.743) (-1700.416) [-1695.047] (-1694.996) -- 0:04:00

      Average standard deviation of split frequencies: 0.023184

      40500 -- (-1695.506) (-1699.345) [-1695.918] (-1697.588) * [-1690.794] (-1695.693) (-1703.755) (-1697.520) -- 0:04:20
      41000 -- (-1697.756) (-1697.181) [-1691.239] (-1695.562) * (-1693.354) [-1695.070] (-1703.512) (-1693.781) -- 0:04:17
      41500 -- (-1693.684) (-1697.954) [-1693.924] (-1698.223) * (-1695.155) (-1696.617) (-1705.323) [-1698.144] -- 0:04:14
      42000 -- (-1703.761) (-1693.052) [-1696.798] (-1698.978) * [-1700.186] (-1695.441) (-1700.895) (-1692.712) -- 0:04:10
      42500 -- (-1700.546) [-1701.422] (-1692.397) (-1689.504) * (-1706.325) [-1693.891] (-1694.583) (-1691.623) -- 0:04:07
      43000 -- (-1702.702) (-1694.383) (-1700.474) [-1691.250] * (-1697.866) (-1692.966) [-1697.165] (-1697.537) -- 0:04:04
      43500 -- (-1697.987) (-1706.112) [-1692.469] (-1694.531) * (-1697.420) (-1695.016) (-1702.210) [-1696.133] -- 0:04:01
      44000 -- (-1701.214) [-1695.625] (-1693.309) (-1698.748) * [-1701.143] (-1698.980) (-1706.561) (-1705.728) -- 0:03:59
      44500 -- (-1701.276) (-1692.417) (-1695.202) [-1698.644] * [-1696.473] (-1703.839) (-1703.362) (-1698.209) -- 0:04:17
      45000 -- (-1696.323) [-1700.311] (-1697.501) (-1702.218) * [-1702.034] (-1693.234) (-1697.354) (-1693.189) -- 0:04:14

      Average standard deviation of split frequencies: 0.015372

      45500 -- (-1698.903) (-1694.346) [-1693.737] (-1697.129) * [-1695.441] (-1695.780) (-1699.200) (-1697.494) -- 0:04:11
      46000 -- [-1705.401] (-1695.539) (-1694.536) (-1694.216) * [-1694.040] (-1695.122) (-1698.618) (-1708.252) -- 0:04:08
      46500 -- (-1694.241) (-1692.602) (-1697.559) [-1698.081] * [-1694.942] (-1702.348) (-1712.912) (-1701.772) -- 0:04:06
      47000 -- (-1694.335) (-1696.403) [-1695.592] (-1703.692) * (-1700.492) (-1698.366) (-1711.219) [-1695.919] -- 0:04:03
      47500 -- [-1690.452] (-1696.135) (-1706.165) (-1701.068) * (-1696.421) (-1701.561) (-1697.875) [-1696.544] -- 0:04:00
      48000 -- (-1697.091) [-1697.057] (-1707.789) (-1695.125) * (-1696.296) (-1696.492) [-1696.100] (-1708.925) -- 0:03:58
      48500 -- (-1697.851) (-1694.526) (-1698.040) [-1701.270] * [-1702.019] (-1695.602) (-1692.997) (-1702.914) -- 0:04:15
      49000 -- (-1697.791) (-1708.040) [-1693.996] (-1699.048) * [-1696.544] (-1696.193) (-1696.717) (-1702.232) -- 0:04:12
      49500 -- [-1697.200] (-1694.820) (-1696.269) (-1693.976) * [-1698.972] (-1697.567) (-1694.446) (-1701.220) -- 0:04:09
      50000 -- [-1702.118] (-1692.805) (-1704.579) (-1693.014) * (-1703.448) (-1694.639) (-1700.914) [-1701.725] -- 0:04:06

      Average standard deviation of split frequencies: 0.013956

      50500 -- (-1696.394) [-1701.497] (-1700.699) (-1696.095) * (-1697.056) (-1695.223) [-1691.438] (-1702.882) -- 0:04:04
      51000 -- (-1695.928) (-1693.424) (-1697.538) [-1692.917] * (-1697.285) [-1696.633] (-1696.236) (-1701.513) -- 0:04:01
      51500 -- [-1696.046] (-1695.420) (-1694.289) (-1694.373) * [-1693.924] (-1692.304) (-1699.164) (-1699.101) -- 0:03:59
      52000 -- [-1691.197] (-1695.046) (-1694.389) (-1696.229) * (-1695.838) [-1701.037] (-1702.523) (-1696.012) -- 0:03:57
      52500 -- (-1702.525) (-1689.497) (-1708.158) [-1693.422] * (-1698.064) [-1702.266] (-1696.071) (-1695.637) -- 0:04:12
      53000 -- (-1697.891) [-1693.289] (-1698.493) (-1692.493) * (-1698.031) (-1694.968) [-1699.615] (-1703.587) -- 0:04:10
      53500 -- (-1701.012) (-1697.717) [-1697.560] (-1700.269) * (-1697.038) [-1694.387] (-1703.769) (-1710.819) -- 0:04:07
      54000 -- [-1699.212] (-1695.684) (-1698.674) (-1696.245) * (-1691.525) [-1696.831] (-1706.123) (-1699.166) -- 0:04:05
      54500 -- (-1705.058) (-1690.851) (-1706.268) [-1692.042] * [-1696.286] (-1695.731) (-1699.206) (-1695.540) -- 0:04:02
      55000 -- (-1703.030) (-1693.415) (-1697.486) [-1696.680] * (-1700.240) (-1692.732) [-1697.659] (-1695.973) -- 0:04:00

      Average standard deviation of split frequencies: 0.025254

      55500 -- (-1701.835) [-1694.815] (-1695.354) (-1698.448) * (-1701.981) [-1694.374] (-1694.795) (-1698.862) -- 0:03:58
      56000 -- (-1708.301) (-1690.522) [-1693.564] (-1693.331) * (-1700.695) (-1699.273) [-1696.311] (-1701.541) -- 0:03:56
      56500 -- (-1709.869) [-1696.463] (-1699.081) (-1695.648) * (-1703.594) (-1696.224) [-1696.350] (-1696.145) -- 0:04:10
      57000 -- (-1698.372) (-1692.551) [-1697.092] (-1691.614) * [-1694.241] (-1691.030) (-1693.161) (-1698.530) -- 0:04:08
      57500 -- (-1693.060) (-1698.621) (-1698.949) [-1697.839] * (-1693.975) [-1690.602] (-1695.086) (-1699.923) -- 0:04:05
      58000 -- (-1693.047) (-1698.075) [-1697.807] (-1699.331) * [-1701.257] (-1692.623) (-1696.992) (-1703.408) -- 0:04:03
      58500 -- (-1696.860) (-1693.624) (-1698.528) [-1693.953] * (-1696.436) (-1691.890) (-1697.643) [-1695.131] -- 0:04:01
      59000 -- (-1702.885) (-1696.745) [-1693.756] (-1697.802) * (-1696.240) (-1697.094) [-1695.002] (-1697.333) -- 0:03:59
      59500 -- (-1701.122) [-1696.438] (-1699.928) (-1700.546) * (-1701.261) (-1709.949) (-1702.132) [-1699.276] -- 0:03:57
      60000 -- (-1699.823) (-1699.221) (-1700.359) [-1697.403] * (-1701.539) [-1697.796] (-1695.780) (-1695.988) -- 0:03:55

      Average standard deviation of split frequencies: 0.017483

      60500 -- (-1693.256) (-1690.925) (-1698.419) [-1693.049] * (-1702.675) (-1703.734) [-1700.592] (-1695.311) -- 0:04:08
      61000 -- (-1697.518) [-1690.480] (-1700.765) (-1692.839) * (-1704.530) (-1693.228) (-1699.677) [-1696.423] -- 0:04:06
      61500 -- [-1698.420] (-1693.359) (-1697.153) (-1698.100) * (-1704.957) (-1696.324) (-1694.351) [-1692.046] -- 0:04:04
      62000 -- [-1693.920] (-1699.064) (-1698.406) (-1694.696) * (-1709.874) (-1693.118) [-1691.889] (-1694.225) -- 0:04:02
      62500 -- (-1698.303) (-1699.752) (-1696.754) [-1693.494] * (-1700.840) (-1703.242) (-1694.021) [-1695.406] -- 0:04:00
      63000 -- (-1703.607) [-1690.032] (-1700.086) (-1695.224) * (-1699.231) (-1692.913) (-1700.287) [-1693.194] -- 0:03:57
      63500 -- (-1700.489) [-1699.148] (-1702.412) (-1693.161) * [-1701.066] (-1699.480) (-1698.330) (-1700.425) -- 0:03:55
      64000 -- [-1694.908] (-1694.399) (-1700.280) (-1694.555) * (-1702.684) (-1699.158) [-1696.183] (-1698.890) -- 0:03:54
      64500 -- [-1695.117] (-1694.039) (-1701.984) (-1696.545) * (-1697.957) (-1699.944) [-1697.534] (-1694.845) -- 0:04:06
      65000 -- (-1695.430) (-1694.670) [-1695.968] (-1694.006) * [-1697.585] (-1700.748) (-1700.251) (-1695.053) -- 0:04:04

      Average standard deviation of split frequencies: 0.019642

      65500 -- (-1697.877) (-1691.561) [-1701.137] (-1700.367) * [-1696.290] (-1698.337) (-1698.665) (-1698.514) -- 0:04:02
      66000 -- (-1696.777) (-1697.694) (-1694.156) [-1696.478] * [-1696.005] (-1693.825) (-1697.617) (-1696.731) -- 0:04:00
      66500 -- (-1703.036) [-1696.358] (-1699.137) (-1696.755) * (-1696.658) (-1703.257) (-1697.679) [-1693.142] -- 0:03:58
      67000 -- (-1700.903) (-1707.017) (-1699.372) [-1689.467] * (-1694.187) [-1696.830] (-1698.894) (-1690.204) -- 0:03:56
      67500 -- (-1698.050) (-1700.806) (-1697.029) [-1698.204] * (-1692.344) (-1699.318) [-1701.330] (-1692.298) -- 0:03:54
      68000 -- (-1700.250) [-1694.583] (-1698.767) (-1697.352) * [-1694.967] (-1696.971) (-1696.051) (-1692.389) -- 0:03:53
      68500 -- (-1703.156) (-1698.820) [-1695.865] (-1693.890) * (-1691.418) [-1695.564] (-1697.702) (-1701.463) -- 0:04:04
      69000 -- [-1699.058] (-1704.009) (-1700.226) (-1692.434) * [-1691.888] (-1694.472) (-1699.831) (-1705.620) -- 0:04:02
      69500 -- (-1702.715) (-1705.357) [-1694.359] (-1697.111) * (-1695.028) [-1701.257] (-1701.869) (-1703.756) -- 0:04:00
      70000 -- (-1703.790) (-1703.287) [-1697.557] (-1702.505) * (-1697.744) [-1695.681] (-1694.528) (-1693.870) -- 0:03:59

      Average standard deviation of split frequencies: 0.016677

      70500 -- (-1693.205) (-1702.634) (-1701.935) [-1695.852] * (-1697.181) (-1698.799) [-1697.817] (-1694.130) -- 0:03:57
      71000 -- (-1697.728) [-1691.670] (-1697.572) (-1695.108) * (-1702.952) (-1695.887) (-1696.020) [-1697.710] -- 0:03:55
      71500 -- (-1700.150) (-1695.827) [-1697.238] (-1695.580) * (-1695.109) [-1697.213] (-1702.330) (-1695.381) -- 0:03:53
      72000 -- [-1692.174] (-1701.134) (-1698.143) (-1696.069) * (-1696.605) (-1699.464) (-1700.433) [-1701.121] -- 0:03:52
      72500 -- (-1695.189) (-1703.574) [-1696.801] (-1700.540) * (-1693.556) [-1701.717] (-1697.755) (-1693.125) -- 0:04:03
      73000 -- [-1697.076] (-1699.475) (-1695.062) (-1694.728) * (-1691.807) (-1698.892) [-1694.458] (-1691.967) -- 0:04:01
      73500 -- (-1699.441) (-1698.565) (-1696.709) [-1695.331] * (-1698.741) (-1699.368) [-1696.265] (-1695.242) -- 0:03:59
      74000 -- (-1694.570) (-1698.508) (-1696.054) [-1697.041] * [-1696.203] (-1703.061) (-1697.483) (-1703.112) -- 0:03:57
      74500 -- (-1695.284) [-1699.938] (-1699.400) (-1697.495) * (-1693.375) (-1696.426) (-1695.888) [-1694.959] -- 0:03:56
      75000 -- [-1695.154] (-1693.160) (-1698.500) (-1691.177) * [-1693.014] (-1696.246) (-1695.399) (-1698.891) -- 0:03:54

      Average standard deviation of split frequencies: 0.017057

      75500 -- [-1697.599] (-1698.831) (-1700.726) (-1691.475) * (-1702.234) (-1698.071) [-1692.147] (-1698.226) -- 0:03:52
      76000 -- (-1693.994) [-1695.289] (-1709.918) (-1698.932) * (-1694.916) (-1698.538) (-1694.652) [-1697.748] -- 0:03:51
      76500 -- (-1694.167) [-1697.226] (-1706.140) (-1697.648) * [-1695.409] (-1693.261) (-1703.699) (-1697.085) -- 0:04:01
      77000 -- (-1701.621) [-1698.255] (-1694.429) (-1699.223) * (-1691.790) [-1695.099] (-1697.517) (-1697.017) -- 0:03:59
      77500 -- [-1695.177] (-1695.764) (-1699.407) (-1703.211) * [-1695.877] (-1693.088) (-1696.763) (-1696.345) -- 0:03:58
      78000 -- (-1696.310) (-1695.105) (-1698.730) [-1705.951] * (-1692.598) (-1702.278) [-1694.806] (-1698.846) -- 0:03:56
      78500 -- (-1696.135) [-1694.003] (-1703.536) (-1697.872) * (-1696.848) [-1698.536] (-1698.572) (-1699.191) -- 0:03:54
      79000 -- (-1695.502) [-1693.571] (-1704.486) (-1702.483) * (-1703.426) (-1701.789) (-1696.690) [-1700.382] -- 0:03:53
      79500 -- [-1692.540] (-1704.520) (-1700.258) (-1703.736) * (-1705.764) (-1700.005) (-1692.465) [-1698.017] -- 0:03:51
      80000 -- (-1694.016) [-1698.587] (-1703.634) (-1694.016) * (-1696.822) [-1698.946] (-1690.987) (-1699.509) -- 0:03:50

      Average standard deviation of split frequencies: 0.016071

      80500 -- (-1694.378) (-1694.527) (-1704.034) [-1691.623] * (-1695.992) [-1696.939] (-1693.753) (-1699.292) -- 0:03:59
      81000 -- (-1692.223) (-1691.711) (-1697.515) [-1694.938] * (-1704.063) (-1699.402) (-1699.095) [-1691.261] -- 0:03:58
      81500 -- [-1691.551] (-1705.522) (-1699.845) (-1694.010) * [-1697.016] (-1697.032) (-1694.580) (-1703.301) -- 0:03:56
      82000 -- (-1692.730) [-1692.639] (-1693.116) (-1691.790) * (-1694.077) [-1694.307] (-1699.544) (-1697.620) -- 0:03:55
      82500 -- (-1692.325) (-1696.249) (-1708.156) [-1691.632] * (-1694.058) (-1692.958) (-1702.899) [-1696.255] -- 0:03:53
      83000 -- (-1701.404) (-1702.870) (-1701.310) [-1695.972] * (-1697.763) [-1698.171] (-1698.424) (-1694.014) -- 0:03:52
      83500 -- (-1697.057) [-1694.150] (-1694.824) (-1695.834) * [-1692.822] (-1697.858) (-1708.439) (-1697.792) -- 0:03:50
      84000 -- (-1704.280) (-1697.134) (-1698.514) [-1689.791] * (-1699.873) (-1696.019) (-1704.236) [-1700.630] -- 0:03:49
      84500 -- (-1704.216) (-1702.948) [-1699.051] (-1699.124) * (-1699.092) [-1695.037] (-1697.221) (-1698.475) -- 0:03:58
      85000 -- (-1698.910) [-1701.848] (-1694.427) (-1694.590) * [-1696.984] (-1691.707) (-1696.148) (-1698.793) -- 0:03:56

      Average standard deviation of split frequencies: 0.019185

      85500 -- (-1701.316) (-1702.452) [-1691.598] (-1697.600) * (-1699.133) [-1694.195] (-1697.661) (-1703.375) -- 0:03:55
      86000 -- [-1693.807] (-1696.499) (-1691.818) (-1697.862) * (-1697.818) (-1701.263) (-1691.763) [-1693.235] -- 0:03:53
      86500 -- (-1695.220) (-1696.129) [-1695.774] (-1694.647) * (-1703.193) (-1698.184) [-1691.571] (-1694.715) -- 0:03:52
      87000 -- [-1698.678] (-1700.942) (-1697.526) (-1695.253) * (-1698.959) [-1696.644] (-1692.928) (-1701.867) -- 0:03:50
      87500 -- (-1695.938) (-1700.494) [-1696.299] (-1707.207) * (-1699.192) (-1696.842) [-1699.507] (-1694.675) -- 0:03:49
      88000 -- (-1701.840) (-1702.833) (-1693.157) [-1695.678] * (-1700.466) [-1700.372] (-1697.515) (-1697.060) -- 0:03:48
      88500 -- (-1705.432) (-1702.756) [-1704.092] (-1700.515) * (-1691.289) (-1697.293) [-1697.597] (-1695.345) -- 0:03:56
      89000 -- [-1692.998] (-1707.231) (-1695.461) (-1700.814) * [-1695.224] (-1696.832) (-1693.488) (-1694.002) -- 0:03:55
      89500 -- [-1697.991] (-1709.145) (-1693.279) (-1694.245) * (-1697.476) [-1694.270] (-1692.870) (-1706.288) -- 0:03:53
      90000 -- [-1696.321] (-1696.000) (-1695.938) (-1696.222) * (-1695.904) (-1696.655) [-1690.846] (-1693.335) -- 0:03:52

      Average standard deviation of split frequencies: 0.015598

      90500 -- (-1696.733) [-1701.281] (-1690.627) (-1698.485) * [-1696.131] (-1698.365) (-1695.897) (-1695.978) -- 0:03:51
      91000 -- (-1693.958) (-1697.949) (-1692.971) [-1703.225] * (-1703.822) (-1690.222) [-1696.615] (-1697.910) -- 0:03:49
      91500 -- [-1695.243] (-1702.723) (-1692.554) (-1707.350) * (-1698.280) [-1692.880] (-1697.391) (-1694.569) -- 0:03:48
      92000 -- (-1695.751) (-1695.190) [-1694.650] (-1704.638) * (-1708.357) [-1691.850] (-1692.864) (-1700.562) -- 0:03:56
      92500 -- (-1701.638) (-1696.986) [-1695.270] (-1703.612) * (-1696.509) [-1701.880] (-1693.780) (-1691.515) -- 0:03:55
      93000 -- [-1699.094] (-1700.404) (-1697.403) (-1703.636) * (-1697.138) [-1690.024] (-1692.796) (-1698.330) -- 0:03:54
      93500 -- (-1699.421) (-1695.432) (-1693.199) [-1690.535] * (-1696.203) (-1692.783) (-1693.454) [-1695.729] -- 0:03:52
      94000 -- (-1700.052) (-1696.291) (-1696.581) [-1699.053] * [-1693.720] (-1692.276) (-1700.537) (-1691.240) -- 0:03:51
      94500 -- [-1688.393] (-1701.933) (-1697.581) (-1704.027) * (-1696.139) (-1701.941) [-1692.698] (-1698.821) -- 0:03:49
      95000 -- (-1700.450) (-1700.151) (-1698.764) [-1698.817] * [-1691.067] (-1698.790) (-1693.731) (-1696.778) -- 0:03:48

      Average standard deviation of split frequencies: 0.013504

      95500 -- (-1696.192) (-1700.454) [-1695.783] (-1695.884) * [-1694.892] (-1694.599) (-1700.831) (-1699.210) -- 0:03:47
      96000 -- (-1699.817) (-1704.725) [-1698.189] (-1698.548) * (-1695.665) [-1696.398] (-1695.510) (-1691.089) -- 0:03:55
      96500 -- (-1704.803) (-1715.595) [-1693.823] (-1694.217) * [-1693.176] (-1695.576) (-1699.257) (-1697.034) -- 0:03:54
      97000 -- (-1707.187) (-1702.741) (-1695.698) [-1692.381] * (-1695.139) [-1697.991] (-1699.902) (-1696.485) -- 0:03:52
      97500 -- (-1699.856) (-1699.238) (-1705.648) [-1692.972] * [-1698.378] (-1697.120) (-1700.869) (-1699.414) -- 0:03:51
      98000 -- (-1705.373) (-1701.661) (-1697.324) [-1694.513] * (-1694.160) [-1701.214] (-1702.983) (-1697.170) -- 0:03:50
      98500 -- (-1697.167) (-1691.919) (-1693.784) [-1699.568] * [-1695.049] (-1700.430) (-1700.134) (-1701.978) -- 0:03:48
      99000 -- [-1694.263] (-1696.757) (-1692.609) (-1697.841) * [-1693.912] (-1697.621) (-1707.323) (-1694.232) -- 0:03:47
      99500 -- (-1695.295) (-1693.225) [-1690.134] (-1697.633) * [-1702.870] (-1695.302) (-1697.664) (-1697.605) -- 0:03:46
      100000 -- (-1694.445) (-1700.621) [-1695.469] (-1695.859) * [-1693.454] (-1697.868) (-1695.947) (-1697.740) -- 0:03:53

      Average standard deviation of split frequencies: 0.019902

      100500 -- (-1700.688) (-1693.333) (-1692.635) [-1697.741] * (-1696.345) [-1698.246] (-1700.318) (-1698.453) -- 0:03:52
      101000 -- (-1700.835) (-1694.686) (-1700.759) [-1692.423] * (-1693.467) (-1699.279) (-1700.248) [-1704.347] -- 0:03:51
      101500 -- (-1692.978) [-1692.757] (-1696.402) (-1698.529) * (-1695.903) [-1699.267] (-1698.717) (-1689.141) -- 0:03:50
      102000 -- (-1692.879) (-1698.056) (-1699.409) [-1695.271] * (-1705.139) (-1701.984) (-1703.358) [-1691.579] -- 0:03:48
      102500 -- (-1693.875) (-1695.998) [-1696.284] (-1703.281) * (-1698.681) (-1693.832) (-1700.173) [-1698.085] -- 0:03:47
      103000 -- (-1696.559) [-1694.613] (-1700.186) (-1693.715) * [-1708.755] (-1692.147) (-1694.453) (-1695.337) -- 0:03:46
      103500 -- (-1696.241) (-1697.029) (-1702.079) [-1700.356] * (-1694.326) (-1696.900) (-1696.882) [-1695.362] -- 0:03:45
      104000 -- [-1699.312] (-1702.417) (-1701.249) (-1701.644) * (-1695.803) (-1696.446) (-1705.872) [-1697.272] -- 0:03:52
      104500 -- [-1695.204] (-1705.977) (-1695.156) (-1705.134) * (-1695.728) (-1694.075) (-1700.195) [-1696.128] -- 0:03:51
      105000 -- (-1698.247) [-1699.073] (-1696.567) (-1696.616) * (-1696.870) (-1695.161) (-1703.929) [-1695.211] -- 0:03:50

      Average standard deviation of split frequencies: 0.018901

      105500 -- (-1703.569) (-1695.943) (-1699.897) [-1697.706] * [-1695.137] (-1693.715) (-1696.135) (-1698.523) -- 0:03:48
      106000 -- [-1690.889] (-1695.692) (-1694.297) (-1699.479) * (-1698.143) (-1693.291) (-1706.456) [-1699.467] -- 0:03:47
      106500 -- (-1693.035) [-1695.375] (-1696.958) (-1698.656) * [-1693.521] (-1695.301) (-1698.099) (-1696.162) -- 0:03:46
      107000 -- (-1698.679) [-1693.793] (-1695.519) (-1694.431) * (-1696.208) [-1698.892] (-1698.303) (-1691.665) -- 0:03:45
      107500 -- (-1694.734) [-1694.459] (-1696.169) (-1698.508) * (-1705.246) (-1694.967) [-1692.252] (-1697.597) -- 0:03:44
      108000 -- (-1701.267) [-1694.208] (-1691.417) (-1697.498) * [-1704.467] (-1694.744) (-1695.330) (-1696.643) -- 0:03:51
      108500 -- (-1693.820) [-1693.084] (-1695.392) (-1692.322) * [-1694.375] (-1696.126) (-1695.892) (-1703.796) -- 0:03:50
      109000 -- (-1700.983) (-1698.132) (-1698.505) [-1694.453] * [-1697.191] (-1697.096) (-1694.990) (-1694.357) -- 0:03:48
      109500 -- (-1699.430) (-1702.289) [-1695.552] (-1701.664) * [-1694.727] (-1696.217) (-1692.985) (-1694.235) -- 0:03:47
      110000 -- (-1697.235) (-1696.331) (-1700.009) [-1701.468] * [-1703.080] (-1700.733) (-1701.422) (-1704.131) -- 0:03:46

      Average standard deviation of split frequencies: 0.015974

      110500 -- (-1709.271) (-1699.711) [-1694.329] (-1707.516) * (-1694.141) (-1698.345) (-1699.365) [-1694.074] -- 0:03:45
      111000 -- (-1699.772) (-1695.196) [-1696.281] (-1699.511) * [-1696.430] (-1695.905) (-1699.443) (-1697.769) -- 0:03:44
      111500 -- (-1704.429) (-1701.109) (-1695.597) [-1691.808] * (-1697.501) [-1695.007] (-1704.579) (-1699.051) -- 0:03:43
      112000 -- (-1702.742) [-1700.336] (-1695.452) (-1692.515) * (-1693.416) (-1695.692) [-1701.824] (-1701.903) -- 0:03:49
      112500 -- (-1698.499) (-1696.883) [-1701.450] (-1697.729) * (-1696.083) (-1697.528) [-1697.988] (-1700.675) -- 0:03:48
      113000 -- (-1695.974) [-1692.600] (-1702.835) (-1700.070) * (-1709.089) (-1697.458) [-1699.329] (-1694.567) -- 0:03:47
      113500 -- (-1694.110) (-1699.626) (-1694.424) [-1692.037] * (-1695.349) (-1700.817) [-1693.469] (-1690.173) -- 0:03:46
      114000 -- [-1690.455] (-1697.026) (-1701.496) (-1695.827) * [-1694.546] (-1697.850) (-1696.470) (-1704.121) -- 0:03:45
      114500 -- (-1699.286) (-1696.103) (-1701.129) [-1697.071] * (-1695.893) (-1695.209) (-1689.832) [-1707.352] -- 0:03:44
      115000 -- (-1697.636) [-1693.795] (-1695.439) (-1695.886) * (-1699.271) [-1702.366] (-1695.365) (-1700.322) -- 0:03:43

      Average standard deviation of split frequencies: 0.014223

      115500 -- (-1698.500) (-1702.541) (-1696.417) [-1691.393] * [-1692.152] (-1691.266) (-1690.696) (-1707.132) -- 0:03:42
      116000 -- (-1698.861) (-1694.035) (-1701.408) [-1697.535] * [-1695.715] (-1694.115) (-1696.028) (-1705.854) -- 0:03:48
      116500 -- [-1695.072] (-1693.032) (-1699.383) (-1700.341) * (-1702.261) [-1693.918] (-1700.477) (-1699.052) -- 0:03:47
      117000 -- (-1692.766) (-1712.879) (-1703.335) [-1700.658] * (-1700.083) (-1694.342) (-1693.988) [-1694.300] -- 0:03:46
      117500 -- [-1691.994] (-1695.554) (-1706.629) (-1701.274) * (-1701.269) (-1696.453) (-1693.946) [-1701.571] -- 0:03:45
      118000 -- (-1696.141) (-1693.365) [-1697.587] (-1697.732) * (-1693.548) (-1702.166) (-1692.516) [-1692.938] -- 0:03:44
      118500 -- (-1700.221) (-1698.222) (-1696.767) [-1695.633] * (-1700.425) [-1698.515] (-1695.950) (-1703.257) -- 0:03:43
      119000 -- [-1698.297] (-1696.667) (-1703.334) (-1693.682) * [-1693.691] (-1696.713) (-1693.676) (-1691.816) -- 0:03:42
      119500 -- (-1692.622) (-1697.584) (-1695.110) [-1697.885] * (-1701.824) (-1695.284) [-1702.026] (-1698.873) -- 0:03:41
      120000 -- (-1694.323) [-1693.794] (-1704.150) (-1703.680) * (-1699.486) (-1708.707) (-1695.949) [-1698.789] -- 0:03:47

      Average standard deviation of split frequencies: 0.016603

      120500 -- (-1692.261) (-1707.552) [-1695.509] (-1695.670) * [-1700.113] (-1696.631) (-1698.198) (-1697.151) -- 0:03:46
      121000 -- [-1694.044] (-1698.696) (-1696.356) (-1698.002) * (-1698.024) (-1692.729) [-1693.897] (-1697.614) -- 0:03:45
      121500 -- [-1692.311] (-1706.131) (-1698.271) (-1699.088) * (-1698.564) (-1691.959) (-1704.408) [-1697.897] -- 0:03:44
      122000 -- (-1692.337) (-1697.296) [-1689.443] (-1699.505) * (-1696.100) (-1691.412) (-1705.306) [-1700.123] -- 0:03:43
      122500 -- (-1710.548) (-1697.287) [-1692.645] (-1697.215) * [-1694.116] (-1704.069) (-1694.140) (-1708.551) -- 0:03:42
      123000 -- (-1697.295) [-1698.875] (-1697.872) (-1696.880) * (-1704.358) [-1704.063] (-1701.088) (-1700.050) -- 0:03:41
      123500 -- (-1699.233) (-1695.527) (-1695.815) [-1695.140] * (-1701.257) (-1699.647) [-1699.104] (-1696.288) -- 0:03:40
      124000 -- (-1702.486) (-1699.816) [-1691.745] (-1695.949) * (-1693.547) [-1694.924] (-1693.995) (-1695.725) -- 0:03:46
      124500 -- (-1704.497) (-1698.725) [-1696.534] (-1693.265) * (-1696.189) [-1693.863] (-1698.705) (-1697.659) -- 0:03:45
      125000 -- (-1698.134) (-1705.193) (-1699.987) [-1702.877] * (-1701.436) (-1693.514) [-1691.902] (-1698.933) -- 0:03:44

      Average standard deviation of split frequencies: 0.025254

      125500 -- (-1707.088) (-1699.501) [-1696.328] (-1697.737) * (-1700.482) [-1696.441] (-1692.870) (-1697.724) -- 0:03:42
      126000 -- (-1694.967) (-1694.637) (-1703.422) [-1699.366] * [-1694.082] (-1712.384) (-1692.649) (-1697.261) -- 0:03:41
      126500 -- (-1702.120) (-1693.035) (-1700.184) [-1695.554] * (-1694.308) (-1697.210) (-1694.698) [-1696.934] -- 0:03:40
      127000 -- (-1699.264) (-1696.395) (-1703.856) [-1693.536] * [-1695.925] (-1697.873) (-1693.120) (-1704.836) -- 0:03:39
      127500 -- (-1698.329) (-1696.685) (-1690.788) [-1692.567] * [-1697.929] (-1699.759) (-1693.414) (-1709.669) -- 0:03:38
      128000 -- (-1697.468) (-1701.231) (-1697.483) [-1693.100] * (-1698.118) [-1695.313] (-1697.965) (-1699.984) -- 0:03:44
      128500 -- (-1696.584) [-1695.739] (-1694.668) (-1695.711) * (-1694.364) [-1700.404] (-1696.642) (-1695.479) -- 0:03:43
      129000 -- (-1697.732) (-1693.933) [-1699.201] (-1692.896) * (-1693.978) (-1699.702) (-1701.767) [-1703.216] -- 0:03:42
      129500 -- (-1702.841) (-1701.232) (-1698.272) [-1696.851] * [-1694.265] (-1704.599) (-1694.257) (-1705.644) -- 0:03:41
      130000 -- (-1698.413) (-1695.428) (-1695.770) [-1696.800] * (-1696.186) (-1699.419) (-1698.744) [-1698.463] -- 0:03:40

      Average standard deviation of split frequencies: 0.030665

      130500 -- (-1709.705) [-1688.474] (-1696.499) (-1700.529) * (-1698.180) (-1697.294) (-1700.114) [-1696.169] -- 0:03:39
      131000 -- [-1695.948] (-1697.553) (-1704.327) (-1697.980) * (-1695.887) (-1697.535) (-1700.211) [-1696.110] -- 0:03:38
      131500 -- [-1702.178] (-1695.928) (-1698.155) (-1699.628) * (-1694.571) (-1692.234) [-1693.038] (-1695.363) -- 0:03:37
      132000 -- (-1703.356) (-1691.627) (-1698.464) [-1700.734] * (-1694.017) (-1702.394) [-1696.921] (-1695.409) -- 0:03:43
      132500 -- (-1700.183) (-1693.858) [-1691.461] (-1699.144) * (-1694.291) (-1697.372) (-1701.155) [-1700.055] -- 0:03:42
      133000 -- (-1699.068) [-1689.490] (-1692.290) (-1703.229) * (-1695.793) (-1698.789) (-1694.791) [-1694.288] -- 0:03:41
      133500 -- (-1697.962) [-1694.825] (-1695.595) (-1700.918) * [-1697.808] (-1692.046) (-1700.639) (-1698.847) -- 0:03:40
      134000 -- (-1699.152) (-1704.158) [-1698.551] (-1696.962) * [-1699.695] (-1695.211) (-1694.207) (-1697.522) -- 0:03:39
      134500 -- [-1697.282] (-1700.395) (-1695.348) (-1697.491) * (-1696.537) [-1694.908] (-1694.187) (-1700.853) -- 0:03:38
      135000 -- [-1693.941] (-1697.072) (-1697.374) (-1697.212) * [-1693.577] (-1699.060) (-1704.930) (-1697.388) -- 0:03:37

      Average standard deviation of split frequencies: 0.025997

      135500 -- (-1692.572) (-1695.231) [-1696.193] (-1697.707) * (-1699.891) (-1694.574) [-1695.698] (-1698.457) -- 0:03:36
      136000 -- (-1698.558) (-1697.534) (-1695.741) [-1700.936] * (-1700.234) (-1698.026) (-1699.123) [-1698.853] -- 0:03:42
      136500 -- [-1691.435] (-1702.180) (-1699.824) (-1705.221) * (-1697.953) (-1698.122) (-1700.115) [-1690.648] -- 0:03:41
      137000 -- (-1700.469) [-1700.099] (-1697.022) (-1694.257) * (-1701.096) (-1694.294) (-1706.923) [-1701.300] -- 0:03:40
      137500 -- (-1696.109) [-1694.376] (-1699.755) (-1696.792) * (-1699.642) (-1696.871) [-1701.857] (-1699.085) -- 0:03:39
      138000 -- (-1698.875) [-1695.397] (-1698.102) (-1702.477) * (-1696.284) [-1697.146] (-1705.219) (-1697.983) -- 0:03:38
      138500 -- [-1691.914] (-1700.200) (-1697.574) (-1696.389) * (-1693.738) (-1700.106) [-1695.686] (-1691.337) -- 0:03:37
      139000 -- [-1693.386] (-1699.149) (-1695.977) (-1695.898) * (-1700.523) (-1697.253) (-1695.703) [-1695.980] -- 0:03:36
      139500 -- (-1693.825) (-1701.465) [-1696.649] (-1697.314) * [-1697.875] (-1696.611) (-1698.079) (-1697.399) -- 0:03:35
      140000 -- (-1692.456) [-1693.169] (-1702.834) (-1705.705) * (-1699.867) (-1695.841) [-1692.098] (-1703.398) -- 0:03:41

      Average standard deviation of split frequencies: 0.027648

      140500 -- (-1700.594) (-1697.047) [-1694.042] (-1697.014) * (-1700.652) [-1694.101] (-1695.005) (-1699.834) -- 0:03:40
      141000 -- (-1700.245) (-1695.238) [-1707.902] (-1698.096) * (-1695.325) (-1691.849) (-1695.189) [-1691.165] -- 0:03:39
      141500 -- (-1700.899) [-1697.493] (-1698.194) (-1697.633) * (-1694.402) (-1699.225) (-1693.109) [-1697.502] -- 0:03:38
      142000 -- [-1700.680] (-1700.248) (-1699.985) (-1697.774) * (-1695.277) (-1695.461) [-1695.312] (-1700.916) -- 0:03:37
      142500 -- (-1698.440) [-1693.522] (-1698.579) (-1695.967) * (-1704.962) (-1694.592) [-1695.950] (-1698.664) -- 0:03:36
      143000 -- (-1704.377) [-1693.389] (-1696.513) (-1701.759) * (-1697.765) (-1694.370) [-1697.572] (-1693.543) -- 0:03:35
      143500 -- (-1707.717) [-1692.712] (-1696.919) (-1696.751) * [-1690.766] (-1704.718) (-1691.834) (-1693.956) -- 0:03:34
      144000 -- (-1696.429) (-1695.578) [-1693.776] (-1700.073) * (-1696.574) (-1696.030) (-1697.995) [-1692.606] -- 0:03:39
      144500 -- (-1698.099) [-1703.273] (-1703.699) (-1706.008) * [-1693.313] (-1693.704) (-1698.505) (-1695.979) -- 0:03:39
      145000 -- (-1692.549) (-1697.721) (-1699.732) [-1692.790] * (-1695.119) [-1694.260] (-1695.475) (-1694.618) -- 0:03:38

      Average standard deviation of split frequencies: 0.027445

      145500 -- (-1696.129) (-1700.739) [-1695.915] (-1695.838) * (-1698.754) (-1695.615) [-1695.442] (-1694.944) -- 0:03:37
      146000 -- (-1701.701) (-1697.124) (-1694.790) [-1700.320] * (-1704.777) [-1699.366] (-1697.556) (-1695.586) -- 0:03:36
      146500 -- (-1695.582) [-1691.357] (-1709.735) (-1700.257) * [-1697.532] (-1692.724) (-1694.859) (-1694.341) -- 0:03:35
      147000 -- (-1693.952) [-1692.925] (-1705.172) (-1696.045) * (-1701.910) (-1694.461) [-1691.012] (-1695.734) -- 0:03:34
      147500 -- [-1697.304] (-1699.820) (-1704.392) (-1695.131) * (-1694.665) (-1697.469) [-1695.754] (-1705.639) -- 0:03:33
      148000 -- [-1698.091] (-1695.786) (-1701.945) (-1704.540) * (-1695.862) [-1693.527] (-1703.270) (-1695.735) -- 0:03:38
      148500 -- (-1706.629) (-1697.509) (-1705.103) [-1697.543] * (-1698.465) (-1696.634) (-1699.481) [-1695.829] -- 0:03:37
      149000 -- [-1699.589] (-1698.521) (-1703.897) (-1700.030) * [-1691.662] (-1694.600) (-1706.663) (-1703.266) -- 0:03:37
      149500 -- (-1698.506) (-1696.774) (-1701.776) [-1698.000] * (-1696.361) (-1693.196) [-1694.404] (-1696.608) -- 0:03:36
      150000 -- [-1697.532] (-1697.732) (-1695.574) (-1702.376) * [-1692.660] (-1697.771) (-1696.110) (-1699.696) -- 0:03:35

      Average standard deviation of split frequencies: 0.023466

      150500 -- (-1702.079) [-1692.640] (-1699.420) (-1695.041) * [-1690.952] (-1694.297) (-1696.858) (-1693.170) -- 0:03:34
      151000 -- (-1697.106) (-1697.870) (-1691.536) [-1692.254] * (-1698.330) [-1694.701] (-1696.862) (-1700.105) -- 0:03:33
      151500 -- [-1695.425] (-1699.352) (-1692.101) (-1697.188) * [-1694.437] (-1695.777) (-1694.192) (-1698.893) -- 0:03:32
      152000 -- (-1701.090) (-1696.214) [-1692.929] (-1699.158) * [-1696.233] (-1695.880) (-1699.980) (-1704.041) -- 0:03:37
      152500 -- (-1710.580) (-1698.235) (-1697.253) [-1695.718] * (-1706.005) (-1698.032) [-1693.649] (-1704.711) -- 0:03:36
      153000 -- (-1698.025) (-1701.168) [-1690.328] (-1702.079) * (-1703.255) [-1695.745] (-1693.150) (-1696.866) -- 0:03:35
      153500 -- (-1696.396) (-1699.239) (-1693.809) [-1697.270] * (-1697.824) (-1699.921) (-1695.905) [-1705.391] -- 0:03:35
      154000 -- (-1704.351) (-1694.525) (-1702.154) [-1699.803] * (-1695.317) [-1694.100] (-1700.164) (-1707.458) -- 0:03:34
      154500 -- (-1695.144) [-1697.970] (-1703.137) (-1698.322) * (-1703.512) [-1698.719] (-1698.405) (-1692.165) -- 0:03:33
      155000 -- (-1695.226) (-1701.932) [-1704.944] (-1695.260) * [-1700.908] (-1701.257) (-1698.555) (-1701.042) -- 0:03:32

      Average standard deviation of split frequencies: 0.021153

      155500 -- (-1698.807) (-1699.362) (-1707.511) [-1697.433] * (-1702.943) (-1701.923) [-1692.837] (-1692.773) -- 0:03:37
      156000 -- (-1702.454) (-1694.831) [-1696.496] (-1693.262) * (-1705.483) (-1701.593) (-1694.985) [-1696.765] -- 0:03:36
      156500 -- (-1696.619) (-1702.887) (-1699.041) [-1694.083] * (-1700.174) (-1697.586) (-1693.590) [-1696.970] -- 0:03:35
      157000 -- (-1698.653) [-1703.897] (-1698.330) (-1701.352) * [-1694.220] (-1700.911) (-1693.836) (-1697.093) -- 0:03:34
      157500 -- (-1702.180) [-1706.672] (-1699.660) (-1695.009) * (-1699.446) (-1694.946) [-1699.546] (-1690.370) -- 0:03:33
      158000 -- [-1696.404] (-1701.906) (-1700.633) (-1701.107) * (-1698.998) (-1694.956) (-1699.317) [-1698.194] -- 0:03:33
      158500 -- (-1699.219) [-1705.349] (-1699.608) (-1699.473) * (-1700.771) [-1695.578] (-1702.901) (-1693.173) -- 0:03:32
      159000 -- (-1694.182) (-1703.074) (-1699.081) [-1694.436] * [-1695.366] (-1695.440) (-1699.892) (-1700.018) -- 0:03:31
      159500 -- (-1698.760) (-1712.512) [-1695.584] (-1698.096) * (-1703.613) [-1697.274] (-1699.411) (-1696.796) -- 0:03:36
      160000 -- (-1697.575) [-1696.847] (-1703.078) (-1699.156) * (-1699.101) (-1712.375) (-1697.908) [-1694.022] -- 0:03:35

      Average standard deviation of split frequencies: 0.021272

      160500 -- [-1698.380] (-1698.162) (-1704.291) (-1700.278) * (-1700.743) (-1696.423) (-1697.779) [-1692.204] -- 0:03:34
      161000 -- (-1698.614) (-1692.023) [-1695.354] (-1696.888) * (-1699.158) (-1696.119) (-1698.150) [-1692.462] -- 0:03:33
      161500 -- (-1694.850) (-1693.923) (-1692.824) [-1697.016] * (-1704.930) (-1693.076) [-1697.447] (-1697.642) -- 0:03:32
      162000 -- (-1700.295) (-1704.260) (-1691.672) [-1695.039] * (-1704.394) [-1704.082] (-1697.863) (-1695.879) -- 0:03:32
      162500 -- [-1694.230] (-1700.637) (-1694.279) (-1699.518) * [-1696.625] (-1692.573) (-1697.062) (-1696.810) -- 0:03:31
      163000 -- (-1697.404) (-1704.914) [-1697.548] (-1701.035) * [-1693.774] (-1694.636) (-1695.793) (-1700.085) -- 0:03:30
      163500 -- (-1692.924) [-1697.210] (-1695.190) (-1696.827) * (-1696.636) [-1690.693] (-1691.966) (-1696.928) -- 0:03:34
      164000 -- (-1696.183) (-1696.283) (-1695.088) [-1700.004] * (-1702.132) (-1703.656) [-1699.458] (-1701.542) -- 0:03:34
      164500 -- [-1695.949] (-1701.604) (-1693.748) (-1700.876) * (-1699.394) (-1699.550) (-1699.591) [-1695.694] -- 0:03:33
      165000 -- (-1695.106) (-1703.221) [-1699.864] (-1694.467) * (-1696.216) [-1692.919] (-1699.259) (-1698.863) -- 0:03:32

      Average standard deviation of split frequencies: 0.017749

      165500 -- (-1696.730) (-1697.500) (-1698.667) [-1696.456] * [-1698.611] (-1694.567) (-1701.462) (-1701.324) -- 0:03:31
      166000 -- [-1694.506] (-1705.353) (-1699.482) (-1695.728) * [-1697.120] (-1697.323) (-1700.881) (-1692.427) -- 0:03:31
      166500 -- (-1693.410) (-1701.615) [-1700.917] (-1694.911) * (-1701.928) (-1700.071) [-1695.473] (-1696.617) -- 0:03:30
      167000 -- (-1695.572) (-1695.250) [-1695.984] (-1699.826) * (-1698.688) [-1694.109] (-1697.602) (-1695.913) -- 0:03:29
      167500 -- (-1693.520) [-1702.913] (-1693.007) (-1695.461) * (-1701.155) (-1695.645) (-1696.822) [-1696.483] -- 0:03:33
      168000 -- [-1694.975] (-1693.778) (-1694.970) (-1700.768) * (-1706.763) (-1705.141) (-1694.351) [-1695.945] -- 0:03:32
      168500 -- (-1696.111) (-1702.741) [-1692.788] (-1694.846) * (-1699.624) (-1699.303) [-1694.616] (-1697.667) -- 0:03:32
      169000 -- (-1701.494) [-1698.068] (-1696.157) (-1691.767) * [-1698.483] (-1693.776) (-1693.352) (-1701.799) -- 0:03:31
      169500 -- (-1696.378) [-1693.582] (-1694.076) (-1694.962) * (-1699.184) [-1694.951] (-1694.911) (-1709.725) -- 0:03:30
      170000 -- (-1705.442) (-1692.129) (-1699.672) [-1695.398] * (-1704.655) [-1692.436] (-1697.686) (-1693.553) -- 0:03:29

      Average standard deviation of split frequencies: 0.009667

      170500 -- (-1698.818) (-1691.215) (-1698.777) [-1692.541] * [-1694.768] (-1699.440) (-1691.880) (-1702.718) -- 0:03:29
      171000 -- (-1699.133) (-1694.902) (-1696.906) [-1695.663] * (-1695.791) (-1705.343) (-1696.233) [-1692.191] -- 0:03:28
      171500 -- [-1696.617] (-1698.064) (-1699.882) (-1700.034) * (-1695.946) [-1699.171] (-1690.141) (-1698.135) -- 0:03:32
      172000 -- (-1700.733) [-1694.608] (-1694.413) (-1703.201) * (-1692.458) [-1699.676] (-1697.704) (-1697.998) -- 0:03:31
      172500 -- (-1700.278) [-1694.154] (-1696.042) (-1694.419) * (-1693.998) (-1701.693) [-1696.272] (-1696.574) -- 0:03:31
      173000 -- (-1707.046) (-1694.954) [-1691.511] (-1699.300) * (-1695.062) (-1701.167) [-1693.409] (-1705.995) -- 0:03:30
      173500 -- (-1694.967) (-1700.594) (-1698.782) [-1692.427] * (-1702.861) (-1696.663) [-1696.959] (-1699.993) -- 0:03:29
      174000 -- (-1698.017) [-1693.746] (-1694.989) (-1698.301) * (-1701.141) (-1703.391) [-1695.001] (-1690.558) -- 0:03:28
      174500 -- (-1692.295) (-1699.192) (-1697.006) [-1696.539] * (-1699.797) [-1692.158] (-1695.667) (-1693.874) -- 0:03:28
      175000 -- [-1691.147] (-1703.759) (-1692.026) (-1705.966) * (-1698.729) (-1698.782) (-1695.098) [-1692.818] -- 0:03:27

      Average standard deviation of split frequencies: 0.014062

      175500 -- (-1697.286) (-1690.376) [-1692.656] (-1705.459) * (-1699.128) [-1692.799] (-1697.927) (-1692.058) -- 0:03:31
      176000 -- [-1695.532] (-1696.081) (-1696.584) (-1712.295) * (-1696.821) (-1702.418) [-1699.057] (-1694.265) -- 0:03:30
      176500 -- [-1693.736] (-1692.630) (-1695.848) (-1698.351) * (-1706.247) (-1699.180) (-1696.127) [-1693.754] -- 0:03:29
      177000 -- (-1693.602) (-1696.520) (-1698.633) [-1696.055] * (-1692.799) (-1705.636) (-1695.054) [-1695.031] -- 0:03:29
      177500 -- (-1696.707) (-1708.209) (-1700.623) [-1693.758] * (-1694.565) [-1699.961] (-1702.567) (-1694.622) -- 0:03:28
      178000 -- [-1696.115] (-1692.169) (-1695.191) (-1697.041) * (-1699.236) (-1698.536) [-1700.750] (-1694.086) -- 0:03:27
      178500 -- (-1700.028) [-1695.807] (-1700.831) (-1696.785) * (-1694.866) (-1696.923) [-1698.628] (-1697.686) -- 0:03:27
      179000 -- (-1694.409) (-1694.622) (-1698.005) [-1696.932] * (-1708.392) [-1699.011] (-1697.470) (-1694.462) -- 0:03:26
      179500 -- (-1694.004) (-1702.101) [-1695.860] (-1698.251) * (-1700.981) [-1699.002] (-1704.423) (-1694.480) -- 0:03:30
      180000 -- [-1692.436] (-1702.404) (-1704.512) (-1692.307) * (-1699.110) (-1693.722) (-1704.856) [-1689.380] -- 0:03:29

      Average standard deviation of split frequencies: 0.009132

      180500 -- [-1698.833] (-1692.974) (-1693.200) (-1694.988) * (-1698.524) (-1698.821) [-1694.838] (-1697.741) -- 0:03:28
      181000 -- (-1709.939) (-1697.248) [-1693.473] (-1695.718) * (-1701.618) (-1698.933) [-1698.933] (-1697.218) -- 0:03:28
      181500 -- [-1698.644] (-1698.978) (-1693.717) (-1697.884) * (-1699.416) (-1701.028) [-1694.197] (-1697.193) -- 0:03:27
      182000 -- (-1698.399) (-1697.327) (-1693.382) [-1694.514] * [-1699.987] (-1697.169) (-1694.233) (-1703.269) -- 0:03:26
      182500 -- (-1695.928) (-1702.520) [-1697.617] (-1698.027) * [-1694.667] (-1694.571) (-1703.429) (-1702.781) -- 0:03:26
      183000 -- (-1695.741) (-1703.978) (-1698.025) [-1699.680] * [-1693.509] (-1698.739) (-1698.138) (-1701.801) -- 0:03:25
      183500 -- [-1698.395] (-1714.950) (-1694.236) (-1695.854) * [-1698.496] (-1696.035) (-1694.645) (-1703.088) -- 0:03:29
      184000 -- (-1697.519) (-1710.568) [-1697.331] (-1699.341) * (-1696.957) (-1704.073) (-1692.550) [-1696.452] -- 0:03:28
      184500 -- (-1700.098) (-1705.243) (-1699.255) [-1693.308] * (-1704.047) [-1697.314] (-1695.982) (-1699.973) -- 0:03:27
      185000 -- (-1700.890) (-1710.866) [-1698.357] (-1694.194) * (-1691.166) [-1697.674] (-1700.145) (-1700.092) -- 0:03:27

      Average standard deviation of split frequencies: 0.009504

      185500 -- [-1699.530] (-1706.797) (-1693.425) (-1699.544) * [-1690.863] (-1698.851) (-1696.679) (-1706.422) -- 0:03:26
      186000 -- (-1698.744) (-1696.784) [-1689.624] (-1697.415) * (-1697.365) [-1696.334] (-1695.162) (-1705.654) -- 0:03:25
      186500 -- (-1699.973) (-1699.095) (-1692.007) [-1692.681] * (-1690.980) (-1694.814) (-1698.589) [-1693.919] -- 0:03:25
      187000 -- (-1701.697) (-1696.944) [-1698.456] (-1690.260) * [-1697.868] (-1697.526) (-1697.316) (-1690.269) -- 0:03:24
      187500 -- [-1698.167] (-1698.598) (-1702.438) (-1690.298) * (-1706.696) (-1700.362) (-1695.675) [-1694.403] -- 0:03:28
      188000 -- (-1699.504) (-1701.055) (-1698.772) [-1693.389] * [-1698.054] (-1700.997) (-1695.134) (-1690.290) -- 0:03:27
      188500 -- (-1695.734) (-1703.639) (-1700.412) [-1694.687] * (-1700.254) [-1697.769] (-1692.846) (-1693.588) -- 0:03:26
      189000 -- (-1704.411) [-1698.405] (-1703.384) (-1693.783) * (-1703.352) (-1699.612) (-1692.774) [-1689.528] -- 0:03:25
      189500 -- (-1697.966) [-1705.143] (-1699.410) (-1696.604) * [-1698.228] (-1699.176) (-1691.540) (-1692.503) -- 0:03:25
      190000 -- [-1705.364] (-1697.543) (-1701.672) (-1696.018) * (-1704.534) (-1698.938) (-1692.362) [-1696.698] -- 0:03:24

      Average standard deviation of split frequencies: 0.009272

      190500 -- [-1701.663] (-1691.353) (-1698.593) (-1697.619) * (-1692.524) [-1703.032] (-1697.676) (-1695.446) -- 0:03:23
      191000 -- (-1702.567) [-1691.329] (-1702.231) (-1692.536) * (-1699.804) (-1694.824) [-1702.056] (-1697.434) -- 0:03:23
      191500 -- [-1704.275] (-1691.674) (-1698.804) (-1696.054) * (-1693.278) [-1699.640] (-1698.297) (-1697.255) -- 0:03:26
      192000 -- (-1701.866) (-1697.966) [-1702.329] (-1694.231) * (-1694.792) (-1698.291) [-1691.650] (-1701.300) -- 0:03:26
      192500 -- (-1696.270) (-1695.463) (-1704.316) [-1697.765] * (-1697.000) (-1694.761) [-1694.017] (-1704.351) -- 0:03:25
      193000 -- (-1696.381) [-1695.740] (-1702.375) (-1696.064) * (-1698.316) [-1699.132] (-1704.593) (-1705.217) -- 0:03:24
      193500 -- (-1694.698) (-1695.445) [-1696.327] (-1697.702) * (-1696.589) [-1700.185] (-1697.639) (-1699.708) -- 0:03:24
      194000 -- [-1701.132] (-1693.304) (-1697.302) (-1695.114) * (-1696.845) [-1693.461] (-1700.954) (-1695.349) -- 0:03:23
      194500 -- [-1696.929] (-1694.371) (-1699.328) (-1696.125) * (-1696.300) [-1689.742] (-1696.879) (-1700.943) -- 0:03:22
      195000 -- (-1696.859) (-1698.803) [-1692.811] (-1695.994) * [-1696.853] (-1700.061) (-1697.616) (-1698.315) -- 0:03:26

      Average standard deviation of split frequencies: 0.004209

      195500 -- [-1694.943] (-1695.363) (-1695.007) (-1696.242) * (-1701.502) (-1696.100) [-1693.342] (-1694.468) -- 0:03:25
      196000 -- (-1697.694) (-1695.245) [-1690.248] (-1696.613) * (-1706.172) (-1696.957) (-1692.547) [-1692.614] -- 0:03:25
      196500 -- (-1698.354) (-1693.985) [-1693.508] (-1704.003) * (-1696.002) [-1691.227] (-1693.411) (-1699.450) -- 0:03:24
      197000 -- (-1692.759) (-1695.559) (-1695.360) [-1702.132] * (-1699.195) [-1694.818] (-1692.054) (-1704.843) -- 0:03:23
      197500 -- (-1693.238) (-1704.474) [-1693.624] (-1696.441) * (-1698.136) [-1698.805] (-1694.927) (-1697.568) -- 0:03:23
      198000 -- (-1695.395) (-1700.513) (-1694.452) [-1699.378] * (-1691.547) (-1698.765) (-1693.153) [-1697.231] -- 0:03:22
      198500 -- (-1695.279) [-1695.293] (-1695.382) (-1700.961) * (-1695.006) (-1710.244) [-1698.151] (-1697.716) -- 0:03:21
      199000 -- (-1691.916) (-1698.868) [-1704.110] (-1708.029) * (-1700.114) (-1700.938) (-1696.168) [-1700.071] -- 0:03:25
      199500 -- (-1698.995) [-1697.143] (-1697.401) (-1696.718) * (-1703.236) (-1705.545) [-1697.108] (-1696.270) -- 0:03:24
      200000 -- [-1694.562] (-1702.722) (-1699.992) (-1705.227) * (-1697.063) (-1704.064) [-1695.408] (-1698.330) -- 0:03:24

      Average standard deviation of split frequencies: 0.005873

      200500 -- [-1696.575] (-1703.267) (-1696.808) (-1702.407) * (-1696.919) (-1708.405) [-1696.421] (-1693.986) -- 0:03:23
      201000 -- (-1695.934) [-1696.831] (-1700.926) (-1695.743) * (-1695.328) (-1702.867) (-1700.596) [-1694.637] -- 0:03:22
      201500 -- [-1692.722] (-1704.127) (-1700.237) (-1697.525) * [-1691.901] (-1706.020) (-1698.601) (-1696.499) -- 0:03:22
      202000 -- (-1690.451) [-1699.448] (-1699.919) (-1700.616) * (-1691.999) (-1706.398) [-1696.755] (-1695.645) -- 0:03:21
      202500 -- (-1700.168) (-1693.153) (-1698.926) [-1698.115] * (-1700.009) (-1703.361) (-1694.383) [-1698.937] -- 0:03:20
      203000 -- [-1694.183] (-1700.431) (-1699.158) (-1691.663) * (-1696.397) (-1704.554) (-1699.390) [-1693.069] -- 0:03:24
      203500 -- (-1692.982) (-1699.470) (-1695.393) [-1700.122] * (-1696.432) [-1708.143] (-1702.909) (-1695.753) -- 0:03:23
      204000 -- [-1696.427] (-1693.058) (-1699.331) (-1702.209) * [-1695.812] (-1696.360) (-1695.189) (-1692.480) -- 0:03:22
      204500 -- (-1696.208) (-1698.841) (-1698.641) [-1701.812] * (-1695.407) (-1702.589) [-1693.509] (-1697.152) -- 0:03:22
      205000 -- [-1689.220] (-1696.006) (-1707.036) (-1704.228) * (-1696.999) (-1694.229) [-1698.047] (-1703.100) -- 0:03:21

      Average standard deviation of split frequencies: 0.005721

      205500 -- (-1698.621) (-1697.728) (-1703.104) [-1706.034] * (-1698.681) (-1694.884) (-1695.104) [-1693.778] -- 0:03:21
      206000 -- [-1695.225] (-1699.314) (-1701.505) (-1703.668) * (-1696.532) [-1694.498] (-1693.584) (-1699.910) -- 0:03:20
      206500 -- (-1703.592) (-1693.795) [-1691.813] (-1705.381) * (-1705.930) (-1702.049) [-1696.382] (-1692.914) -- 0:03:19
      207000 -- (-1706.524) [-1691.224] (-1698.788) (-1694.763) * [-1694.219] (-1695.546) (-1697.741) (-1702.431) -- 0:03:23
      207500 -- (-1702.032) (-1701.399) [-1697.587] (-1696.280) * (-1695.167) (-1690.443) [-1692.586] (-1694.873) -- 0:03:22
      208000 -- (-1699.260) (-1697.527) (-1696.024) [-1697.373] * (-1695.434) (-1693.850) (-1705.291) [-1699.064] -- 0:03:21
      208500 -- [-1702.111] (-1704.765) (-1701.159) (-1701.745) * [-1701.093] (-1697.251) (-1696.960) (-1694.509) -- 0:03:21
      209000 -- [-1699.208] (-1696.352) (-1701.258) (-1690.685) * [-1699.111] (-1691.541) (-1693.741) (-1694.789) -- 0:03:20
      209500 -- (-1698.826) (-1694.496) (-1694.494) [-1700.658] * (-1695.761) (-1692.857) (-1690.346) [-1690.364] -- 0:03:19
      210000 -- (-1700.826) (-1696.821) (-1696.531) [-1695.859] * (-1697.406) [-1696.716] (-1693.653) (-1700.531) -- 0:03:19

      Average standard deviation of split frequencies: 0.005035

      210500 -- (-1698.318) (-1706.731) [-1700.331] (-1698.595) * (-1701.747) (-1700.714) (-1700.793) [-1696.702] -- 0:03:18
      211000 -- [-1698.726] (-1692.039) (-1695.436) (-1701.187) * (-1696.240) [-1698.038] (-1701.724) (-1700.581) -- 0:03:21
      211500 -- (-1696.804) [-1698.539] (-1699.311) (-1697.049) * (-1690.887) (-1698.482) (-1691.705) [-1694.810] -- 0:03:21
      212000 -- (-1699.706) (-1698.358) (-1698.974) [-1696.412] * (-1693.910) (-1702.382) [-1693.014] (-1696.588) -- 0:03:20
      212500 -- (-1699.382) [-1693.987] (-1695.459) (-1697.171) * (-1695.371) (-1692.358) [-1695.256] (-1693.707) -- 0:03:20
      213000 -- (-1703.460) (-1693.393) (-1694.490) [-1697.077] * (-1691.262) (-1690.012) [-1696.991] (-1691.715) -- 0:03:19
      213500 -- (-1699.882) (-1701.895) (-1690.684) [-1699.776] * (-1699.184) (-1696.443) (-1695.015) [-1697.182] -- 0:03:18
      214000 -- (-1698.355) (-1691.864) [-1689.523] (-1703.577) * (-1694.565) (-1694.802) [-1699.096] (-1694.707) -- 0:03:18
      214500 -- (-1701.860) (-1695.995) [-1693.391] (-1695.826) * [-1693.772] (-1708.208) (-1692.376) (-1698.450) -- 0:03:17
      215000 -- [-1692.256] (-1695.617) (-1700.586) (-1701.299) * [-1697.481] (-1697.225) (-1696.584) (-1696.443) -- 0:03:20

      Average standard deviation of split frequencies: 0.004910

      215500 -- (-1698.489) (-1693.857) [-1701.370] (-1704.986) * (-1694.475) [-1698.466] (-1693.583) (-1697.796) -- 0:03:20
      216000 -- [-1692.220] (-1703.760) (-1700.539) (-1699.181) * (-1697.589) [-1704.122] (-1695.228) (-1698.053) -- 0:03:19
      216500 -- (-1692.439) (-1697.330) [-1698.759] (-1702.844) * (-1698.924) [-1690.676] (-1695.840) (-1691.319) -- 0:03:19
      217000 -- (-1695.220) [-1698.288] (-1701.158) (-1694.690) * (-1697.802) [-1696.521] (-1692.788) (-1692.250) -- 0:03:18
      217500 -- [-1690.397] (-1703.802) (-1691.983) (-1695.319) * (-1694.492) (-1697.051) [-1701.153] (-1693.828) -- 0:03:17
      218000 -- (-1693.984) (-1702.805) [-1698.991] (-1692.180) * [-1695.578] (-1698.740) (-1699.400) (-1695.380) -- 0:03:17
      218500 -- (-1693.874) (-1701.411) [-1702.941] (-1695.506) * [-1693.374] (-1699.346) (-1694.111) (-1700.609) -- 0:03:16
      219000 -- [-1692.705] (-1710.869) (-1692.705) (-1694.467) * [-1691.813] (-1703.242) (-1697.499) (-1698.260) -- 0:03:19
      219500 -- (-1698.350) (-1700.494) [-1697.345] (-1694.485) * (-1695.595) (-1700.367) (-1695.157) [-1692.882] -- 0:03:19
      220000 -- (-1697.935) [-1695.743] (-1695.287) (-1702.762) * (-1697.110) (-1700.863) (-1695.207) [-1697.281] -- 0:03:18

      Average standard deviation of split frequencies: 0.004273

      220500 -- [-1694.885] (-1698.267) (-1691.901) (-1703.645) * (-1702.562) (-1698.298) (-1696.560) [-1692.334] -- 0:03:17
      221000 -- [-1694.238] (-1698.743) (-1696.710) (-1698.381) * (-1699.027) (-1694.272) (-1699.205) [-1691.591] -- 0:03:17
      221500 -- [-1692.523] (-1701.721) (-1696.649) (-1704.836) * (-1699.851) [-1702.352] (-1698.384) (-1698.232) -- 0:03:16
      222000 -- [-1693.283] (-1696.744) (-1702.264) (-1693.007) * (-1697.455) [-1691.798] (-1692.480) (-1703.792) -- 0:03:16
      222500 -- (-1694.524) (-1698.594) (-1698.506) [-1692.131] * (-1699.890) [-1695.485] (-1696.369) (-1697.168) -- 0:03:15
      223000 -- (-1694.039) (-1710.544) (-1700.434) [-1699.604] * (-1697.788) (-1694.916) (-1698.383) [-1692.609] -- 0:03:18
      223500 -- (-1702.987) [-1699.199] (-1698.292) (-1692.011) * [-1694.886] (-1696.145) (-1694.308) (-1692.988) -- 0:03:18
      224000 -- (-1701.345) (-1699.570) (-1699.932) [-1694.816] * [-1695.598] (-1700.942) (-1694.118) (-1698.669) -- 0:03:17
      224500 -- [-1694.545] (-1695.947) (-1697.718) (-1691.158) * (-1695.863) (-1703.901) (-1696.006) [-1693.155] -- 0:03:16
      225000 -- (-1696.751) [-1694.899] (-1696.279) (-1692.861) * [-1695.020] (-1702.692) (-1691.822) (-1691.354) -- 0:03:16

      Average standard deviation of split frequencies: 0.004693

      225500 -- (-1717.676) (-1700.363) [-1693.575] (-1697.523) * (-1698.111) [-1694.735] (-1700.948) (-1700.859) -- 0:03:15
      226000 -- (-1694.563) [-1694.299] (-1696.525) (-1693.846) * (-1701.269) [-1694.791] (-1697.685) (-1690.755) -- 0:03:15
      226500 -- (-1697.236) (-1696.084) (-1697.859) [-1695.157] * (-1696.666) [-1689.328] (-1695.568) (-1702.593) -- 0:03:14
      227000 -- (-1695.418) (-1702.369) (-1697.718) [-1697.735] * (-1699.450) [-1696.083] (-1694.330) (-1695.771) -- 0:03:17
      227500 -- [-1699.125] (-1699.430) (-1700.286) (-1696.393) * (-1692.705) (-1699.271) [-1696.329] (-1695.080) -- 0:03:16
      228000 -- (-1699.262) (-1700.086) [-1703.361] (-1695.549) * (-1694.795) (-1697.312) [-1696.644] (-1692.535) -- 0:03:16
      228500 -- (-1698.006) (-1700.533) (-1701.991) [-1698.501] * [-1695.623] (-1698.699) (-1695.824) (-1701.983) -- 0:03:15
      229000 -- (-1700.386) (-1701.798) (-1705.538) [-1694.761] * [-1694.678] (-1701.339) (-1699.783) (-1700.581) -- 0:03:15
      229500 -- (-1696.856) (-1694.936) (-1705.539) [-1699.518] * (-1697.056) (-1703.939) [-1702.181] (-1691.212) -- 0:03:14
      230000 -- (-1699.668) [-1693.797] (-1696.739) (-1691.452) * (-1700.361) (-1711.835) (-1698.715) [-1694.462] -- 0:03:14

      Average standard deviation of split frequencies: 0.005109

      230500 -- (-1710.792) [-1697.449] (-1691.576) (-1698.618) * (-1705.344) (-1703.251) [-1693.347] (-1696.218) -- 0:03:13
      231000 -- (-1701.030) [-1711.189] (-1694.309) (-1694.468) * (-1706.380) [-1691.278] (-1695.885) (-1695.168) -- 0:03:16
      231500 -- (-1707.675) (-1703.372) [-1695.139] (-1697.400) * (-1703.146) (-1694.616) [-1694.693] (-1696.820) -- 0:03:15
      232000 -- (-1700.795) [-1695.835] (-1692.825) (-1700.008) * (-1702.564) (-1695.596) [-1702.558] (-1697.009) -- 0:03:15
      232500 -- (-1697.481) [-1695.578] (-1690.254) (-1699.899) * (-1702.437) (-1700.263) [-1690.188] (-1693.935) -- 0:03:14
      233000 -- (-1703.913) (-1695.710) [-1693.732] (-1705.849) * (-1707.719) (-1696.900) (-1693.736) [-1691.640] -- 0:03:14
      233500 -- (-1711.874) [-1693.967] (-1690.600) (-1699.644) * (-1701.710) [-1694.343] (-1702.476) (-1695.453) -- 0:03:13
      234000 -- (-1701.738) [-1692.348] (-1703.513) (-1704.794) * (-1700.225) [-1695.172] (-1712.193) (-1696.694) -- 0:03:13
      234500 -- [-1691.537] (-1698.957) (-1703.721) (-1692.573) * (-1699.733) [-1700.523] (-1704.152) (-1705.283) -- 0:03:15
      235000 -- (-1695.793) (-1693.499) (-1695.279) [-1694.740] * (-1709.223) (-1701.676) [-1697.093] (-1703.893) -- 0:03:15

      Average standard deviation of split frequencies: 0.004494

      235500 -- (-1693.828) (-1692.117) (-1703.064) [-1697.128] * (-1702.095) [-1693.540] (-1692.333) (-1699.093) -- 0:03:14
      236000 -- (-1692.469) [-1699.402] (-1706.893) (-1694.860) * (-1694.574) [-1695.214] (-1699.092) (-1698.195) -- 0:03:14
      236500 -- (-1696.905) (-1696.299) (-1701.670) [-1693.135] * (-1692.306) (-1703.543) [-1693.664] (-1699.668) -- 0:03:13
      237000 -- (-1700.916) (-1692.592) [-1698.621] (-1695.590) * [-1692.501] (-1703.497) (-1704.618) (-1696.964) -- 0:03:13
      237500 -- (-1696.388) [-1692.434] (-1701.741) (-1690.454) * (-1694.102) (-1696.804) [-1701.935] (-1696.735) -- 0:03:12
      238000 -- (-1695.830) [-1700.124] (-1699.290) (-1693.029) * (-1708.852) (-1697.827) [-1694.642] (-1698.244) -- 0:03:12
      238500 -- (-1696.603) [-1692.328] (-1695.046) (-1693.339) * (-1694.988) (-1694.103) [-1689.429] (-1704.619) -- 0:03:14
      239000 -- (-1699.131) (-1693.772) (-1696.165) [-1691.735] * (-1693.373) [-1692.214] (-1699.927) (-1696.440) -- 0:03:14
      239500 -- (-1696.767) (-1698.532) (-1697.536) [-1692.421] * (-1694.925) (-1690.950) (-1696.888) [-1695.984] -- 0:03:13
      240000 -- [-1697.533] (-1695.559) (-1693.247) (-1696.293) * (-1699.523) (-1696.850) [-1699.784] (-1705.927) -- 0:03:13

      Average standard deviation of split frequencies: 0.004407

      240500 -- (-1696.779) (-1696.328) [-1696.317] (-1697.633) * (-1695.053) (-1698.816) [-1691.925] (-1693.195) -- 0:03:12
      241000 -- (-1698.353) [-1692.878] (-1695.421) (-1697.255) * (-1699.849) (-1694.647) [-1693.036] (-1692.829) -- 0:03:12
      241500 -- (-1694.413) [-1695.938] (-1699.454) (-1695.890) * (-1704.979) [-1700.696] (-1691.224) (-1699.203) -- 0:03:11
      242000 -- [-1693.068] (-1696.339) (-1693.922) (-1704.010) * (-1701.799) (-1697.152) (-1691.157) [-1695.630] -- 0:03:11
      242500 -- (-1704.521) (-1698.265) [-1692.991] (-1705.105) * (-1698.577) (-1694.094) (-1698.170) [-1701.799] -- 0:03:13
      243000 -- (-1702.715) [-1703.395] (-1698.066) (-1698.944) * (-1700.771) (-1693.860) [-1698.010] (-1697.879) -- 0:03:13
      243500 -- (-1702.561) (-1699.276) [-1698.342] (-1700.259) * (-1699.477) [-1694.355] (-1701.501) (-1695.253) -- 0:03:12
      244000 -- (-1704.088) [-1696.725] (-1709.721) (-1696.857) * (-1702.740) [-1694.373] (-1697.104) (-1700.249) -- 0:03:12
      244500 -- [-1696.738] (-1692.707) (-1697.615) (-1695.125) * (-1706.692) [-1699.841] (-1697.357) (-1698.916) -- 0:03:11
      245000 -- (-1693.330) [-1693.600] (-1700.546) (-1701.603) * (-1699.577) (-1702.462) [-1690.657] (-1695.281) -- 0:03:11

      Average standard deviation of split frequencies: 0.005270

      245500 -- (-1698.400) (-1699.000) (-1700.488) [-1699.771] * (-1696.664) (-1700.065) (-1699.852) [-1698.051] -- 0:03:10
      246000 -- (-1694.627) (-1699.183) (-1704.424) [-1696.794] * (-1698.219) (-1695.378) [-1698.203] (-1694.424) -- 0:03:10
      246500 -- (-1697.835) (-1705.928) [-1695.558] (-1695.581) * (-1696.708) (-1700.122) [-1697.183] (-1701.597) -- 0:03:12
      247000 -- (-1702.515) [-1698.669] (-1696.366) (-1693.903) * [-1690.038] (-1700.249) (-1696.998) (-1693.664) -- 0:03:12
      247500 -- [-1696.804] (-1696.096) (-1698.927) (-1700.060) * (-1695.658) [-1694.802] (-1693.029) (-1700.767) -- 0:03:11
      248000 -- (-1693.548) (-1699.833) (-1694.943) [-1692.660] * (-1693.158) [-1694.299] (-1693.666) (-1700.264) -- 0:03:11
      248500 -- (-1697.537) (-1705.060) [-1697.731] (-1695.280) * (-1699.278) (-1694.789) (-1695.782) [-1699.285] -- 0:03:10
      249000 -- (-1700.492) [-1695.533] (-1702.465) (-1695.487) * (-1696.624) (-1702.476) [-1697.988] (-1696.325) -- 0:03:10
      249500 -- (-1695.181) (-1695.129) (-1694.750) [-1698.594] * [-1697.794] (-1700.081) (-1695.389) (-1694.143) -- 0:03:09
      250000 -- (-1694.355) [-1690.752] (-1696.254) (-1699.282) * (-1704.645) [-1694.450] (-1695.186) (-1700.869) -- 0:03:09

      Average standard deviation of split frequencies: 0.006112

      250500 -- (-1703.804) [-1693.194] (-1699.427) (-1696.826) * [-1703.875] (-1693.896) (-1700.012) (-1696.533) -- 0:03:11
      251000 -- (-1701.586) [-1696.534] (-1694.753) (-1697.437) * [-1696.094] (-1694.960) (-1709.258) (-1696.766) -- 0:03:10
      251500 -- (-1698.325) [-1689.597] (-1699.019) (-1698.319) * (-1702.799) (-1697.056) [-1695.279] (-1698.464) -- 0:03:10
      252000 -- (-1695.963) [-1693.104] (-1694.442) (-1695.755) * [-1697.417] (-1694.467) (-1696.819) (-1695.387) -- 0:03:09
      252500 -- [-1695.671] (-1699.808) (-1699.601) (-1695.634) * (-1698.620) [-1692.324] (-1692.870) (-1698.962) -- 0:03:09
      253000 -- (-1694.671) [-1690.947] (-1693.736) (-1699.270) * (-1695.925) [-1699.954] (-1694.443) (-1699.509) -- 0:03:08
      253500 -- (-1694.023) [-1694.440] (-1702.356) (-1691.323) * [-1691.571] (-1706.622) (-1694.503) (-1697.250) -- 0:03:08
      254000 -- (-1698.676) (-1702.018) [-1695.166] (-1700.845) * (-1688.951) [-1697.009] (-1696.527) (-1699.779) -- 0:03:07
      254500 -- [-1692.188] (-1696.260) (-1693.214) (-1699.209) * (-1696.733) (-1696.654) (-1700.892) [-1703.918] -- 0:03:10
      255000 -- (-1700.682) [-1694.513] (-1698.002) (-1695.254) * (-1702.483) (-1696.842) [-1695.874] (-1692.430) -- 0:03:09

      Average standard deviation of split frequencies: 0.005985

      255500 -- [-1693.311] (-1692.920) (-1700.689) (-1691.948) * (-1698.550) (-1699.485) (-1692.214) [-1695.174] -- 0:03:09
      256000 -- [-1697.295] (-1695.558) (-1700.872) (-1697.103) * (-1698.929) (-1698.377) [-1693.174] (-1695.493) -- 0:03:08
      256500 -- [-1691.351] (-1697.592) (-1696.288) (-1696.148) * (-1698.311) (-1698.165) [-1694.885] (-1697.618) -- 0:03:08
      257000 -- (-1695.267) (-1692.272) (-1697.829) [-1690.348] * (-1698.106) [-1695.737] (-1695.132) (-1695.723) -- 0:03:07
      257500 -- (-1696.366) (-1691.608) [-1700.420] (-1691.913) * [-1696.765] (-1696.253) (-1693.817) (-1700.976) -- 0:03:07
      258000 -- (-1707.210) [-1694.722] (-1696.119) (-1699.655) * (-1693.787) (-1695.190) (-1698.199) [-1699.143] -- 0:03:06
      258500 -- (-1692.069) [-1695.928] (-1701.999) (-1698.554) * (-1693.305) [-1692.520] (-1697.586) (-1702.373) -- 0:03:09
      259000 -- [-1689.542] (-1696.778) (-1697.329) (-1699.847) * (-1695.330) (-1693.819) [-1699.201] (-1692.973) -- 0:03:08
      259500 -- (-1695.531) (-1696.174) [-1701.414] (-1697.721) * (-1692.959) [-1695.705] (-1701.942) (-1700.592) -- 0:03:08
      260000 -- (-1699.668) (-1697.753) (-1700.017) [-1696.240] * [-1691.462] (-1692.636) (-1697.092) (-1696.838) -- 0:03:07

      Average standard deviation of split frequencies: 0.006330

      260500 -- [-1696.423] (-1698.808) (-1693.992) (-1699.017) * [-1693.628] (-1695.069) (-1697.536) (-1699.651) -- 0:03:07
      261000 -- (-1700.169) [-1698.276] (-1703.408) (-1695.138) * (-1698.800) (-1701.947) (-1700.021) [-1698.412] -- 0:03:06
      261500 -- (-1703.706) (-1693.911) (-1696.713) [-1695.981] * [-1696.083] (-1700.556) (-1699.685) (-1698.307) -- 0:03:06
      262000 -- (-1695.233) (-1694.481) (-1699.240) [-1693.017] * (-1699.195) (-1691.667) (-1709.466) [-1703.777] -- 0:03:05
      262500 -- [-1698.356] (-1693.195) (-1702.483) (-1693.414) * (-1699.136) (-1692.641) [-1700.518] (-1708.852) -- 0:03:08
      263000 -- (-1696.254) (-1695.629) [-1694.952] (-1695.030) * (-1697.687) [-1692.565] (-1699.949) (-1701.216) -- 0:03:07
      263500 -- (-1695.533) (-1695.470) [-1692.985] (-1693.635) * [-1700.918] (-1693.150) (-1695.568) (-1706.973) -- 0:03:07
      264000 -- (-1703.227) (-1697.404) (-1694.000) [-1692.764] * (-1703.702) [-1700.388] (-1699.661) (-1703.717) -- 0:03:06
      264500 -- (-1697.876) [-1700.972] (-1694.347) (-1702.438) * [-1695.154] (-1701.210) (-1699.023) (-1699.234) -- 0:03:06
      265000 -- (-1695.907) (-1701.942) (-1695.150) [-1695.302] * (-1705.471) [-1695.598] (-1696.252) (-1696.185) -- 0:03:05

      Average standard deviation of split frequencies: 0.005760

      265500 -- (-1693.391) (-1697.876) (-1696.210) [-1697.897] * (-1693.240) (-1697.095) (-1698.582) [-1694.671] -- 0:03:05
      266000 -- [-1700.884] (-1704.064) (-1699.467) (-1696.470) * (-1700.972) (-1699.709) [-1693.355] (-1697.233) -- 0:03:04
      266500 -- (-1706.603) (-1700.733) (-1701.386) [-1695.046] * (-1697.546) (-1698.215) [-1695.637] (-1695.386) -- 0:03:07
      267000 -- (-1701.109) [-1694.787] (-1699.367) (-1699.651) * (-1701.114) [-1690.534] (-1701.937) (-1696.014) -- 0:03:06
      267500 -- (-1703.619) (-1698.759) [-1698.649] (-1698.955) * (-1697.485) (-1700.159) [-1703.948] (-1695.399) -- 0:03:06
      268000 -- [-1700.580] (-1691.391) (-1699.808) (-1698.927) * (-1692.918) [-1695.104] (-1694.818) (-1703.060) -- 0:03:05
      268500 -- (-1695.970) (-1701.205) [-1696.448] (-1694.073) * (-1695.745) (-1698.936) [-1694.998] (-1701.275) -- 0:03:05
      269000 -- (-1705.472) (-1695.230) (-1703.038) [-1701.133] * (-1699.982) [-1694.267] (-1693.885) (-1698.226) -- 0:03:04
      269500 -- (-1696.143) (-1697.680) (-1708.115) [-1694.237] * (-1695.888) [-1701.293] (-1697.761) (-1700.022) -- 0:03:04
      270000 -- [-1694.616] (-1692.893) (-1707.005) (-1705.572) * (-1709.031) [-1703.494] (-1693.394) (-1695.101) -- 0:03:03

      Average standard deviation of split frequencies: 0.006096

      270500 -- (-1693.648) (-1694.681) [-1694.482] (-1698.539) * (-1699.565) [-1699.652] (-1697.913) (-1692.531) -- 0:03:06
      271000 -- [-1693.572] (-1696.035) (-1693.410) (-1692.280) * (-1701.719) (-1692.410) (-1700.854) [-1694.684] -- 0:03:05
      271500 -- (-1697.488) (-1698.264) (-1696.872) [-1701.885] * [-1701.396] (-1695.269) (-1696.731) (-1700.836) -- 0:03:05
      272000 -- (-1699.328) [-1689.105] (-1697.370) (-1703.533) * (-1703.590) (-1696.973) (-1701.566) [-1698.964] -- 0:03:04
      272500 -- [-1701.806] (-1694.956) (-1694.751) (-1709.558) * (-1693.995) (-1697.401) (-1703.390) [-1691.501] -- 0:03:04
      273000 -- (-1695.162) (-1693.463) [-1694.097] (-1696.309) * (-1698.232) [-1694.351] (-1705.640) (-1693.851) -- 0:03:03
      273500 -- (-1694.252) (-1691.373) [-1690.642] (-1700.986) * (-1694.094) (-1696.579) (-1703.898) [-1695.349] -- 0:03:03
      274000 -- (-1692.289) (-1697.921) (-1700.871) [-1696.702] * [-1697.825] (-1697.378) (-1699.046) (-1694.363) -- 0:03:02
      274500 -- (-1706.480) (-1700.119) [-1698.461] (-1700.021) * (-1693.434) (-1699.429) [-1694.460] (-1696.709) -- 0:03:05
      275000 -- (-1697.352) (-1701.671) (-1699.266) [-1695.421] * (-1697.355) (-1696.951) [-1693.656] (-1692.740) -- 0:03:04

      Average standard deviation of split frequencies: 0.006405

      275500 -- [-1702.089] (-1711.816) (-1695.478) (-1702.593) * (-1701.520) (-1701.818) [-1699.944] (-1698.756) -- 0:03:04
      276000 -- (-1706.250) (-1698.574) (-1701.645) [-1698.651] * (-1708.331) (-1701.195) [-1696.098] (-1705.398) -- 0:03:03
      276500 -- (-1696.173) (-1713.360) (-1699.811) [-1696.282] * (-1705.986) (-1698.567) (-1693.187) [-1695.821] -- 0:03:03
      277000 -- (-1695.470) (-1700.555) [-1691.956] (-1697.687) * (-1700.370) [-1700.053] (-1700.870) (-1692.146) -- 0:03:02
      277500 -- (-1696.473) (-1708.101) (-1694.886) [-1690.674] * (-1700.221) [-1697.439] (-1696.422) (-1699.982) -- 0:03:02
      278000 -- (-1699.062) (-1697.641) (-1693.109) [-1691.808] * (-1706.046) (-1697.693) [-1698.501] (-1694.328) -- 0:03:01
      278500 -- (-1696.320) (-1694.056) (-1705.937) [-1703.973] * (-1696.074) (-1698.484) [-1696.532] (-1693.602) -- 0:03:03
      279000 -- [-1693.393] (-1696.993) (-1699.779) (-1697.873) * [-1698.902] (-1699.796) (-1693.720) (-1696.201) -- 0:03:03
      279500 -- (-1706.500) (-1696.573) [-1693.411] (-1692.227) * (-1709.033) (-1693.570) (-1698.337) [-1696.860] -- 0:03:03
      280000 -- [-1696.575] (-1693.310) (-1694.976) (-1703.892) * (-1697.546) (-1702.247) (-1694.536) [-1698.401] -- 0:03:02

      Average standard deviation of split frequencies: 0.006298

      280500 -- (-1693.052) (-1699.493) [-1697.017] (-1695.357) * (-1696.166) (-1701.760) [-1700.755] (-1692.604) -- 0:03:02
      281000 -- (-1698.833) (-1693.143) [-1696.449] (-1692.373) * (-1701.891) (-1701.904) [-1694.829] (-1697.851) -- 0:03:01
      281500 -- (-1695.923) (-1691.451) (-1700.728) [-1694.217] * [-1694.380] (-1698.620) (-1697.452) (-1711.159) -- 0:03:01
      282000 -- [-1694.050] (-1696.479) (-1701.562) (-1694.794) * (-1697.357) [-1702.403] (-1700.999) (-1699.736) -- 0:03:03
      282500 -- (-1696.976) (-1694.665) (-1694.055) [-1695.084] * [-1690.501] (-1704.745) (-1696.276) (-1696.917) -- 0:03:02
      283000 -- (-1695.028) (-1702.298) [-1696.856] (-1693.559) * (-1699.497) (-1692.408) [-1692.367] (-1696.380) -- 0:03:02
      283500 -- (-1693.110) [-1694.617] (-1696.072) (-1695.834) * (-1699.046) [-1696.463] (-1695.749) (-1704.651) -- 0:03:01
      284000 -- (-1699.483) (-1696.282) (-1692.415) [-1697.013] * (-1692.321) [-1695.445] (-1691.916) (-1694.728) -- 0:03:01
      284500 -- (-1702.041) (-1691.384) (-1693.081) [-1697.124] * [-1696.899] (-1699.795) (-1700.508) (-1704.089) -- 0:03:01
      285000 -- [-1691.410] (-1695.660) (-1697.363) (-1694.353) * [-1693.662] (-1701.651) (-1695.178) (-1697.955) -- 0:03:00

      Average standard deviation of split frequencies: 0.007417

      285500 -- [-1695.155] (-1704.160) (-1696.608) (-1695.313) * (-1696.877) [-1693.267] (-1695.613) (-1700.008) -- 0:03:00
      286000 -- (-1697.821) [-1694.657] (-1699.244) (-1696.342) * (-1698.849) (-1690.895) [-1695.565] (-1696.841) -- 0:03:02
      286500 -- (-1702.887) (-1694.158) (-1700.954) [-1704.664] * (-1699.752) [-1693.111] (-1693.431) (-1700.099) -- 0:03:01
      287000 -- [-1696.709] (-1700.841) (-1700.414) (-1698.101) * (-1710.247) (-1701.669) (-1693.950) [-1690.926] -- 0:03:01
      287500 -- (-1695.188) (-1699.433) [-1697.505] (-1702.399) * [-1699.688] (-1696.665) (-1697.095) (-1698.551) -- 0:03:00
      288000 -- (-1700.252) (-1698.446) (-1705.724) [-1688.226] * [-1701.275] (-1691.617) (-1697.463) (-1690.777) -- 0:03:00
      288500 -- (-1705.215) [-1694.029] (-1708.302) (-1695.103) * (-1701.858) [-1701.874] (-1691.761) (-1693.987) -- 0:03:00
      289000 -- [-1698.107] (-1695.967) (-1701.016) (-1691.976) * (-1701.897) [-1694.841] (-1692.037) (-1694.179) -- 0:02:59
      289500 -- (-1695.689) (-1701.425) (-1694.759) [-1695.356] * (-1695.090) (-1698.328) [-1693.016] (-1701.095) -- 0:02:59
      290000 -- (-1698.374) (-1709.685) [-1695.888] (-1692.909) * [-1691.276] (-1701.996) (-1698.531) (-1698.476) -- 0:03:01

      Average standard deviation of split frequencies: 0.008109

      290500 -- (-1697.895) (-1696.166) [-1700.188] (-1695.081) * (-1698.192) (-1698.451) (-1707.544) [-1689.277] -- 0:03:00
      291000 -- (-1691.542) (-1694.976) (-1701.775) [-1692.233] * (-1700.182) [-1691.385] (-1700.768) (-1701.683) -- 0:03:00
      291500 -- (-1693.713) [-1692.486] (-1702.233) (-1699.564) * (-1702.937) (-1697.350) [-1697.933] (-1695.569) -- 0:02:59
      292000 -- [-1700.283] (-1694.715) (-1705.147) (-1694.663) * (-1696.596) (-1698.687) (-1691.963) [-1694.156] -- 0:02:59
      292500 -- (-1696.065) (-1696.045) (-1701.615) [-1694.802] * (-1694.747) [-1696.649] (-1703.492) (-1702.804) -- 0:02:58
      293000 -- [-1692.952] (-1695.891) (-1700.454) (-1695.545) * (-1693.939) (-1697.101) [-1691.542] (-1696.863) -- 0:02:58
      293500 -- [-1692.359] (-1705.362) (-1701.899) (-1696.154) * (-1698.009) [-1695.304] (-1694.575) (-1706.269) -- 0:02:58
      294000 -- (-1701.183) [-1692.317] (-1703.227) (-1697.209) * (-1696.684) [-1693.712] (-1703.753) (-1702.002) -- 0:03:00
      294500 -- (-1690.522) (-1698.197) (-1699.318) [-1694.689] * (-1691.432) (-1704.006) (-1704.657) [-1700.240] -- 0:02:59
      295000 -- (-1698.371) (-1705.515) (-1705.766) [-1691.802] * (-1700.079) (-1695.888) [-1698.054] (-1700.865) -- 0:02:59

      Average standard deviation of split frequencies: 0.007963

      295500 -- (-1702.555) [-1699.708] (-1707.397) (-1695.365) * (-1694.985) (-1700.373) [-1694.798] (-1695.552) -- 0:02:58
      296000 -- (-1698.095) (-1711.558) [-1700.578] (-1695.356) * (-1694.592) (-1696.321) (-1698.595) [-1700.947] -- 0:02:58
      296500 -- (-1700.119) (-1694.858) (-1698.791) [-1690.856] * (-1695.311) (-1701.582) (-1693.383) [-1703.178] -- 0:02:57
      297000 -- (-1695.172) (-1701.309) (-1699.801) [-1695.441] * (-1699.235) (-1697.964) (-1694.304) [-1701.354] -- 0:02:57
      297500 -- (-1707.432) (-1692.490) (-1698.319) [-1695.687] * [-1695.055] (-1697.485) (-1698.679) (-1696.796) -- 0:02:57
      298000 -- (-1704.835) [-1698.861] (-1693.812) (-1695.742) * (-1694.931) (-1695.632) (-1695.340) [-1699.116] -- 0:02:59
      298500 -- (-1704.430) (-1702.840) (-1694.569) [-1693.803] * [-1694.672] (-1693.564) (-1701.715) (-1693.111) -- 0:02:58
      299000 -- (-1701.920) (-1706.448) [-1700.252] (-1698.788) * (-1701.882) (-1700.072) (-1699.945) [-1695.708] -- 0:02:58
      299500 -- [-1696.907] (-1697.019) (-1701.118) (-1709.749) * [-1694.927] (-1695.263) (-1703.947) (-1697.907) -- 0:02:57
      300000 -- [-1695.194] (-1692.779) (-1699.375) (-1699.706) * [-1694.706] (-1700.242) (-1698.005) (-1704.436) -- 0:02:57

      Average standard deviation of split frequencies: 0.008231

      300500 -- (-1704.774) (-1696.860) (-1704.244) [-1698.777] * [-1690.395] (-1698.658) (-1695.890) (-1698.239) -- 0:02:56
      301000 -- (-1696.384) (-1704.797) [-1696.758] (-1704.679) * (-1699.984) [-1690.760] (-1695.937) (-1692.821) -- 0:02:56
      301500 -- [-1696.621] (-1700.771) (-1707.826) (-1689.775) * (-1695.749) (-1694.078) [-1696.296] (-1697.616) -- 0:02:56
      302000 -- [-1691.335] (-1698.570) (-1698.457) (-1696.599) * [-1695.030] (-1700.226) (-1699.170) (-1694.303) -- 0:02:57
      302500 -- (-1703.578) (-1701.580) (-1699.679) [-1694.320] * (-1695.968) (-1699.639) [-1695.191] (-1692.272) -- 0:02:57
      303000 -- (-1696.567) (-1700.269) (-1699.211) [-1696.771] * (-1708.015) (-1699.983) (-1698.889) [-1696.026] -- 0:02:57
      303500 -- (-1696.273) (-1702.068) [-1699.232] (-1697.217) * (-1700.950) [-1692.019] (-1693.645) (-1698.620) -- 0:02:56
      304000 -- [-1694.366] (-1708.731) (-1695.254) (-1699.539) * (-1697.011) (-1698.009) (-1695.049) [-1701.050] -- 0:02:56
      304500 -- [-1695.965] (-1698.013) (-1694.850) (-1695.617) * [-1694.786] (-1694.896) (-1696.084) (-1701.299) -- 0:02:55
      305000 -- (-1699.853) (-1702.131) (-1701.287) [-1694.149] * (-1691.743) [-1694.968] (-1695.193) (-1696.515) -- 0:02:55

      Average standard deviation of split frequencies: 0.008473

      305500 -- [-1695.686] (-1700.975) (-1698.152) (-1701.010) * [-1694.567] (-1692.389) (-1699.090) (-1700.723) -- 0:02:55
      306000 -- (-1697.756) (-1703.904) (-1702.635) [-1697.709] * [-1699.418] (-1694.690) (-1700.424) (-1699.650) -- 0:02:56
      306500 -- [-1694.921] (-1698.171) (-1693.364) (-1697.016) * (-1699.002) (-1694.664) [-1696.122] (-1703.116) -- 0:02:56
      307000 -- (-1695.616) (-1700.304) (-1701.231) [-1696.048] * (-1701.920) (-1704.148) (-1700.613) [-1700.518] -- 0:02:56
      307500 -- (-1702.565) (-1704.898) (-1698.601) [-1698.137] * (-1696.574) [-1701.773] (-1696.408) (-1700.767) -- 0:02:55
      308000 -- (-1700.652) (-1702.271) (-1699.467) [-1701.717] * (-1699.761) [-1698.973] (-1696.512) (-1695.044) -- 0:02:55
      308500 -- (-1696.618) (-1701.456) (-1694.112) [-1698.261] * (-1697.372) (-1700.561) [-1696.140] (-1695.934) -- 0:02:54
      309000 -- (-1697.088) (-1694.409) (-1698.456) [-1696.183] * [-1693.782] (-1708.249) (-1696.507) (-1694.672) -- 0:02:54
      309500 -- (-1690.813) (-1697.339) (-1706.903) [-1698.076] * [-1693.648] (-1700.716) (-1703.973) (-1693.748) -- 0:02:54
      310000 -- [-1693.857] (-1697.404) (-1698.280) (-1700.609) * [-1693.184] (-1699.943) (-1694.870) (-1692.067) -- 0:02:55

      Average standard deviation of split frequencies: 0.008346

      310500 -- [-1698.211] (-1696.805) (-1698.195) (-1694.693) * (-1696.178) (-1718.029) (-1693.863) [-1696.087] -- 0:02:55
      311000 -- [-1699.517] (-1695.611) (-1697.679) (-1704.466) * [-1692.133] (-1699.553) (-1698.192) (-1691.645) -- 0:02:55
      311500 -- [-1696.582] (-1702.439) (-1697.921) (-1697.671) * (-1697.201) [-1694.619] (-1701.700) (-1697.958) -- 0:02:54
      312000 -- (-1694.240) (-1697.274) [-1694.682] (-1692.343) * (-1696.696) (-1699.340) (-1702.738) [-1696.667] -- 0:02:54
      312500 -- (-1702.093) [-1692.012] (-1697.802) (-1694.457) * (-1700.844) (-1694.615) [-1697.988] (-1699.401) -- 0:02:53
      313000 -- (-1711.880) [-1693.053] (-1693.626) (-1697.557) * (-1698.980) (-1702.917) [-1694.916] (-1695.266) -- 0:02:53
      313500 -- (-1698.770) (-1693.200) (-1700.435) [-1696.596] * (-1696.818) (-1694.302) (-1698.727) [-1695.435] -- 0:02:52
      314000 -- (-1704.663) [-1692.474] (-1696.007) (-1694.114) * (-1698.719) [-1696.497] (-1699.855) (-1694.532) -- 0:02:54
      314500 -- (-1697.277) (-1698.323) [-1693.894] (-1697.263) * (-1703.861) (-1693.352) [-1690.789] (-1692.563) -- 0:02:54
      315000 -- (-1704.783) (-1690.154) (-1695.166) [-1694.225] * (-1695.879) (-1697.729) (-1697.432) [-1695.938] -- 0:02:53

      Average standard deviation of split frequencies: 0.007459

      315500 -- (-1700.231) (-1697.278) [-1692.852] (-1705.479) * (-1701.136) (-1692.660) [-1692.724] (-1695.602) -- 0:02:53
      316000 -- [-1692.837] (-1696.812) (-1691.004) (-1709.087) * (-1696.495) (-1696.571) (-1701.452) [-1694.107] -- 0:02:53
      316500 -- (-1696.162) (-1694.062) (-1693.199) [-1698.152] * (-1694.490) (-1696.916) (-1698.718) [-1696.477] -- 0:02:52
      317000 -- [-1699.885] (-1698.979) (-1694.123) (-1700.461) * [-1698.998] (-1692.275) (-1697.358) (-1698.951) -- 0:02:52
      317500 -- (-1698.563) (-1703.846) [-1694.883] (-1697.964) * (-1694.289) (-1696.612) (-1701.884) [-1693.713] -- 0:02:51
      318000 -- (-1702.353) (-1699.365) [-1695.451] (-1699.932) * (-1694.262) [-1699.477] (-1697.113) (-1695.487) -- 0:02:53
      318500 -- (-1696.946) (-1695.630) [-1696.017] (-1696.726) * [-1695.384] (-1696.622) (-1697.894) (-1691.454) -- 0:02:53
      319000 -- (-1693.928) [-1696.524] (-1695.383) (-1695.830) * (-1701.590) (-1694.232) [-1695.423] (-1695.924) -- 0:02:52
      319500 -- (-1705.354) [-1696.624] (-1697.539) (-1695.711) * (-1692.774) [-1698.339] (-1696.910) (-1696.285) -- 0:02:52
      320000 -- (-1698.107) [-1694.928] (-1701.085) (-1698.641) * (-1701.193) (-1700.506) [-1695.481] (-1696.964) -- 0:02:52

      Average standard deviation of split frequencies: 0.006983

      320500 -- (-1697.477) [-1692.473] (-1702.920) (-1698.106) * [-1697.813] (-1702.723) (-1695.430) (-1703.811) -- 0:02:51
      321000 -- [-1697.003] (-1702.609) (-1697.780) (-1698.730) * (-1698.491) [-1693.955] (-1696.479) (-1696.437) -- 0:02:51
      321500 -- [-1693.062] (-1705.161) (-1697.882) (-1696.433) * (-1694.815) [-1699.348] (-1694.841) (-1699.506) -- 0:02:50
      322000 -- (-1697.466) (-1694.316) [-1696.238] (-1698.682) * (-1697.382) (-1692.693) (-1702.308) [-1697.061] -- 0:02:52
      322500 -- [-1701.512] (-1695.158) (-1695.397) (-1702.912) * (-1693.861) [-1698.437] (-1699.849) (-1704.643) -- 0:02:52
      323000 -- (-1694.819) [-1695.870] (-1698.027) (-1695.819) * [-1694.041] (-1695.439) (-1699.134) (-1704.859) -- 0:02:51
      323500 -- (-1693.739) (-1697.032) [-1693.422] (-1705.899) * (-1698.171) (-1694.911) [-1690.760] (-1702.654) -- 0:02:51
      324000 -- (-1699.567) (-1691.285) [-1694.724] (-1697.279) * (-1695.586) [-1699.649] (-1699.733) (-1698.245) -- 0:02:51
      324500 -- (-1692.300) [-1689.081] (-1699.686) (-1701.265) * (-1704.728) [-1696.925] (-1694.917) (-1704.001) -- 0:02:50
      325000 -- (-1699.771) [-1693.019] (-1699.423) (-1701.996) * (-1696.486) [-1704.009] (-1697.821) (-1695.872) -- 0:02:50

      Average standard deviation of split frequencies: 0.007592

      325500 -- (-1698.096) (-1695.875) (-1701.986) [-1693.765] * [-1691.801] (-1698.658) (-1696.259) (-1700.432) -- 0:02:49
      326000 -- (-1695.667) [-1699.998] (-1698.416) (-1690.998) * (-1697.983) [-1695.883] (-1692.069) (-1695.285) -- 0:02:51
      326500 -- (-1702.338) (-1700.239) [-1698.706] (-1701.586) * (-1698.460) (-1693.662) [-1691.521] (-1706.278) -- 0:02:51
      327000 -- [-1692.096] (-1692.707) (-1696.576) (-1696.335) * [-1694.779] (-1694.664) (-1692.794) (-1696.058) -- 0:02:50
      327500 -- (-1695.806) [-1701.272] (-1698.618) (-1703.758) * (-1695.820) (-1701.503) [-1691.181] (-1697.031) -- 0:02:50
      328000 -- (-1699.137) (-1697.336) (-1699.055) [-1703.093] * (-1693.346) (-1698.035) [-1697.416] (-1703.756) -- 0:02:50
      328500 -- [-1698.243] (-1698.736) (-1700.486) (-1703.505) * (-1696.464) (-1692.126) [-1693.848] (-1695.513) -- 0:02:49
      329000 -- (-1697.419) (-1690.484) (-1698.291) [-1701.234] * (-1698.116) [-1698.048] (-1697.322) (-1698.669) -- 0:02:49
      329500 -- (-1692.298) (-1694.875) [-1696.942] (-1700.161) * [-1696.475] (-1698.555) (-1697.538) (-1695.375) -- 0:02:48
      330000 -- (-1692.135) (-1701.481) (-1699.455) [-1695.035] * (-1698.092) [-1693.118] (-1701.355) (-1692.585) -- 0:02:50

      Average standard deviation of split frequencies: 0.007484

      330500 -- (-1694.579) [-1695.037] (-1697.180) (-1697.844) * (-1699.588) [-1690.271] (-1696.513) (-1697.577) -- 0:02:50
      331000 -- (-1695.350) [-1693.979] (-1693.387) (-1701.862) * (-1695.732) (-1700.687) (-1697.567) [-1694.510] -- 0:02:49
      331500 -- (-1699.733) (-1691.565) [-1697.147] (-1700.656) * (-1699.935) (-1694.225) [-1693.134] (-1702.455) -- 0:02:49
      332000 -- [-1696.609] (-1698.036) (-1696.399) (-1692.801) * [-1699.551] (-1693.985) (-1700.736) (-1701.096) -- 0:02:49
      332500 -- (-1696.543) (-1699.334) [-1698.625] (-1696.041) * [-1698.758] (-1700.182) (-1698.716) (-1700.015) -- 0:02:48
      333000 -- [-1695.692] (-1703.297) (-1697.486) (-1690.802) * (-1699.875) (-1699.159) (-1700.470) [-1695.381] -- 0:02:48
      333500 -- [-1691.912] (-1696.584) (-1699.261) (-1699.775) * (-1694.325) (-1700.359) [-1692.098] (-1696.192) -- 0:02:47
      334000 -- (-1700.437) (-1699.403) [-1690.330] (-1701.864) * (-1701.450) (-1702.735) [-1691.128] (-1700.726) -- 0:02:49
      334500 -- (-1707.080) (-1700.031) [-1695.035] (-1705.601) * [-1695.560] (-1703.233) (-1692.951) (-1693.822) -- 0:02:49
      335000 -- (-1695.711) (-1697.096) [-1688.519] (-1695.099) * (-1694.957) (-1702.126) (-1695.056) [-1697.872] -- 0:02:48

      Average standard deviation of split frequencies: 0.007366

      335500 -- [-1700.690] (-1704.699) (-1705.100) (-1694.981) * [-1694.101] (-1696.191) (-1695.772) (-1699.274) -- 0:02:48
      336000 -- (-1692.824) [-1691.886] (-1701.617) (-1698.904) * (-1707.189) [-1700.473] (-1699.701) (-1700.023) -- 0:02:47
      336500 -- (-1693.327) (-1696.930) (-1696.740) [-1695.838] * (-1705.422) (-1698.552) (-1701.069) [-1699.796] -- 0:02:47
      337000 -- (-1696.879) (-1697.101) (-1700.627) [-1692.852] * [-1694.116] (-1695.320) (-1705.194) (-1695.758) -- 0:02:47
      337500 -- [-1697.108] (-1690.618) (-1699.066) (-1708.772) * [-1694.785] (-1699.966) (-1698.547) (-1694.141) -- 0:02:46
      338000 -- (-1692.155) (-1698.429) (-1692.838) [-1697.902] * (-1700.984) [-1694.082] (-1692.771) (-1695.856) -- 0:02:48
      338500 -- [-1699.214] (-1695.360) (-1702.205) (-1694.655) * (-1705.547) [-1695.900] (-1690.669) (-1709.593) -- 0:02:48
      339000 -- (-1701.660) (-1692.820) [-1692.064] (-1699.566) * (-1693.653) (-1694.277) (-1696.676) [-1695.939] -- 0:02:47
      339500 -- (-1694.896) (-1705.027) (-1697.147) [-1697.071] * (-1700.123) (-1694.736) [-1701.446] (-1696.618) -- 0:02:47
      340000 -- [-1691.784] (-1705.034) (-1697.789) (-1697.349) * [-1698.842] (-1700.098) (-1698.646) (-1695.234) -- 0:02:46

      Average standard deviation of split frequencies: 0.007957

      340500 -- [-1692.313] (-1695.376) (-1703.238) (-1691.529) * (-1698.287) (-1699.703) (-1692.613) [-1693.449] -- 0:02:46
      341000 -- [-1695.425] (-1699.129) (-1703.313) (-1695.615) * (-1700.714) (-1695.824) [-1697.523] (-1694.106) -- 0:02:46
      341500 -- (-1695.761) [-1692.529] (-1696.775) (-1695.094) * (-1704.374) (-1696.629) (-1692.626) [-1696.052] -- 0:02:45
      342000 -- (-1698.805) [-1695.257] (-1697.698) (-1699.949) * (-1696.359) (-1703.042) (-1696.420) [-1699.244] -- 0:02:47
      342500 -- (-1698.244) (-1700.906) (-1693.783) [-1698.108] * [-1695.742] (-1703.196) (-1702.076) (-1707.233) -- 0:02:47
      343000 -- [-1697.729] (-1697.740) (-1693.305) (-1693.717) * (-1698.674) [-1699.581] (-1700.834) (-1707.051) -- 0:02:46
      343500 -- (-1694.790) [-1697.533] (-1693.124) (-1695.192) * (-1701.234) (-1698.653) (-1692.453) [-1698.961] -- 0:02:46
      344000 -- (-1698.596) (-1707.376) (-1696.646) [-1699.665] * (-1698.024) [-1692.395] (-1694.670) (-1699.457) -- 0:02:45
      344500 -- [-1700.456] (-1699.608) (-1694.679) (-1695.263) * (-1697.115) (-1692.067) [-1694.954] (-1704.700) -- 0:02:45
      345000 -- (-1697.596) (-1695.607) (-1698.472) [-1694.896] * (-1706.512) (-1700.882) [-1696.671] (-1697.057) -- 0:02:45

      Average standard deviation of split frequencies: 0.007834

      345500 -- (-1696.061) [-1693.435] (-1697.119) (-1694.196) * (-1693.036) (-1690.111) [-1692.511] (-1694.145) -- 0:02:44
      346000 -- [-1695.884] (-1698.187) (-1701.931) (-1698.387) * (-1698.703) [-1693.117] (-1692.856) (-1698.738) -- 0:02:46
      346500 -- (-1702.309) (-1699.517) (-1704.614) [-1691.810] * [-1700.420] (-1698.288) (-1698.401) (-1696.610) -- 0:02:45
      347000 -- [-1694.712] (-1699.547) (-1693.338) (-1699.404) * [-1696.060] (-1702.777) (-1694.118) (-1700.389) -- 0:02:45
      347500 -- (-1699.438) (-1697.290) (-1695.986) [-1700.125] * (-1695.068) [-1695.533] (-1692.568) (-1695.888) -- 0:02:45
      348000 -- [-1697.824] (-1701.370) (-1699.832) (-1698.581) * (-1696.286) [-1696.708] (-1692.474) (-1698.666) -- 0:02:44
      348500 -- (-1697.515) (-1697.444) (-1692.960) [-1694.153] * (-1698.999) (-1693.828) [-1694.577] (-1704.569) -- 0:02:44
      349000 -- (-1693.407) (-1698.589) (-1696.207) [-1697.818] * (-1691.450) [-1697.731] (-1692.572) (-1700.492) -- 0:02:44
      349500 -- (-1698.584) [-1697.149] (-1701.815) (-1699.992) * (-1696.687) [-1698.580] (-1695.348) (-1696.342) -- 0:02:43
      350000 -- (-1695.271) (-1693.075) (-1696.365) [-1693.889] * (-1692.679) (-1696.178) (-1703.105) [-1698.640] -- 0:02:45

      Average standard deviation of split frequencies: 0.007058

      350500 -- (-1703.943) (-1693.599) [-1696.037] (-1693.941) * (-1694.189) (-1695.913) (-1703.963) [-1696.060] -- 0:02:44
      351000 -- [-1697.143] (-1695.638) (-1695.590) (-1696.420) * (-1692.584) [-1700.229] (-1700.607) (-1692.482) -- 0:02:44
      351500 -- (-1694.681) (-1696.732) (-1697.139) [-1699.294] * (-1695.886) (-1697.378) (-1691.352) [-1692.155] -- 0:02:44
      352000 -- [-1694.069] (-1695.674) (-1693.555) (-1700.254) * (-1702.480) (-1700.222) [-1693.141] (-1697.818) -- 0:02:43
      352500 -- [-1697.796] (-1697.244) (-1701.016) (-1711.204) * [-1692.294] (-1697.975) (-1692.047) (-1696.988) -- 0:02:43
      353000 -- (-1694.551) (-1694.212) [-1699.610] (-1702.691) * (-1706.528) (-1703.055) [-1690.073] (-1693.725) -- 0:02:43
      353500 -- [-1695.897] (-1703.773) (-1692.069) (-1703.516) * (-1694.372) (-1700.558) (-1691.369) [-1693.311] -- 0:02:44
      354000 -- (-1695.550) (-1702.363) [-1696.135] (-1702.824) * (-1702.337) (-1695.378) [-1706.478] (-1702.994) -- 0:02:44
      354500 -- (-1698.048) [-1701.027] (-1700.193) (-1698.720) * [-1693.951] (-1699.644) (-1697.940) (-1694.303) -- 0:02:43
      355000 -- (-1694.096) [-1695.436] (-1700.281) (-1703.443) * (-1694.317) (-1704.117) (-1692.991) [-1696.269] -- 0:02:43

      Average standard deviation of split frequencies: 0.007283

      355500 -- (-1705.869) (-1697.838) [-1691.969] (-1701.738) * (-1696.885) (-1700.189) (-1699.601) [-1695.496] -- 0:02:43
      356000 -- [-1700.649] (-1696.200) (-1695.969) (-1700.383) * (-1698.815) (-1701.509) [-1693.750] (-1696.503) -- 0:02:42
      356500 -- (-1702.771) [-1693.845] (-1695.435) (-1700.086) * [-1694.163] (-1700.759) (-1701.280) (-1696.356) -- 0:02:42
      357000 -- (-1701.660) [-1696.271] (-1698.170) (-1701.243) * (-1693.044) (-1699.957) [-1699.758] (-1696.012) -- 0:02:42
      357500 -- (-1696.620) (-1698.944) (-1694.819) [-1699.759] * (-1694.760) [-1696.871] (-1705.981) (-1700.012) -- 0:02:43
      358000 -- (-1700.579) (-1706.575) (-1692.363) [-1698.086] * [-1701.320] (-1692.586) (-1702.339) (-1696.881) -- 0:02:43
      358500 -- [-1695.433] (-1701.245) (-1689.634) (-1701.560) * [-1691.273] (-1696.618) (-1699.543) (-1692.980) -- 0:02:42
      359000 -- (-1701.760) (-1699.296) (-1694.196) [-1695.148] * (-1702.749) [-1695.089] (-1695.899) (-1697.741) -- 0:02:42
      359500 -- [-1695.832] (-1700.717) (-1696.502) (-1698.694) * [-1696.786] (-1702.620) (-1695.610) (-1695.835) -- 0:02:42
      360000 -- (-1697.462) [-1706.505] (-1692.196) (-1696.559) * [-1697.565] (-1697.584) (-1698.665) (-1702.884) -- 0:02:41

      Average standard deviation of split frequencies: 0.007189

      360500 -- (-1692.477) (-1702.793) [-1691.632] (-1702.538) * (-1704.078) (-1692.953) (-1697.266) [-1694.940] -- 0:02:41
      361000 -- [-1696.591] (-1698.930) (-1697.183) (-1695.214) * (-1701.164) [-1693.669] (-1697.012) (-1693.913) -- 0:02:41
      361500 -- (-1695.441) (-1692.797) [-1698.894] (-1698.582) * (-1693.095) (-1699.648) [-1693.440] (-1695.540) -- 0:02:42
      362000 -- (-1695.855) (-1692.004) (-1694.927) [-1700.191] * (-1696.995) (-1697.980) (-1692.580) [-1697.900] -- 0:02:42
      362500 -- (-1693.114) (-1697.713) (-1698.920) [-1697.273] * (-1698.527) (-1705.830) (-1695.109) [-1695.016] -- 0:02:41
      363000 -- [-1691.964] (-1705.335) (-1701.966) (-1699.350) * (-1702.055) (-1704.145) [-1699.770] (-1690.686) -- 0:02:41
      363500 -- [-1694.793] (-1696.734) (-1696.002) (-1696.654) * (-1708.227) (-1695.433) [-1692.893] (-1693.982) -- 0:02:41
      364000 -- (-1705.970) (-1695.094) [-1698.272] (-1695.336) * [-1694.391] (-1695.393) (-1698.657) (-1695.483) -- 0:02:40
      364500 -- (-1703.017) [-1695.910] (-1697.412) (-1696.480) * [-1694.579] (-1704.219) (-1694.062) (-1697.686) -- 0:02:40
      365000 -- (-1698.126) (-1697.071) [-1703.924] (-1695.259) * (-1697.638) (-1708.574) (-1702.127) [-1694.978] -- 0:02:40

      Average standard deviation of split frequencies: 0.007084

      365500 -- (-1699.858) (-1694.133) [-1694.871] (-1699.156) * [-1692.139] (-1701.653) (-1695.965) (-1701.269) -- 0:02:41
      366000 -- (-1697.781) (-1695.212) [-1700.282] (-1703.205) * [-1689.765] (-1697.431) (-1691.851) (-1694.087) -- 0:02:41
      366500 -- (-1697.767) (-1698.827) (-1704.147) [-1694.129] * (-1693.086) (-1697.256) (-1696.806) [-1695.552] -- 0:02:40
      367000 -- (-1696.652) (-1701.995) [-1699.631] (-1694.685) * (-1695.323) (-1697.043) (-1697.374) [-1695.492] -- 0:02:40
      367500 -- (-1699.512) (-1694.406) [-1695.834] (-1690.371) * [-1695.812] (-1696.387) (-1695.983) (-1702.930) -- 0:02:40
      368000 -- (-1694.860) (-1693.912) (-1698.200) [-1694.085] * [-1694.961] (-1695.955) (-1704.486) (-1697.144) -- 0:02:39
      368500 -- [-1696.142] (-1700.039) (-1701.005) (-1697.843) * (-1698.274) [-1693.191] (-1706.886) (-1701.096) -- 0:02:39
      369000 -- (-1703.650) (-1694.641) (-1701.414) [-1691.127] * (-1694.554) (-1697.386) [-1694.564] (-1700.891) -- 0:02:39
      369500 -- [-1697.939] (-1696.695) (-1705.172) (-1692.067) * (-1701.004) (-1695.252) (-1694.653) [-1695.186] -- 0:02:40
      370000 -- (-1695.396) (-1698.725) [-1698.321] (-1704.828) * (-1695.490) (-1694.900) [-1694.836] (-1702.299) -- 0:02:40

      Average standard deviation of split frequencies: 0.006677

      370500 -- (-1695.488) [-1700.761] (-1701.600) (-1693.113) * (-1701.535) [-1698.768] (-1692.808) (-1697.841) -- 0:02:39
      371000 -- [-1696.041] (-1694.405) (-1694.891) (-1703.346) * [-1693.617] (-1711.619) (-1695.901) (-1701.559) -- 0:02:39
      371500 -- (-1699.839) (-1701.679) [-1695.678] (-1700.426) * [-1695.845] (-1703.712) (-1702.211) (-1693.716) -- 0:02:39
      372000 -- [-1697.126] (-1700.826) (-1699.210) (-1703.251) * (-1703.215) [-1700.787] (-1697.964) (-1693.214) -- 0:02:38
      372500 -- (-1701.426) [-1694.850] (-1699.745) (-1694.295) * (-1695.517) (-1697.148) [-1697.018] (-1694.831) -- 0:02:38
      373000 -- (-1695.922) [-1697.020] (-1703.675) (-1697.451) * (-1695.073) (-1703.353) (-1700.568) [-1699.370] -- 0:02:38
      373500 -- (-1698.683) [-1698.038] (-1694.713) (-1697.716) * (-1707.601) (-1692.947) [-1692.930] (-1694.964) -- 0:02:39
      374000 -- (-1699.919) (-1695.925) [-1697.312] (-1693.587) * (-1699.400) [-1694.804] (-1692.227) (-1693.997) -- 0:02:39
      374500 -- (-1698.836) (-1689.092) (-1699.156) [-1699.834] * (-1700.626) (-1695.470) (-1700.536) [-1695.144] -- 0:02:38
      375000 -- (-1700.564) (-1696.361) (-1702.653) [-1699.611] * (-1695.563) [-1696.416] (-1695.207) (-1699.309) -- 0:02:38

      Average standard deviation of split frequencies: 0.006896

      375500 -- (-1701.142) [-1692.173] (-1694.733) (-1701.828) * (-1698.860) [-1691.336] (-1696.752) (-1696.247) -- 0:02:37
      376000 -- (-1701.381) (-1696.925) (-1698.574) [-1700.861] * (-1697.244) (-1694.105) [-1692.270] (-1693.061) -- 0:02:37
      376500 -- (-1701.808) [-1703.647] (-1692.813) (-1699.610) * (-1698.800) (-1700.970) (-1691.672) [-1695.821] -- 0:02:37
      377000 -- (-1699.846) (-1699.878) (-1695.887) [-1696.916] * (-1697.411) (-1696.749) [-1696.944] (-1693.059) -- 0:02:36
      377500 -- [-1698.724] (-1696.120) (-1696.857) (-1697.264) * (-1694.757) (-1698.436) [-1695.603] (-1696.662) -- 0:02:38
      378000 -- (-1701.619) (-1705.222) [-1697.460] (-1698.442) * (-1693.603) (-1691.694) (-1692.391) [-1697.097] -- 0:02:37
      378500 -- (-1698.330) (-1705.830) [-1698.253] (-1700.981) * (-1692.135) (-1697.750) [-1692.332] (-1699.595) -- 0:02:37
      379000 -- (-1693.184) [-1706.922] (-1702.108) (-1694.262) * [-1698.043] (-1703.697) (-1697.172) (-1697.599) -- 0:02:37
      379500 -- (-1701.343) (-1700.924) (-1702.992) [-1692.008] * (-1698.354) (-1699.759) (-1707.218) [-1690.739] -- 0:02:36
      380000 -- [-1699.487] (-1701.301) (-1700.417) (-1695.988) * (-1694.341) (-1701.042) (-1697.129) [-1692.917] -- 0:02:36

      Average standard deviation of split frequencies: 0.005882

      380500 -- (-1697.471) (-1697.498) (-1701.747) [-1697.638] * (-1692.407) (-1697.656) (-1692.201) [-1695.245] -- 0:02:36
      381000 -- [-1698.815] (-1694.137) (-1703.442) (-1697.935) * (-1695.456) [-1701.109] (-1696.029) (-1696.505) -- 0:02:35
      381500 -- (-1698.020) [-1698.407] (-1703.750) (-1702.367) * (-1694.015) (-1698.497) (-1701.716) [-1695.938] -- 0:02:37
      382000 -- [-1700.048] (-1699.421) (-1700.742) (-1702.895) * (-1693.448) [-1693.586] (-1695.829) (-1697.830) -- 0:02:36
      382500 -- [-1699.910] (-1698.319) (-1703.528) (-1697.713) * [-1700.311] (-1703.556) (-1705.060) (-1695.886) -- 0:02:36
      383000 -- (-1697.007) (-1697.221) (-1692.488) [-1699.869] * (-1695.312) (-1697.063) (-1694.822) [-1695.351] -- 0:02:36
      383500 -- (-1695.777) (-1695.589) [-1691.175] (-1699.945) * (-1700.671) (-1697.796) [-1698.660] (-1702.395) -- 0:02:35
      384000 -- (-1696.881) (-1696.273) [-1697.431] (-1700.893) * (-1700.303) (-1701.920) (-1690.930) [-1692.165] -- 0:02:35
      384500 -- (-1695.838) (-1700.479) (-1698.073) [-1696.876] * (-1693.547) (-1695.458) (-1694.212) [-1692.936] -- 0:02:35
      385000 -- [-1694.741] (-1693.776) (-1698.289) (-1694.692) * [-1701.599] (-1702.291) (-1694.145) (-1701.615) -- 0:02:34

      Average standard deviation of split frequencies: 0.005496

      385500 -- (-1699.771) [-1701.301] (-1700.740) (-1693.408) * (-1696.108) (-1695.362) (-1695.150) [-1691.661] -- 0:02:36
      386000 -- (-1695.621) (-1699.675) (-1699.952) [-1696.372] * (-1701.911) (-1698.571) [-1694.871] (-1695.086) -- 0:02:35
      386500 -- [-1690.306] (-1698.741) (-1701.900) (-1697.953) * (-1697.427) (-1708.305) (-1703.653) [-1696.095] -- 0:02:35
      387000 -- (-1694.440) [-1691.207] (-1698.726) (-1692.584) * [-1694.750] (-1706.836) (-1696.020) (-1693.591) -- 0:02:35
      387500 -- (-1703.990) (-1697.993) (-1694.958) [-1695.186] * [-1693.770] (-1698.043) (-1698.993) (-1695.435) -- 0:02:34
      388000 -- (-1704.510) (-1695.973) (-1700.002) [-1696.353] * (-1695.764) (-1699.725) [-1697.388] (-1699.210) -- 0:02:34
      388500 -- (-1696.390) [-1694.122] (-1696.336) (-1700.665) * (-1693.817) [-1693.903] (-1694.561) (-1700.820) -- 0:02:34
      389000 -- (-1694.323) (-1706.370) (-1700.458) [-1693.949] * (-1690.413) (-1696.728) (-1698.593) [-1696.139] -- 0:02:33
      389500 -- (-1697.758) (-1692.496) (-1700.965) [-1694.792] * [-1695.346] (-1693.330) (-1698.805) (-1694.614) -- 0:02:35
      390000 -- (-1699.329) (-1693.267) [-1693.341] (-1703.441) * (-1693.910) (-1696.875) (-1701.760) [-1700.536] -- 0:02:34

      Average standard deviation of split frequencies: 0.005430

      390500 -- (-1694.617) [-1698.354] (-1697.397) (-1701.954) * (-1699.601) [-1689.496] (-1696.177) (-1711.329) -- 0:02:34
      391000 -- [-1690.838] (-1706.726) (-1694.731) (-1696.511) * [-1696.243] (-1706.097) (-1701.309) (-1709.336) -- 0:02:34
      391500 -- [-1696.436] (-1700.623) (-1690.563) (-1692.513) * (-1697.908) [-1691.975] (-1698.126) (-1716.136) -- 0:02:33
      392000 -- [-1693.158] (-1695.387) (-1691.232) (-1694.650) * (-1702.851) (-1697.782) [-1701.053] (-1699.185) -- 0:02:33
      392500 -- (-1696.180) (-1698.888) (-1698.426) [-1695.626] * (-1696.181) [-1695.467] (-1699.618) (-1696.691) -- 0:02:33
      393000 -- [-1694.533] (-1693.953) (-1700.058) (-1697.331) * (-1689.464) [-1699.585] (-1699.655) (-1696.357) -- 0:02:32
      393500 -- [-1692.111] (-1696.070) (-1697.404) (-1701.044) * (-1694.306) (-1699.745) [-1701.597] (-1704.748) -- 0:02:34
      394000 -- (-1693.997) (-1695.175) (-1692.236) [-1694.068] * (-1697.546) [-1692.644] (-1700.043) (-1699.404) -- 0:02:33
      394500 -- (-1697.121) [-1697.254] (-1697.246) (-1700.163) * (-1694.819) [-1703.432] (-1700.371) (-1697.137) -- 0:02:33
      395000 -- (-1701.228) (-1696.251) [-1694.488] (-1697.927) * (-1697.240) [-1700.469] (-1700.468) (-1700.517) -- 0:02:33

      Average standard deviation of split frequencies: 0.005654

      395500 -- [-1702.307] (-1691.981) (-1693.261) (-1700.988) * [-1700.807] (-1702.731) (-1695.361) (-1697.061) -- 0:02:32
      396000 -- (-1705.659) (-1696.444) (-1700.480) [-1693.929] * (-1700.955) [-1699.144] (-1698.421) (-1699.234) -- 0:02:32
      396500 -- (-1707.144) (-1699.825) (-1693.888) [-1693.357] * (-1699.763) (-1700.930) (-1699.108) [-1694.046] -- 0:02:32
      397000 -- (-1708.484) (-1696.966) [-1692.248] (-1696.181) * (-1697.921) [-1697.571] (-1693.104) (-1695.451) -- 0:02:31
      397500 -- (-1697.965) (-1697.453) (-1699.987) [-1692.748] * [-1696.249] (-1695.245) (-1704.402) (-1708.239) -- 0:02:33
      398000 -- (-1697.138) (-1692.479) [-1694.248] (-1693.115) * (-1700.985) (-1697.919) [-1690.358] (-1699.512) -- 0:02:32
      398500 -- (-1695.414) (-1692.166) (-1700.255) [-1699.691] * (-1701.289) (-1694.905) [-1691.619] (-1704.070) -- 0:02:32
      399000 -- (-1694.558) (-1706.132) (-1695.004) [-1694.853] * [-1700.057] (-1694.825) (-1692.680) (-1696.263) -- 0:02:32
      399500 -- [-1689.711] (-1696.378) (-1698.407) (-1692.725) * (-1697.739) (-1698.447) (-1695.869) [-1694.901] -- 0:02:31
      400000 -- (-1699.150) (-1695.008) (-1692.590) [-1698.886] * (-1697.340) (-1697.089) [-1697.585] (-1695.302) -- 0:02:31

      Average standard deviation of split frequencies: 0.005294

      400500 -- (-1699.190) (-1693.647) (-1697.612) [-1694.559] * [-1691.007] (-1698.310) (-1698.536) (-1696.359) -- 0:02:31
      401000 -- (-1699.020) (-1695.383) [-1698.500] (-1693.142) * (-1701.480) (-1699.258) [-1693.549] (-1694.777) -- 0:02:30
      401500 -- (-1701.813) (-1694.150) (-1696.200) [-1695.753] * (-1695.931) [-1695.157] (-1705.481) (-1691.337) -- 0:02:32
      402000 -- (-1694.241) (-1692.551) [-1697.698] (-1689.402) * (-1696.667) [-1699.760] (-1702.050) (-1697.771) -- 0:02:31
      402500 -- (-1692.429) (-1689.274) [-1701.733] (-1696.896) * (-1697.442) (-1697.937) (-1698.117) [-1700.065] -- 0:02:31
      403000 -- [-1697.093] (-1701.673) (-1700.650) (-1694.025) * (-1699.915) [-1697.552] (-1697.223) (-1694.407) -- 0:02:31
      403500 -- (-1694.597) [-1693.672] (-1695.812) (-1696.850) * (-1703.786) [-1695.344] (-1697.370) (-1691.756) -- 0:02:30
      404000 -- (-1696.600) (-1699.399) (-1702.857) [-1698.960] * (-1699.856) [-1704.826] (-1697.731) (-1695.542) -- 0:02:30
      404500 -- (-1697.726) (-1698.760) [-1692.981] (-1693.787) * [-1699.514] (-1698.400) (-1700.023) (-1697.951) -- 0:02:30
      405000 -- [-1697.410] (-1703.124) (-1694.701) (-1705.611) * (-1704.135) (-1701.842) [-1694.073] (-1692.093) -- 0:02:29

      Average standard deviation of split frequencies: 0.004354

      405500 -- [-1699.237] (-1701.579) (-1696.951) (-1698.426) * (-1697.649) (-1697.492) (-1698.738) [-1692.313] -- 0:02:31
      406000 -- [-1693.954] (-1696.421) (-1696.750) (-1694.511) * (-1704.136) [-1697.355] (-1694.272) (-1696.151) -- 0:02:30
      406500 -- (-1694.850) [-1696.907] (-1697.770) (-1693.940) * (-1700.302) (-1701.113) [-1696.674] (-1695.563) -- 0:02:30
      407000 -- (-1697.619) [-1691.695] (-1696.572) (-1702.150) * (-1695.250) (-1696.489) [-1698.031] (-1694.650) -- 0:02:30
      407500 -- (-1696.596) [-1691.348] (-1696.437) (-1696.111) * (-1696.884) [-1696.083] (-1698.488) (-1698.502) -- 0:02:29
      408000 -- (-1698.978) [-1694.940] (-1693.920) (-1694.440) * (-1700.051) (-1694.295) (-1704.399) [-1701.874] -- 0:02:29
      408500 -- [-1697.656] (-1698.881) (-1696.849) (-1693.285) * (-1700.183) [-1690.307] (-1693.955) (-1699.351) -- 0:02:29
      409000 -- (-1694.531) (-1699.471) (-1699.515) [-1691.704] * [-1693.683] (-1689.943) (-1695.325) (-1695.504) -- 0:02:28
      409500 -- [-1696.459] (-1698.754) (-1714.431) (-1697.121) * [-1696.344] (-1699.667) (-1693.884) (-1694.423) -- 0:02:29
      410000 -- (-1697.896) (-1699.870) (-1710.499) [-1700.953] * (-1697.498) [-1690.368] (-1695.621) (-1694.541) -- 0:02:29

      Average standard deviation of split frequencies: 0.004018

      410500 -- (-1692.071) (-1699.274) (-1700.605) [-1698.325] * (-1698.094) (-1695.379) (-1694.421) [-1693.919] -- 0:02:29
      411000 -- (-1695.674) [-1692.731] (-1701.527) (-1697.351) * (-1702.871) (-1696.320) [-1693.656] (-1699.537) -- 0:02:29
      411500 -- (-1692.038) [-1698.510] (-1696.840) (-1699.799) * (-1694.858) (-1698.568) [-1698.475] (-1699.237) -- 0:02:28
      412000 -- (-1699.000) [-1693.945] (-1703.220) (-1700.231) * [-1695.269] (-1697.768) (-1706.472) (-1691.737) -- 0:02:28
      412500 -- (-1696.463) (-1696.162) (-1701.854) [-1697.587] * (-1698.966) (-1696.766) (-1705.924) [-1690.532] -- 0:02:28
      413000 -- [-1694.302] (-1698.808) (-1698.327) (-1702.898) * (-1700.883) (-1693.308) [-1699.573] (-1693.869) -- 0:02:27
      413500 -- (-1694.792) [-1699.335] (-1699.948) (-1701.036) * (-1700.776) [-1695.183] (-1702.250) (-1698.221) -- 0:02:28
      414000 -- [-1701.433] (-1695.126) (-1697.536) (-1697.582) * (-1695.952) (-1694.526) (-1691.694) [-1693.311] -- 0:02:28
      414500 -- (-1701.849) (-1703.047) (-1696.523) [-1690.100] * (-1703.024) [-1696.765] (-1696.580) (-1697.831) -- 0:02:28
      415000 -- (-1698.762) [-1690.936] (-1703.550) (-1697.883) * (-1707.168) (-1691.621) (-1700.689) [-1694.223] -- 0:02:28

      Average standard deviation of split frequencies: 0.004249

      415500 -- [-1696.111] (-1692.558) (-1694.491) (-1700.137) * (-1704.118) (-1694.781) [-1692.875] (-1693.782) -- 0:02:27
      416000 -- (-1701.204) [-1696.720] (-1695.975) (-1702.167) * (-1703.162) (-1692.633) (-1701.037) [-1694.582] -- 0:02:27
      416500 -- (-1698.895) (-1698.997) (-1699.135) [-1694.381] * [-1699.590] (-1701.207) (-1702.022) (-1701.866) -- 0:02:27
      417000 -- [-1693.695] (-1697.572) (-1709.023) (-1697.485) * [-1695.087] (-1699.097) (-1698.483) (-1694.099) -- 0:02:28
      417500 -- [-1698.687] (-1696.351) (-1693.001) (-1696.264) * [-1696.693] (-1694.867) (-1703.202) (-1696.632) -- 0:02:27
      418000 -- (-1696.373) [-1699.759] (-1699.319) (-1707.804) * (-1698.113) (-1697.974) [-1695.806] (-1694.818) -- 0:02:27
      418500 -- (-1695.664) [-1695.695] (-1696.564) (-1693.733) * (-1696.537) (-1695.505) (-1702.459) [-1703.285] -- 0:02:27
      419000 -- (-1699.745) (-1703.802) (-1692.622) [-1691.370] * (-1695.627) (-1701.769) (-1704.342) [-1693.060] -- 0:02:26
      419500 -- [-1696.811] (-1696.154) (-1699.605) (-1699.779) * (-1705.528) [-1693.390] (-1699.777) (-1696.561) -- 0:02:26
      420000 -- (-1691.218) [-1697.197] (-1698.348) (-1696.813) * [-1696.693] (-1707.061) (-1694.115) (-1702.976) -- 0:02:26

      Average standard deviation of split frequencies: 0.006163

      420500 -- [-1691.874] (-1706.866) (-1699.683) (-1694.508) * (-1694.277) (-1698.308) (-1692.948) [-1702.230] -- 0:02:26
      421000 -- (-1700.267) [-1694.527] (-1699.180) (-1694.011) * (-1701.346) [-1697.694] (-1695.517) (-1701.902) -- 0:02:27
      421500 -- [-1694.781] (-1698.782) (-1694.742) (-1694.010) * (-1700.639) (-1695.225) [-1690.335] (-1696.149) -- 0:02:26
      422000 -- [-1696.076] (-1703.145) (-1693.358) (-1696.746) * (-1699.270) (-1697.598) (-1692.547) [-1694.882] -- 0:02:26
      422500 -- (-1699.133) (-1705.060) (-1694.175) [-1694.921] * [-1698.252] (-1697.270) (-1696.469) (-1697.404) -- 0:02:26
      423000 -- (-1699.477) [-1704.695] (-1701.163) (-1697.090) * (-1699.816) (-1697.709) (-1705.371) [-1690.863] -- 0:02:25
      423500 -- (-1703.161) (-1703.573) [-1690.800] (-1695.216) * (-1700.495) (-1693.731) (-1697.799) [-1693.678] -- 0:02:25
      424000 -- (-1704.682) (-1701.675) [-1695.100] (-1700.430) * (-1697.729) (-1697.388) (-1695.112) [-1693.284] -- 0:02:25
      424500 -- (-1707.822) [-1699.324] (-1693.316) (-1695.938) * (-1703.395) (-1699.030) [-1693.869] (-1695.579) -- 0:02:25
      425000 -- (-1704.212) (-1711.696) [-1695.633] (-1698.321) * (-1696.446) (-1700.035) [-1691.969] (-1698.108) -- 0:02:26

      Average standard deviation of split frequencies: 0.006363

      425500 -- (-1699.466) (-1697.478) (-1697.490) [-1694.331] * (-1696.814) [-1695.422] (-1691.601) (-1694.097) -- 0:02:25
      426000 -- (-1697.016) [-1696.358] (-1694.110) (-1702.214) * (-1700.493) (-1693.563) (-1701.523) [-1699.027] -- 0:02:25
      426500 -- (-1695.607) (-1700.193) (-1705.463) [-1698.843] * (-1708.232) [-1691.041] (-1704.409) (-1700.568) -- 0:02:25
      427000 -- (-1699.420) (-1697.576) [-1699.550] (-1699.415) * (-1697.911) (-1697.282) [-1696.486] (-1693.778) -- 0:02:24
      427500 -- (-1700.596) (-1693.261) (-1708.647) [-1698.592] * [-1697.172] (-1695.613) (-1697.745) (-1691.497) -- 0:02:24
      428000 -- (-1700.265) (-1696.524) (-1700.380) [-1696.301] * (-1697.703) [-1698.286] (-1699.735) (-1693.488) -- 0:02:24
      428500 -- (-1699.000) (-1703.163) (-1694.646) [-1699.553] * (-1702.089) (-1695.214) [-1692.695] (-1696.311) -- 0:02:24
      429000 -- (-1695.631) [-1697.317] (-1696.886) (-1698.695) * (-1693.809) [-1699.264] (-1699.412) (-1702.542) -- 0:02:25
      429500 -- [-1696.433] (-1696.837) (-1696.767) (-1697.963) * (-1694.556) (-1696.383) [-1696.162] (-1699.284) -- 0:02:24
      430000 -- (-1697.765) (-1695.589) (-1696.673) [-1693.376] * [-1694.816] (-1698.243) (-1696.232) (-1713.638) -- 0:02:24

      Average standard deviation of split frequencies: 0.005747

      430500 -- (-1698.903) (-1701.281) (-1693.387) [-1701.535] * (-1697.986) [-1703.923] (-1693.153) (-1701.555) -- 0:02:24
      431000 -- [-1694.007] (-1695.972) (-1701.665) (-1707.500) * (-1695.132) (-1694.562) [-1693.058] (-1694.647) -- 0:02:23
      431500 -- (-1701.523) (-1703.037) [-1696.591] (-1705.443) * (-1697.807) [-1696.821] (-1691.001) (-1697.853) -- 0:02:23
      432000 -- (-1696.608) [-1696.641] (-1692.220) (-1692.310) * (-1704.464) [-1695.783] (-1694.430) (-1692.565) -- 0:02:23
      432500 -- [-1693.059] (-1699.589) (-1694.479) (-1707.208) * (-1697.847) [-1701.086] (-1691.735) (-1698.962) -- 0:02:23
      433000 -- [-1695.381] (-1694.163) (-1699.605) (-1699.825) * (-1694.366) (-1699.606) (-1694.927) [-1697.311] -- 0:02:24
      433500 -- (-1696.602) (-1702.686) [-1697.486] (-1695.905) * [-1698.988] (-1695.443) (-1702.877) (-1693.331) -- 0:02:23
      434000 -- (-1698.440) (-1703.752) [-1703.038] (-1695.083) * (-1696.184) [-1695.434] (-1705.639) (-1700.272) -- 0:02:23
      434500 -- (-1696.038) [-1702.285] (-1702.556) (-1701.646) * (-1700.545) [-1693.513] (-1703.313) (-1695.646) -- 0:02:23
      435000 -- (-1693.018) (-1696.661) [-1699.426] (-1695.658) * (-1699.914) (-1692.584) (-1697.518) [-1694.526] -- 0:02:22

      Average standard deviation of split frequencies: 0.005406

      435500 -- (-1692.089) [-1695.424] (-1696.976) (-1698.434) * (-1699.763) (-1691.031) [-1701.244] (-1703.514) -- 0:02:22
      436000 -- (-1696.107) [-1693.756] (-1692.540) (-1695.517) * (-1697.924) (-1693.699) (-1696.276) [-1697.033] -- 0:02:22
      436500 -- (-1700.671) (-1698.829) (-1695.742) [-1698.395] * (-1704.017) (-1698.410) (-1694.411) [-1696.458] -- 0:02:22
      437000 -- [-1697.038] (-1701.915) (-1697.836) (-1697.844) * (-1700.131) (-1692.303) [-1695.040] (-1694.349) -- 0:02:23
      437500 -- (-1706.958) (-1704.078) [-1691.866] (-1698.722) * (-1695.802) (-1693.556) (-1698.616) [-1693.437] -- 0:02:22
      438000 -- [-1695.559] (-1704.621) (-1693.753) (-1703.434) * (-1695.774) (-1697.541) [-1694.599] (-1693.044) -- 0:02:22
      438500 -- (-1698.029) (-1698.081) [-1695.480] (-1696.181) * (-1696.134) [-1697.177] (-1694.366) (-1704.391) -- 0:02:22
      439000 -- [-1695.684] (-1693.675) (-1702.355) (-1692.558) * (-1696.908) (-1696.830) [-1698.487] (-1693.786) -- 0:02:21
      439500 -- (-1694.458) (-1699.429) (-1695.772) [-1695.761] * (-1699.464) (-1694.808) (-1696.110) [-1693.822] -- 0:02:21
      440000 -- (-1703.186) (-1700.455) (-1693.999) [-1695.043] * (-1703.809) (-1694.998) [-1697.700] (-1700.722) -- 0:02:21

      Average standard deviation of split frequencies: 0.007221

      440500 -- (-1693.161) (-1699.231) [-1695.583] (-1691.685) * (-1695.875) (-1698.469) [-1695.229] (-1699.987) -- 0:02:20
      441000 -- (-1692.943) [-1694.745] (-1696.774) (-1694.638) * [-1696.692] (-1697.634) (-1701.310) (-1691.048) -- 0:02:21
      441500 -- (-1699.818) [-1693.218] (-1694.774) (-1691.805) * [-1699.470] (-1693.989) (-1695.022) (-1695.529) -- 0:02:21
      442000 -- (-1698.691) (-1702.488) [-1691.007] (-1700.365) * (-1698.136) (-1693.646) (-1698.441) [-1693.512] -- 0:02:21
      442500 -- (-1705.593) [-1691.093] (-1698.613) (-1699.429) * [-1698.174] (-1697.147) (-1694.468) (-1693.249) -- 0:02:21
      443000 -- (-1701.310) (-1699.182) (-1706.525) [-1700.835] * (-1699.498) (-1693.812) (-1693.902) [-1700.229] -- 0:02:20
      443500 -- [-1694.945] (-1700.799) (-1701.486) (-1700.637) * (-1701.355) (-1694.745) (-1694.833) [-1698.338] -- 0:02:20
      444000 -- (-1700.967) (-1697.172) (-1703.831) [-1696.494] * (-1693.934) (-1697.359) [-1694.510] (-1699.661) -- 0:02:20
      444500 -- [-1700.218] (-1690.819) (-1704.648) (-1697.829) * (-1700.054) (-1699.532) [-1696.100] (-1694.777) -- 0:02:19
      445000 -- (-1701.214) (-1693.262) (-1699.370) [-1693.106] * (-1700.986) (-1699.765) [-1697.908] (-1694.968) -- 0:02:20

      Average standard deviation of split frequencies: 0.007399

      445500 -- (-1698.277) (-1695.704) [-1698.902] (-1694.592) * [-1696.596] (-1696.514) (-1695.005) (-1704.976) -- 0:02:20
      446000 -- (-1692.625) (-1698.039) (-1712.139) [-1695.391] * (-1697.525) (-1699.469) [-1696.782] (-1700.567) -- 0:02:20
      446500 -- (-1697.754) [-1691.570] (-1693.270) (-1703.125) * (-1697.852) (-1700.212) (-1703.770) [-1693.464] -- 0:02:20
      447000 -- [-1700.857] (-1699.338) (-1698.666) (-1695.808) * (-1698.370) (-1699.313) (-1692.131) [-1694.455] -- 0:02:19
      447500 -- (-1693.343) [-1698.937] (-1697.455) (-1702.734) * (-1694.257) (-1702.842) [-1696.831] (-1693.936) -- 0:02:19
      448000 -- (-1695.888) (-1694.890) [-1694.135] (-1694.403) * [-1698.193] (-1706.517) (-1704.064) (-1695.107) -- 0:02:19
      448500 -- (-1692.721) (-1705.716) (-1699.019) [-1702.514] * (-1694.152) (-1695.199) (-1699.300) [-1691.628] -- 0:02:18
      449000 -- [-1692.060] (-1693.035) (-1697.083) (-1704.697) * (-1696.785) [-1699.329] (-1697.038) (-1695.718) -- 0:02:19
      449500 -- (-1697.967) (-1698.245) [-1694.388] (-1697.039) * [-1694.947] (-1701.894) (-1693.169) (-1695.570) -- 0:02:19
      450000 -- [-1700.148] (-1698.243) (-1699.200) (-1696.043) * (-1699.797) (-1696.382) [-1694.212] (-1701.308) -- 0:02:19

      Average standard deviation of split frequencies: 0.008630

      450500 -- [-1701.569] (-1694.438) (-1697.709) (-1699.265) * [-1695.741] (-1698.820) (-1699.961) (-1694.510) -- 0:02:19
      451000 -- (-1699.541) [-1695.657] (-1699.765) (-1697.335) * (-1695.653) (-1704.789) [-1697.209] (-1694.313) -- 0:02:18
      451500 -- (-1699.913) (-1700.679) [-1697.364] (-1700.983) * (-1695.602) (-1695.153) [-1692.267] (-1697.089) -- 0:02:18
      452000 -- (-1700.354) (-1702.145) (-1697.124) [-1693.115] * [-1693.126] (-1693.975) (-1698.390) (-1701.880) -- 0:02:18
      452500 -- (-1692.766) (-1695.836) (-1707.801) [-1693.747] * (-1691.293) [-1693.044] (-1697.721) (-1701.775) -- 0:02:19
      453000 -- (-1703.042) (-1697.833) (-1691.530) [-1691.024] * (-1694.433) [-1695.253] (-1693.986) (-1697.518) -- 0:02:18
      453500 -- (-1694.809) [-1696.053] (-1700.577) (-1697.686) * (-1694.658) (-1701.671) [-1693.849] (-1704.123) -- 0:02:18
      454000 -- (-1698.617) (-1695.919) [-1697.925] (-1695.078) * [-1697.375] (-1704.652) (-1694.709) (-1700.255) -- 0:02:18
      454500 -- (-1701.549) (-1696.423) (-1693.952) [-1694.768] * [-1696.064] (-1699.539) (-1699.012) (-1699.572) -- 0:02:18
      455000 -- [-1693.001] (-1697.837) (-1695.215) (-1693.306) * (-1704.595) (-1693.970) [-1696.426] (-1696.365) -- 0:02:17

      Average standard deviation of split frequencies: 0.010596

      455500 -- [-1692.527] (-1699.586) (-1697.314) (-1703.402) * (-1691.453) [-1694.314] (-1699.668) (-1700.870) -- 0:02:17
      456000 -- [-1696.439] (-1700.268) (-1693.481) (-1697.100) * [-1703.394] (-1700.684) (-1691.466) (-1699.021) -- 0:02:17
      456500 -- (-1694.700) (-1694.260) [-1695.131] (-1694.198) * (-1697.405) [-1699.680] (-1696.361) (-1697.870) -- 0:02:18
      457000 -- (-1697.734) (-1703.140) (-1697.652) [-1699.877] * (-1691.878) [-1694.619] (-1691.086) (-1698.673) -- 0:02:17
      457500 -- (-1692.672) [-1695.235] (-1693.124) (-1700.320) * [-1696.313] (-1699.425) (-1695.633) (-1694.527) -- 0:02:17
      458000 -- (-1697.831) (-1700.077) (-1690.456) [-1691.911] * (-1695.958) [-1697.961] (-1696.342) (-1696.689) -- 0:02:17
      458500 -- (-1694.842) (-1703.964) [-1697.957] (-1696.013) * [-1705.038] (-1698.588) (-1702.878) (-1703.569) -- 0:02:16
      459000 -- (-1695.833) (-1700.422) [-1695.617] (-1700.879) * (-1705.519) (-1693.983) (-1696.071) [-1697.624] -- 0:02:16
      459500 -- (-1695.809) [-1692.352] (-1698.415) (-1687.818) * (-1696.196) [-1690.291] (-1695.335) (-1703.311) -- 0:02:16
      460000 -- (-1702.183) (-1701.241) [-1698.732] (-1701.371) * [-1695.707] (-1698.309) (-1698.266) (-1702.188) -- 0:02:16

      Average standard deviation of split frequencies: 0.010489

      460500 -- (-1695.044) [-1695.699] (-1695.775) (-1692.388) * (-1694.838) [-1698.330] (-1699.999) (-1708.708) -- 0:02:17
      461000 -- (-1698.906) [-1703.071] (-1699.311) (-1690.502) * (-1692.154) (-1698.142) [-1699.931] (-1707.675) -- 0:02:16
      461500 -- (-1701.013) (-1701.032) [-1694.505] (-1689.927) * [-1697.560] (-1699.203) (-1698.166) (-1695.350) -- 0:02:16
      462000 -- (-1696.739) (-1696.405) [-1693.774] (-1705.596) * (-1700.046) (-1701.489) [-1702.821] (-1698.442) -- 0:02:16
      462500 -- (-1695.376) (-1698.022) [-1691.967] (-1700.712) * (-1692.951) (-1700.367) [-1696.210] (-1697.636) -- 0:02:15
      463000 -- (-1691.375) [-1696.127] (-1694.008) (-1702.130) * (-1694.393) [-1698.392] (-1693.671) (-1701.331) -- 0:02:15
      463500 -- (-1694.930) (-1694.927) (-1693.710) [-1699.029] * (-1696.773) [-1699.117] (-1695.238) (-1700.656) -- 0:02:15
      464000 -- (-1696.475) [-1695.035] (-1698.347) (-1694.802) * [-1696.138] (-1702.015) (-1698.469) (-1701.764) -- 0:02:15
      464500 -- (-1704.855) (-1695.984) (-1696.364) [-1693.178] * [-1704.560] (-1696.675) (-1700.181) (-1694.300) -- 0:02:16
      465000 -- (-1707.128) [-1696.757] (-1689.710) (-1692.342) * (-1705.504) (-1695.703) (-1696.045) [-1690.730] -- 0:02:15

      Average standard deviation of split frequencies: 0.011380

      465500 -- [-1697.148] (-1701.482) (-1697.293) (-1693.637) * (-1703.393) (-1694.577) (-1696.738) [-1693.524] -- 0:02:15
      466000 -- (-1699.202) (-1696.043) [-1696.397] (-1692.956) * [-1698.703] (-1695.931) (-1697.757) (-1699.899) -- 0:02:15
      466500 -- [-1695.967] (-1696.432) (-1695.583) (-1691.111) * [-1695.443] (-1695.520) (-1699.728) (-1696.613) -- 0:02:14
      467000 -- (-1694.195) [-1697.629] (-1702.023) (-1692.631) * (-1705.950) (-1699.914) [-1694.599] (-1692.647) -- 0:02:14
      467500 -- [-1701.833] (-1701.276) (-1708.406) (-1701.056) * [-1691.848] (-1706.311) (-1697.941) (-1692.526) -- 0:02:14
      468000 -- [-1702.025] (-1697.001) (-1702.822) (-1698.799) * (-1698.139) (-1699.688) (-1695.800) [-1701.328] -- 0:02:14
      468500 -- (-1698.697) (-1708.770) (-1703.641) [-1695.803] * [-1700.584] (-1697.126) (-1696.667) (-1696.057) -- 0:02:15
      469000 -- [-1697.569] (-1701.376) (-1698.337) (-1693.166) * [-1692.995] (-1696.489) (-1695.992) (-1700.541) -- 0:02:14
      469500 -- (-1700.665) (-1700.104) [-1695.770] (-1694.954) * (-1695.632) [-1692.518] (-1698.987) (-1691.148) -- 0:02:14
      470000 -- [-1703.706] (-1695.405) (-1704.994) (-1696.158) * (-1696.558) (-1696.570) (-1704.105) [-1692.953] -- 0:02:14

      Average standard deviation of split frequencies: 0.012770

      470500 -- (-1704.246) (-1698.987) [-1692.042] (-1695.555) * (-1699.408) (-1695.800) [-1693.738] (-1693.620) -- 0:02:13
      471000 -- (-1696.279) [-1697.922] (-1702.016) (-1693.668) * [-1692.620] (-1707.025) (-1700.263) (-1696.087) -- 0:02:13
      471500 -- (-1690.975) (-1696.312) [-1693.255] (-1700.001) * [-1695.602] (-1696.998) (-1697.394) (-1698.070) -- 0:02:13
      472000 -- (-1694.119) (-1700.967) [-1693.169] (-1699.266) * (-1695.490) (-1699.495) (-1694.334) [-1693.957] -- 0:02:13
      472500 -- (-1691.041) (-1699.865) (-1695.519) [-1692.784] * (-1698.315) (-1696.157) [-1704.196] (-1701.288) -- 0:02:13
      473000 -- (-1703.926) [-1697.117] (-1700.175) (-1694.190) * (-1691.281) (-1700.164) (-1697.785) [-1695.669] -- 0:02:13
      473500 -- (-1691.154) (-1699.661) (-1697.876) [-1700.370] * (-1699.219) [-1698.389] (-1701.065) (-1693.483) -- 0:02:13
      474000 -- (-1702.889) (-1699.273) (-1692.451) [-1691.375] * (-1694.316) (-1698.883) (-1698.723) [-1694.894] -- 0:02:13
      474500 -- (-1702.337) (-1697.687) [-1694.074] (-1702.086) * [-1691.823] (-1698.221) (-1701.327) (-1701.029) -- 0:02:12
      475000 -- (-1702.890) (-1697.569) [-1692.633] (-1700.697) * (-1691.082) (-1701.012) (-1697.689) [-1693.218] -- 0:02:12

      Average standard deviation of split frequencies: 0.011389

      475500 -- [-1693.938] (-1699.643) (-1692.441) (-1698.224) * (-1695.736) [-1695.504] (-1694.876) (-1703.389) -- 0:02:12
      476000 -- (-1691.226) (-1706.136) (-1701.562) [-1699.333] * (-1694.851) [-1694.868] (-1707.218) (-1695.043) -- 0:02:12
      476500 -- [-1694.346] (-1699.183) (-1699.421) (-1699.542) * [-1693.499] (-1697.289) (-1693.460) (-1691.477) -- 0:02:12
      477000 -- (-1698.131) (-1694.524) [-1692.433] (-1702.688) * (-1704.282) [-1692.069] (-1700.514) (-1699.594) -- 0:02:12
      477500 -- (-1692.927) [-1705.601] (-1692.831) (-1706.454) * (-1698.703) (-1701.291) (-1700.155) [-1702.550] -- 0:02:12
      478000 -- (-1696.623) [-1697.126] (-1690.751) (-1708.260) * (-1698.895) (-1698.632) [-1693.969] (-1696.322) -- 0:02:12
      478500 -- (-1700.443) [-1695.361] (-1693.741) (-1702.744) * (-1699.993) (-1696.390) (-1711.871) [-1693.648] -- 0:02:11
      479000 -- (-1699.621) (-1696.602) [-1697.808] (-1695.450) * [-1695.815] (-1697.358) (-1699.804) (-1699.099) -- 0:02:11
      479500 -- [-1695.375] (-1702.476) (-1693.119) (-1694.728) * (-1701.329) [-1694.875] (-1706.610) (-1692.508) -- 0:02:11
      480000 -- (-1695.698) (-1704.937) (-1698.717) [-1691.800] * (-1693.258) (-1701.311) (-1696.745) [-1691.256] -- 0:02:11

      Average standard deviation of split frequencies: 0.012014

      480500 -- (-1697.268) (-1697.875) [-1689.864] (-1697.183) * (-1696.996) (-1702.056) (-1697.718) [-1693.692] -- 0:02:11
      481000 -- [-1696.873] (-1699.280) (-1690.899) (-1697.306) * (-1703.243) [-1697.420] (-1696.447) (-1699.495) -- 0:02:11
      481500 -- (-1693.686) (-1696.176) (-1696.148) [-1697.640] * (-1704.762) (-1704.775) (-1698.587) [-1698.402] -- 0:02:11
      482000 -- (-1706.349) (-1697.344) (-1701.249) [-1696.423] * [-1694.536] (-1699.740) (-1698.404) (-1698.309) -- 0:02:11
      482500 -- (-1694.716) [-1698.968] (-1698.842) (-1697.723) * (-1694.682) (-1695.991) [-1693.586] (-1696.907) -- 0:02:10
      483000 -- (-1701.412) [-1693.772] (-1695.442) (-1701.539) * (-1695.598) (-1697.215) [-1695.844] (-1699.543) -- 0:02:10
      483500 -- [-1692.846] (-1696.340) (-1703.036) (-1694.748) * (-1695.007) (-1695.022) (-1695.575) [-1698.035] -- 0:02:10
      484000 -- (-1697.238) [-1696.287] (-1701.148) (-1696.030) * [-1700.734] (-1702.640) (-1704.201) (-1694.022) -- 0:02:10
      484500 -- (-1698.062) (-1697.756) [-1692.502] (-1701.344) * (-1700.245) (-1703.580) [-1689.722] (-1706.552) -- 0:02:10
      485000 -- (-1711.096) [-1697.345] (-1697.701) (-1696.583) * [-1696.570] (-1700.785) (-1697.151) (-1698.679) -- 0:02:10

      Average standard deviation of split frequencies: 0.012125

      485500 -- [-1702.741] (-1698.270) (-1693.826) (-1690.380) * (-1694.374) [-1695.124] (-1698.236) (-1700.968) -- 0:02:10
      486000 -- (-1704.941) (-1699.747) (-1701.098) [-1703.904] * (-1699.304) (-1696.602) (-1696.287) [-1698.312] -- 0:02:10
      486500 -- [-1697.980] (-1693.187) (-1694.693) (-1696.794) * (-1699.385) (-1698.704) [-1695.111] (-1702.933) -- 0:02:09
      487000 -- (-1699.327) (-1693.116) [-1695.507] (-1700.365) * (-1696.228) (-1700.800) [-1700.832] (-1695.654) -- 0:02:09
      487500 -- (-1697.393) (-1703.533) [-1694.696] (-1696.161) * [-1699.086] (-1704.091) (-1693.716) (-1700.859) -- 0:02:09
      488000 -- (-1699.803) (-1699.327) (-1698.851) [-1694.332] * [-1697.473] (-1695.882) (-1696.866) (-1691.049) -- 0:02:09
      488500 -- (-1703.965) [-1693.569] (-1695.559) (-1700.085) * [-1695.711] (-1693.769) (-1694.272) (-1699.535) -- 0:02:09
      489000 -- (-1697.796) (-1696.492) (-1692.136) [-1690.734] * (-1699.713) (-1693.597) [-1695.392] (-1699.283) -- 0:02:09
      489500 -- [-1696.787] (-1702.206) (-1695.516) (-1697.132) * (-1693.115) [-1693.549] (-1692.639) (-1697.357) -- 0:02:09
      490000 -- (-1699.412) [-1696.345] (-1699.209) (-1691.065) * (-1699.735) (-1690.604) [-1691.395] (-1702.282) -- 0:02:09

      Average standard deviation of split frequencies: 0.012970

      490500 -- (-1696.043) [-1690.642] (-1698.679) (-1696.407) * (-1699.825) (-1693.056) [-1691.983] (-1699.448) -- 0:02:08
      491000 -- (-1691.713) (-1696.067) (-1692.363) [-1692.998] * (-1701.438) (-1693.630) (-1698.567) [-1703.355] -- 0:02:08
      491500 -- (-1697.228) (-1698.723) [-1691.159] (-1698.650) * [-1702.752] (-1704.146) (-1692.045) (-1704.357) -- 0:02:08
      492000 -- (-1694.190) (-1701.206) (-1699.388) [-1692.585] * (-1700.898) (-1696.726) (-1695.418) [-1701.412] -- 0:02:08
      492500 -- [-1693.911] (-1703.977) (-1694.471) (-1697.089) * (-1692.354) (-1692.355) [-1692.180] (-1700.275) -- 0:02:08
      493000 -- [-1693.470] (-1695.054) (-1695.966) (-1691.854) * (-1696.022) [-1703.421] (-1695.494) (-1701.392) -- 0:02:08
      493500 -- (-1692.600) (-1699.178) [-1701.432] (-1691.468) * (-1693.615) [-1698.103] (-1693.089) (-1700.183) -- 0:02:08
      494000 -- (-1698.960) [-1695.016] (-1698.160) (-1695.993) * (-1702.335) (-1693.817) (-1697.028) [-1696.233] -- 0:02:08
      494500 -- (-1709.799) [-1693.480] (-1702.469) (-1692.509) * (-1697.242) (-1696.352) (-1692.565) [-1698.143] -- 0:02:07
      495000 -- (-1703.767) (-1689.744) (-1695.946) [-1697.179] * (-1691.705) (-1698.818) (-1694.374) [-1697.115] -- 0:02:07

      Average standard deviation of split frequencies: 0.014019

      495500 -- (-1708.558) (-1701.665) (-1703.177) [-1694.347] * (-1699.226) [-1695.163] (-1694.330) (-1698.490) -- 0:02:07
      496000 -- (-1703.696) (-1693.642) [-1698.732] (-1700.689) * (-1700.337) [-1695.263] (-1697.532) (-1698.365) -- 0:02:07
      496500 -- (-1704.552) (-1698.584) [-1695.824] (-1703.178) * (-1698.425) [-1706.327] (-1707.175) (-1695.763) -- 0:02:07
      497000 -- (-1699.518) (-1696.677) (-1699.317) [-1698.161] * [-1692.593] (-1699.637) (-1694.802) (-1698.920) -- 0:02:07
      497500 -- (-1690.866) [-1691.582] (-1695.614) (-1699.713) * (-1693.054) [-1693.966] (-1695.655) (-1698.141) -- 0:02:07
      498000 -- [-1699.380] (-1700.326) (-1694.595) (-1696.611) * (-1694.728) [-1693.616] (-1693.713) (-1696.909) -- 0:02:07
      498500 -- [-1694.922] (-1696.511) (-1697.160) (-1697.187) * [-1692.956] (-1693.633) (-1705.113) (-1700.595) -- 0:02:06
      499000 -- (-1699.799) (-1701.387) [-1694.421] (-1707.173) * (-1695.588) (-1695.974) [-1701.551] (-1698.994) -- 0:02:06
      499500 -- (-1702.106) [-1699.090] (-1697.700) (-1698.950) * (-1690.044) [-1692.512] (-1695.488) (-1695.028) -- 0:02:06
      500000 -- (-1696.336) (-1703.351) [-1694.500] (-1700.348) * [-1701.589] (-1696.009) (-1697.018) (-1699.779) -- 0:02:06

      Average standard deviation of split frequencies: 0.014359

      500500 -- [-1695.465] (-1705.043) (-1696.424) (-1693.739) * (-1698.069) (-1702.703) (-1696.879) [-1696.504] -- 0:02:06
      501000 -- (-1702.676) (-1691.275) (-1694.099) [-1696.006] * (-1696.862) (-1697.915) (-1701.547) [-1694.378] -- 0:02:06
      501500 -- [-1694.120] (-1696.199) (-1694.092) (-1693.914) * (-1702.686) (-1704.490) (-1701.679) [-1697.470] -- 0:02:06
      502000 -- (-1692.971) (-1695.894) [-1691.653] (-1700.209) * (-1695.946) [-1698.522] (-1697.442) (-1698.245) -- 0:02:05
      502500 -- (-1701.238) (-1700.031) (-1694.673) [-1696.309] * (-1694.055) (-1696.275) (-1697.452) [-1695.476] -- 0:02:05
      503000 -- (-1705.022) (-1694.596) [-1701.190] (-1694.769) * [-1694.262] (-1697.112) (-1694.484) (-1703.106) -- 0:02:05
      503500 -- (-1696.560) (-1703.804) (-1701.370) [-1689.959] * (-1695.797) (-1692.668) [-1690.694] (-1694.014) -- 0:02:05
      504000 -- (-1702.314) [-1703.293] (-1691.120) (-1700.087) * (-1694.764) [-1697.606] (-1694.634) (-1696.755) -- 0:02:04
      504500 -- (-1696.899) (-1698.424) [-1695.885] (-1696.555) * (-1696.913) [-1701.238] (-1702.727) (-1701.155) -- 0:02:05
      505000 -- [-1698.968] (-1701.130) (-1695.555) (-1700.614) * (-1701.176) (-1704.364) [-1704.287] (-1701.589) -- 0:02:05

      Average standard deviation of split frequencies: 0.013276

      505500 -- (-1709.260) [-1699.101] (-1695.520) (-1696.064) * (-1698.292) (-1701.944) [-1697.662] (-1697.099) -- 0:02:05
      506000 -- [-1701.713] (-1693.125) (-1694.831) (-1698.956) * (-1695.618) (-1697.674) [-1695.474] (-1697.202) -- 0:02:04
      506500 -- (-1697.741) [-1690.788] (-1698.138) (-1696.808) * (-1699.210) [-1702.439] (-1700.397) (-1700.833) -- 0:02:04
      507000 -- (-1705.864) (-1694.126) [-1694.339] (-1698.301) * [-1696.557] (-1694.028) (-1700.508) (-1700.634) -- 0:02:04
      507500 -- (-1693.966) (-1699.247) [-1696.015] (-1698.517) * (-1698.330) (-1698.521) [-1693.074] (-1698.621) -- 0:02:04
      508000 -- [-1698.775] (-1699.523) (-1696.403) (-1697.719) * (-1693.838) (-1697.951) (-1701.439) [-1698.282] -- 0:02:03
      508500 -- (-1712.833) [-1693.291] (-1696.274) (-1694.001) * (-1696.980) (-1696.952) (-1695.422) [-1696.666] -- 0:02:04
      509000 -- (-1706.563) [-1691.043] (-1693.866) (-1699.315) * (-1695.768) [-1701.013] (-1700.665) (-1702.694) -- 0:02:04
      509500 -- [-1695.217] (-1696.116) (-1701.035) (-1696.136) * [-1699.008] (-1696.997) (-1705.398) (-1701.488) -- 0:02:04
      510000 -- [-1700.517] (-1695.465) (-1696.556) (-1700.930) * (-1690.793) (-1700.767) [-1698.510] (-1698.313) -- 0:02:03

      Average standard deviation of split frequencies: 0.012462

      510500 -- [-1701.610] (-1703.339) (-1696.384) (-1696.304) * (-1695.413) (-1696.407) [-1696.843] (-1700.257) -- 0:02:03
      511000 -- (-1698.029) [-1693.194] (-1697.816) (-1705.071) * (-1699.505) (-1696.152) [-1693.382] (-1703.040) -- 0:02:03
      511500 -- [-1694.462] (-1693.338) (-1698.442) (-1693.556) * (-1692.451) [-1695.425] (-1700.739) (-1697.839) -- 0:02:03
      512000 -- (-1699.666) (-1693.442) [-1701.078] (-1696.579) * (-1700.570) [-1695.669] (-1697.887) (-1698.128) -- 0:02:02
      512500 -- [-1694.309] (-1696.137) (-1699.471) (-1696.181) * (-1697.047) (-1699.184) (-1699.817) [-1694.235] -- 0:02:03
      513000 -- (-1700.779) (-1694.295) (-1700.076) [-1695.275] * (-1696.053) (-1699.102) (-1694.300) [-1700.775] -- 0:02:03
      513500 -- (-1694.891) (-1697.520) (-1698.081) [-1695.270] * (-1693.143) (-1697.085) [-1691.451] (-1693.317) -- 0:02:03
      514000 -- (-1693.919) (-1696.115) (-1697.810) [-1693.943] * (-1697.718) (-1697.977) [-1692.366] (-1698.413) -- 0:02:02
      514500 -- [-1702.263] (-1699.229) (-1697.593) (-1694.160) * [-1693.778] (-1691.606) (-1696.981) (-1705.355) -- 0:02:02
      515000 -- [-1697.915] (-1701.102) (-1696.212) (-1700.651) * (-1693.870) (-1696.710) [-1693.816] (-1698.199) -- 0:02:02

      Average standard deviation of split frequencies: 0.012790

      515500 -- (-1699.891) (-1703.563) (-1695.630) [-1693.288] * (-1697.686) [-1699.066] (-1696.262) (-1691.076) -- 0:02:02
      516000 -- (-1691.955) [-1698.082] (-1701.031) (-1695.048) * (-1693.019) (-1700.407) [-1694.269] (-1698.346) -- 0:02:01
      516500 -- [-1694.961] (-1697.349) (-1695.587) (-1696.842) * (-1695.116) (-1695.300) [-1700.495] (-1694.322) -- 0:02:02
      517000 -- (-1692.387) (-1702.350) (-1700.295) [-1696.504] * (-1697.218) [-1694.819] (-1695.164) (-1696.626) -- 0:02:02
      517500 -- (-1693.895) (-1699.120) [-1694.833] (-1694.485) * (-1695.585) [-1695.430] (-1699.521) (-1693.788) -- 0:02:02
      518000 -- (-1705.897) [-1694.056] (-1701.927) (-1705.266) * (-1695.701) [-1693.994] (-1695.797) (-1698.786) -- 0:02:01
      518500 -- (-1699.216) (-1698.139) (-1713.448) [-1696.314] * [-1693.935] (-1699.803) (-1695.473) (-1704.873) -- 0:02:01
      519000 -- (-1695.669) (-1697.421) [-1695.521] (-1692.202) * (-1701.463) (-1691.307) (-1694.459) [-1691.364] -- 0:02:01
      519500 -- (-1698.893) (-1701.120) (-1697.366) [-1695.708] * (-1697.799) [-1696.169] (-1693.909) (-1699.296) -- 0:02:01
      520000 -- (-1696.086) [-1701.501] (-1693.745) (-1692.671) * (-1704.681) [-1695.366] (-1693.901) (-1695.745) -- 0:02:01

      Average standard deviation of split frequencies: 0.013581

      520500 -- [-1692.867] (-1696.281) (-1693.403) (-1697.946) * [-1699.304] (-1696.415) (-1695.213) (-1698.001) -- 0:02:01
      521000 -- (-1693.804) (-1696.409) (-1698.489) [-1691.844] * [-1697.100] (-1693.212) (-1694.516) (-1696.583) -- 0:02:01
      521500 -- [-1696.775] (-1698.330) (-1693.178) (-1690.594) * (-1707.148) (-1691.533) (-1696.880) [-1697.082] -- 0:02:01
      522000 -- [-1696.051] (-1698.517) (-1693.926) (-1694.185) * (-1696.810) [-1694.218] (-1692.464) (-1696.612) -- 0:02:00
      522500 -- (-1694.557) (-1694.768) (-1694.319) [-1689.202] * [-1702.525] (-1697.944) (-1697.391) (-1700.841) -- 0:02:00
      523000 -- [-1693.098] (-1696.100) (-1692.054) (-1696.343) * (-1701.624) [-1692.688] (-1692.495) (-1705.455) -- 0:02:00
      523500 -- [-1696.277] (-1695.311) (-1699.038) (-1696.180) * (-1694.127) (-1703.822) (-1692.244) [-1695.496] -- 0:02:00
      524000 -- (-1696.387) [-1696.532] (-1697.333) (-1693.003) * (-1688.747) (-1698.285) [-1695.457] (-1699.694) -- 0:02:00
      524500 -- [-1690.844] (-1695.298) (-1693.264) (-1695.879) * (-1694.053) [-1699.696] (-1693.654) (-1697.163) -- 0:02:00
      525000 -- (-1695.977) [-1694.523] (-1695.161) (-1697.779) * (-1696.091) (-1694.803) [-1701.607] (-1697.925) -- 0:02:00

      Average standard deviation of split frequencies: 0.012547

      525500 -- (-1700.148) (-1710.527) (-1699.527) [-1694.975] * [-1695.900] (-1691.189) (-1699.910) (-1694.701) -- 0:02:00
      526000 -- (-1699.193) (-1700.365) (-1698.442) [-1695.461] * (-1701.507) (-1698.272) (-1696.188) [-1695.886] -- 0:01:59
      526500 -- (-1700.324) [-1694.890] (-1697.454) (-1700.604) * [-1706.144] (-1695.190) (-1700.090) (-1701.730) -- 0:01:59
      527000 -- (-1705.883) (-1691.335) (-1700.964) [-1698.722] * (-1697.930) (-1693.844) [-1701.356] (-1698.421) -- 0:01:59
      527500 -- (-1706.366) [-1695.178] (-1697.065) (-1700.094) * (-1698.658) (-1689.699) (-1702.011) [-1694.405] -- 0:01:59
      528000 -- (-1693.530) [-1698.519] (-1701.107) (-1698.348) * (-1697.781) (-1692.562) [-1691.907] (-1692.368) -- 0:01:59
      528500 -- (-1698.492) [-1693.941] (-1700.980) (-1698.017) * (-1696.729) (-1696.703) (-1699.175) [-1691.565] -- 0:01:59
      529000 -- (-1694.055) (-1699.090) (-1693.918) [-1691.950] * (-1700.180) [-1696.311] (-1696.799) (-1691.392) -- 0:01:59
      529500 -- (-1704.746) (-1700.944) (-1703.579) [-1692.323] * (-1699.190) (-1696.929) (-1692.825) [-1696.931] -- 0:01:59
      530000 -- (-1705.229) [-1698.491] (-1698.088) (-1692.349) * (-1695.044) [-1693.389] (-1695.647) (-1699.504) -- 0:01:58

      Average standard deviation of split frequencies: 0.012659

      530500 -- (-1693.736) (-1700.755) [-1693.977] (-1697.270) * [-1693.563] (-1707.505) (-1697.723) (-1697.228) -- 0:01:58
      531000 -- (-1697.282) (-1703.752) (-1695.466) [-1703.277] * (-1694.832) (-1698.304) [-1702.346] (-1699.109) -- 0:01:58
      531500 -- (-1699.828) (-1697.224) (-1695.570) [-1699.131] * (-1693.068) (-1699.517) (-1700.469) [-1694.674] -- 0:01:58
      532000 -- (-1699.155) [-1697.674] (-1701.334) (-1698.994) * [-1696.444] (-1691.765) (-1703.734) (-1708.088) -- 0:01:58
      532500 -- [-1697.018] (-1695.652) (-1692.833) (-1696.189) * [-1694.115] (-1691.740) (-1701.898) (-1694.331) -- 0:01:58
      533000 -- [-1701.668] (-1696.194) (-1700.331) (-1702.402) * (-1692.486) (-1697.513) [-1694.726] (-1702.590) -- 0:01:58
      533500 -- [-1693.237] (-1700.807) (-1703.700) (-1694.309) * [-1696.520] (-1692.849) (-1701.265) (-1710.534) -- 0:01:58
      534000 -- [-1698.224] (-1691.687) (-1698.206) (-1702.652) * (-1691.785) (-1703.284) [-1700.648] (-1699.329) -- 0:01:57
      534500 -- (-1701.183) (-1693.912) (-1696.546) [-1694.296] * (-1700.328) (-1700.250) (-1701.567) [-1696.576] -- 0:01:57
      535000 -- (-1699.402) (-1702.527) (-1698.540) [-1695.996] * [-1691.879] (-1696.541) (-1706.512) (-1700.372) -- 0:01:57

      Average standard deviation of split frequencies: 0.011433

      535500 -- (-1697.612) [-1702.397] (-1697.529) (-1697.065) * (-1691.457) (-1704.906) [-1697.955] (-1701.669) -- 0:01:57
      536000 -- (-1694.271) (-1704.411) [-1696.585] (-1697.203) * (-1699.620) (-1692.708) (-1699.767) [-1696.729] -- 0:01:57
      536500 -- (-1697.401) (-1695.261) [-1700.002] (-1694.329) * (-1698.995) (-1700.743) [-1695.850] (-1697.687) -- 0:01:57
      537000 -- (-1695.639) (-1695.809) (-1703.531) [-1698.985] * [-1693.124] (-1697.084) (-1700.826) (-1697.594) -- 0:01:57
      537500 -- (-1700.385) [-1697.985] (-1713.164) (-1699.443) * (-1692.885) (-1694.096) (-1696.260) [-1695.023] -- 0:01:57
      538000 -- (-1704.807) (-1695.236) [-1703.802] (-1696.583) * (-1696.894) (-1703.334) [-1704.908] (-1698.400) -- 0:01:56
      538500 -- (-1696.226) (-1699.374) (-1707.213) [-1694.909] * (-1700.296) [-1700.472] (-1693.264) (-1696.502) -- 0:01:56
      539000 -- (-1698.807) [-1693.511] (-1695.734) (-1693.870) * [-1694.475] (-1698.257) (-1708.779) (-1697.536) -- 0:01:56
      539500 -- (-1693.604) (-1702.075) [-1700.218] (-1693.191) * [-1693.679] (-1703.019) (-1694.008) (-1701.929) -- 0:01:56
      540000 -- [-1697.820] (-1700.778) (-1698.135) (-1693.785) * (-1698.470) (-1696.775) (-1696.192) [-1694.882] -- 0:01:56

      Average standard deviation of split frequencies: 0.011553

      540500 -- (-1703.485) [-1693.179] (-1700.524) (-1702.978) * (-1693.063) (-1690.487) (-1699.622) [-1696.060] -- 0:01:56
      541000 -- (-1694.733) (-1694.877) (-1698.109) [-1697.589] * (-1699.808) (-1698.827) [-1695.452] (-1698.332) -- 0:01:56
      541500 -- [-1699.536] (-1697.560) (-1699.580) (-1695.299) * (-1698.635) [-1696.252] (-1697.210) (-1695.870) -- 0:01:56
      542000 -- (-1693.675) [-1694.861] (-1697.468) (-1700.295) * [-1692.136] (-1694.775) (-1697.249) (-1698.104) -- 0:01:55
      542500 -- [-1695.689] (-1698.855) (-1692.964) (-1702.296) * (-1702.858) [-1700.561] (-1696.717) (-1699.330) -- 0:01:55
      543000 -- [-1694.301] (-1694.696) (-1697.078) (-1698.351) * (-1696.072) (-1702.162) (-1695.714) [-1703.223] -- 0:01:55
      543500 -- (-1699.552) (-1697.462) [-1706.970] (-1696.595) * [-1703.342] (-1700.329) (-1695.582) (-1693.666) -- 0:01:55
      544000 -- (-1701.137) [-1696.948] (-1702.031) (-1694.519) * (-1698.154) (-1695.062) (-1696.479) [-1695.564] -- 0:01:55
      544500 -- [-1690.497] (-1696.595) (-1701.805) (-1700.341) * (-1704.161) [-1695.583] (-1698.221) (-1701.120) -- 0:01:55
      545000 -- [-1693.042] (-1696.403) (-1716.156) (-1702.580) * (-1705.210) [-1698.839] (-1703.149) (-1695.955) -- 0:01:55

      Average standard deviation of split frequencies: 0.011440

      545500 -- (-1693.869) [-1692.542] (-1694.423) (-1696.121) * (-1704.245) (-1704.137) (-1701.254) [-1690.820] -- 0:01:54
      546000 -- (-1693.982) (-1698.526) [-1699.050] (-1698.421) * [-1696.642] (-1693.356) (-1703.906) (-1699.870) -- 0:01:54
      546500 -- (-1693.493) (-1700.411) [-1693.956] (-1698.714) * [-1696.330] (-1694.154) (-1702.391) (-1696.739) -- 0:01:54
      547000 -- (-1699.537) [-1694.362] (-1695.273) (-1694.181) * [-1691.280] (-1691.543) (-1701.280) (-1697.130) -- 0:01:54
      547500 -- (-1690.371) [-1696.581] (-1693.015) (-1702.270) * [-1695.247] (-1698.579) (-1698.536) (-1696.176) -- 0:01:54
      548000 -- [-1694.171] (-1695.629) (-1697.666) (-1697.216) * [-1696.867] (-1697.926) (-1697.344) (-1702.179) -- 0:01:54
      548500 -- (-1695.726) [-1701.335] (-1693.351) (-1697.124) * [-1694.129] (-1694.878) (-1702.198) (-1698.195) -- 0:01:54
      549000 -- [-1702.977] (-1695.600) (-1691.891) (-1713.209) * (-1695.489) [-1697.899] (-1702.139) (-1697.538) -- 0:01:54
      549500 -- [-1703.942] (-1697.618) (-1694.129) (-1698.896) * [-1697.137] (-1697.569) (-1693.948) (-1695.976) -- 0:01:53
      550000 -- (-1697.019) (-1706.365) (-1696.855) [-1698.655] * [-1691.580] (-1694.517) (-1696.478) (-1696.478) -- 0:01:53

      Average standard deviation of split frequencies: 0.011343

      550500 -- [-1694.594] (-1697.403) (-1693.199) (-1699.985) * [-1693.226] (-1700.364) (-1701.113) (-1703.167) -- 0:01:53
      551000 -- (-1693.442) [-1695.972] (-1699.664) (-1695.958) * [-1698.324] (-1694.814) (-1700.942) (-1694.876) -- 0:01:53
      551500 -- (-1693.897) (-1701.769) [-1695.764] (-1700.764) * (-1698.866) (-1698.380) (-1692.340) [-1696.387] -- 0:01:53
      552000 -- (-1696.636) (-1695.611) [-1697.363] (-1703.598) * (-1697.217) (-1697.083) [-1695.661] (-1702.136) -- 0:01:53
      552500 -- (-1706.173) (-1693.890) (-1695.201) [-1700.330] * (-1705.767) (-1698.357) [-1694.433] (-1698.271) -- 0:01:53
      553000 -- (-1691.368) [-1695.125] (-1705.198) (-1703.611) * (-1695.236) [-1707.490] (-1698.258) (-1699.874) -- 0:01:53
      553500 -- (-1691.917) (-1702.203) [-1698.872] (-1696.626) * (-1698.656) (-1702.128) (-1696.518) [-1694.210] -- 0:01:52
      554000 -- (-1695.636) (-1700.087) [-1696.114] (-1692.721) * (-1695.248) (-1701.099) (-1700.585) [-1696.844] -- 0:01:52
      554500 -- (-1697.170) [-1702.720] (-1700.340) (-1701.738) * (-1709.173) (-1704.360) (-1698.838) [-1697.382] -- 0:01:52
      555000 -- (-1699.218) (-1701.411) [-1695.662] (-1698.185) * [-1701.189] (-1709.920) (-1703.972) (-1693.506) -- 0:01:52

      Average standard deviation of split frequencies: 0.012718

      555500 -- (-1691.450) [-1697.537] (-1693.557) (-1700.360) * (-1699.524) (-1706.854) [-1705.997] (-1702.508) -- 0:01:52
      556000 -- (-1691.106) (-1699.938) [-1698.043] (-1700.874) * (-1700.181) [-1695.081] (-1712.667) (-1694.945) -- 0:01:52
      556500 -- (-1697.841) (-1697.858) (-1693.199) [-1690.532] * [-1695.029] (-1694.764) (-1708.881) (-1699.431) -- 0:01:52
      557000 -- (-1696.064) [-1694.623] (-1694.844) (-1697.984) * (-1697.877) (-1694.212) [-1693.448] (-1701.571) -- 0:01:52
      557500 -- (-1698.904) [-1702.498] (-1690.710) (-1700.132) * (-1703.542) (-1694.774) [-1698.467] (-1695.364) -- 0:01:51
      558000 -- (-1696.732) (-1699.519) [-1695.213] (-1702.999) * [-1698.505] (-1697.401) (-1703.106) (-1700.940) -- 0:01:51
      558500 -- (-1695.106) [-1690.583] (-1694.204) (-1693.301) * [-1697.065] (-1696.415) (-1704.387) (-1697.043) -- 0:01:51
      559000 -- (-1696.280) (-1696.920) (-1698.311) [-1696.077] * (-1696.417) (-1693.412) (-1707.385) [-1696.432] -- 0:01:51
      559500 -- (-1706.600) (-1698.309) (-1699.156) [-1698.236] * (-1697.212) (-1691.682) [-1698.371] (-1694.782) -- 0:01:51
      560000 -- (-1707.527) (-1705.426) [-1693.664] (-1698.805) * [-1696.807] (-1699.958) (-1700.674) (-1690.448) -- 0:01:51

      Average standard deviation of split frequencies: 0.014083

      560500 -- (-1707.120) [-1694.494] (-1692.819) (-1697.080) * (-1697.927) [-1703.497] (-1692.600) (-1695.320) -- 0:01:51
      561000 -- (-1699.510) (-1698.905) [-1692.225] (-1694.419) * (-1701.097) [-1693.900] (-1696.295) (-1694.558) -- 0:01:51
      561500 -- (-1695.524) (-1694.879) (-1695.829) [-1695.368] * [-1693.747] (-1697.562) (-1691.169) (-1695.346) -- 0:01:50
      562000 -- (-1698.024) (-1694.428) [-1692.902] (-1695.101) * (-1699.144) (-1700.825) [-1692.221] (-1697.080) -- 0:01:50
      562500 -- (-1700.286) (-1690.922) [-1697.969] (-1695.974) * [-1693.587] (-1700.139) (-1699.612) (-1701.073) -- 0:01:50
      563000 -- (-1698.132) (-1697.173) (-1696.472) [-1694.017] * (-1703.950) (-1695.510) [-1693.456] (-1696.350) -- 0:01:50
      563500 -- (-1695.303) [-1691.742] (-1703.230) (-1694.255) * (-1694.063) (-1695.763) (-1695.607) [-1699.497] -- 0:01:49
      564000 -- [-1696.001] (-1693.237) (-1696.265) (-1704.499) * (-1696.539) [-1696.671] (-1701.015) (-1694.464) -- 0:01:50
      564500 -- (-1693.041) (-1695.131) (-1698.726) [-1693.006] * (-1696.380) [-1699.207] (-1692.925) (-1706.927) -- 0:01:50
      565000 -- (-1694.898) (-1693.296) [-1697.261] (-1694.938) * (-1702.262) (-1695.229) [-1692.509] (-1696.969) -- 0:01:50

      Average standard deviation of split frequencies: 0.012909

      565500 -- (-1692.953) (-1696.966) [-1696.587] (-1696.560) * (-1699.429) [-1693.871] (-1693.166) (-1695.872) -- 0:01:49
      566000 -- (-1694.435) (-1699.118) [-1699.701] (-1698.582) * [-1696.902] (-1691.633) (-1708.406) (-1705.709) -- 0:01:49
      566500 -- [-1695.966] (-1697.306) (-1697.211) (-1695.046) * (-1699.191) [-1691.149] (-1695.498) (-1694.963) -- 0:01:49
      567000 -- (-1705.802) (-1699.256) [-1691.262] (-1699.600) * [-1694.944] (-1695.209) (-1698.267) (-1701.381) -- 0:01:49
      567500 -- (-1693.353) (-1692.390) [-1695.615] (-1699.827) * (-1695.384) (-1699.069) [-1702.529] (-1701.773) -- 0:01:48
      568000 -- (-1694.550) (-1696.810) [-1697.402] (-1700.547) * (-1701.497) (-1698.527) [-1695.690] (-1700.987) -- 0:01:49
      568500 -- (-1702.571) (-1696.753) (-1698.512) [-1701.201] * (-1697.822) [-1698.328] (-1695.539) (-1698.389) -- 0:01:49
      569000 -- (-1695.674) (-1701.271) (-1697.709) [-1696.622] * [-1696.950] (-1697.260) (-1693.080) (-1699.446) -- 0:01:49
      569500 -- (-1696.758) (-1698.578) (-1699.165) [-1695.451] * (-1690.627) [-1700.784] (-1696.668) (-1700.011) -- 0:01:48
      570000 -- (-1697.847) (-1700.795) [-1695.605] (-1701.509) * [-1699.852] (-1698.330) (-1694.697) (-1700.055) -- 0:01:48

      Average standard deviation of split frequencies: 0.016108

      570500 -- (-1692.727) (-1696.741) [-1692.241] (-1703.190) * (-1695.477) (-1700.821) (-1697.417) [-1694.625] -- 0:01:48
      571000 -- (-1693.956) (-1701.364) [-1694.916] (-1699.852) * (-1693.957) (-1694.128) [-1697.057] (-1698.474) -- 0:01:48
      571500 -- [-1694.289] (-1694.674) (-1698.540) (-1693.336) * (-1700.927) [-1701.822] (-1696.316) (-1691.033) -- 0:01:47
      572000 -- [-1697.708] (-1695.631) (-1702.908) (-1691.740) * (-1689.917) (-1695.975) (-1702.613) [-1696.460] -- 0:01:48
      572500 -- (-1698.083) (-1697.428) [-1696.257] (-1702.935) * [-1699.603] (-1690.680) (-1700.003) (-1702.041) -- 0:01:48
      573000 -- [-1696.541] (-1695.789) (-1699.892) (-1697.891) * [-1693.886] (-1697.205) (-1696.661) (-1702.348) -- 0:01:48
      573500 -- (-1692.732) (-1695.842) (-1689.864) [-1695.422] * (-1697.315) [-1699.330] (-1698.903) (-1700.506) -- 0:01:47
      574000 -- [-1696.640] (-1698.431) (-1694.758) (-1693.048) * (-1703.653) (-1713.606) (-1697.880) [-1693.759] -- 0:01:47
      574500 -- [-1702.390] (-1699.317) (-1695.764) (-1690.676) * (-1697.779) (-1701.477) (-1700.419) [-1695.319] -- 0:01:47
      575000 -- (-1695.275) (-1693.779) (-1699.620) [-1698.304] * [-1691.537] (-1699.476) (-1695.998) (-1697.309) -- 0:01:47

      Average standard deviation of split frequencies: 0.017187

      575500 -- [-1697.243] (-1691.643) (-1696.592) (-1699.774) * (-1699.687) (-1694.779) [-1699.144] (-1702.899) -- 0:01:46
      576000 -- (-1696.283) (-1692.534) (-1699.390) [-1696.865] * (-1693.038) (-1698.780) (-1701.551) [-1698.783] -- 0:01:47
      576500 -- [-1691.487] (-1701.680) (-1701.106) (-1697.469) * (-1699.265) (-1692.904) (-1698.073) [-1701.048] -- 0:01:47
      577000 -- (-1694.774) (-1696.161) (-1694.805) [-1698.262] * (-1696.811) [-1692.329] (-1696.990) (-1700.638) -- 0:01:47
      577500 -- [-1694.958] (-1702.658) (-1698.076) (-1697.467) * (-1699.022) [-1697.188] (-1694.413) (-1692.355) -- 0:01:46
      578000 -- (-1699.603) (-1701.250) [-1694.732] (-1694.503) * (-1707.976) [-1701.181] (-1698.971) (-1696.023) -- 0:01:46
      578500 -- (-1696.105) [-1699.847] (-1696.765) (-1698.110) * (-1693.643) (-1700.711) (-1695.105) [-1695.418] -- 0:01:46
      579000 -- (-1700.611) [-1700.028] (-1698.431) (-1699.234) * (-1704.831) (-1700.289) [-1698.689] (-1691.892) -- 0:01:46
      579500 -- (-1698.191) (-1694.611) (-1697.351) [-1695.066] * (-1695.701) [-1694.709] (-1700.815) (-1700.572) -- 0:01:45
      580000 -- (-1698.552) (-1695.729) [-1700.161] (-1697.910) * (-1697.308) (-1700.468) (-1695.720) [-1697.101] -- 0:01:46

      Average standard deviation of split frequencies: 0.017048

      580500 -- (-1698.745) [-1690.764] (-1699.208) (-1702.349) * (-1691.832) (-1697.988) [-1699.104] (-1696.941) -- 0:01:46
      581000 -- (-1695.980) (-1698.071) [-1693.637] (-1697.277) * [-1695.625] (-1699.123) (-1693.529) (-1696.722) -- 0:01:46
      581500 -- (-1702.356) [-1693.396] (-1696.045) (-1695.262) * (-1693.367) (-1697.570) [-1693.306] (-1708.651) -- 0:01:45
      582000 -- (-1701.711) [-1696.964] (-1696.027) (-1697.276) * [-1695.780] (-1705.239) (-1699.924) (-1695.867) -- 0:01:45
      582500 -- (-1704.571) (-1706.023) [-1691.672] (-1694.104) * [-1695.428] (-1697.192) (-1693.737) (-1694.346) -- 0:01:45
      583000 -- (-1692.144) (-1707.595) [-1696.579] (-1698.644) * (-1699.951) [-1696.671] (-1698.250) (-1697.599) -- 0:01:45
      583500 -- (-1693.911) (-1700.146) (-1693.841) [-1695.505] * (-1696.784) [-1695.210] (-1699.829) (-1701.370) -- 0:01:44
      584000 -- [-1696.938] (-1697.161) (-1700.434) (-1694.927) * (-1701.408) [-1697.871] (-1700.274) (-1699.868) -- 0:01:45
      584500 -- (-1693.291) (-1695.880) (-1697.541) [-1695.547] * (-1702.107) [-1693.289] (-1701.790) (-1695.046) -- 0:01:45
      585000 -- [-1692.902] (-1705.351) (-1696.746) (-1696.338) * (-1714.209) [-1697.489] (-1703.415) (-1697.796) -- 0:01:44

      Average standard deviation of split frequencies: 0.016692

      585500 -- [-1691.259] (-1701.612) (-1698.568) (-1698.032) * (-1701.217) [-1693.303] (-1695.884) (-1701.492) -- 0:01:44
      586000 -- (-1694.162) (-1699.886) (-1696.465) [-1694.262] * (-1698.805) [-1694.393] (-1698.344) (-1694.575) -- 0:01:44
      586500 -- (-1691.674) [-1696.259] (-1705.230) (-1698.412) * [-1695.168] (-1702.351) (-1703.232) (-1696.269) -- 0:01:44
      587000 -- [-1694.900] (-1698.846) (-1690.133) (-1700.753) * (-1701.516) (-1697.225) (-1703.265) [-1699.616] -- 0:01:44
      587500 -- [-1695.485] (-1691.329) (-1692.261) (-1692.278) * (-1691.004) [-1693.089] (-1698.680) (-1699.451) -- 0:01:43
      588000 -- (-1701.797) (-1696.730) (-1705.486) [-1692.653] * (-1691.924) (-1696.071) (-1694.189) [-1698.503] -- 0:01:44
      588500 -- [-1692.982] (-1696.241) (-1701.341) (-1693.802) * (-1691.493) (-1693.594) [-1693.647] (-1697.047) -- 0:01:44
      589000 -- (-1699.195) (-1698.151) (-1696.376) [-1697.202] * (-1700.083) [-1694.854] (-1703.074) (-1697.444) -- 0:01:43
      589500 -- (-1696.152) [-1694.829] (-1700.636) (-1707.246) * (-1700.062) (-1701.007) [-1692.798] (-1697.701) -- 0:01:43
      590000 -- (-1700.458) [-1691.908] (-1691.054) (-1699.258) * (-1692.950) (-1696.279) (-1693.128) [-1694.169] -- 0:01:43

      Average standard deviation of split frequencies: 0.016161

      590500 -- (-1707.579) (-1696.198) [-1692.485] (-1699.277) * [-1691.947] (-1691.779) (-1704.518) (-1699.882) -- 0:01:43
      591000 -- (-1696.792) (-1700.201) (-1693.181) [-1693.841] * (-1696.682) (-1695.380) (-1697.672) [-1692.636] -- 0:01:43
      591500 -- (-1696.083) (-1698.710) (-1691.141) [-1704.474] * [-1693.123] (-1694.357) (-1689.265) (-1694.022) -- 0:01:42
      592000 -- (-1689.573) (-1707.267) [-1696.193] (-1703.787) * (-1708.240) (-1697.462) (-1697.248) [-1700.306] -- 0:01:43
      592500 -- [-1693.110] (-1701.108) (-1699.326) (-1697.195) * (-1700.843) (-1695.793) (-1691.137) [-1695.474] -- 0:01:43
      593000 -- [-1694.429] (-1699.938) (-1696.285) (-1691.160) * (-1703.953) [-1700.519] (-1699.564) (-1693.992) -- 0:01:42
      593500 -- [-1698.641] (-1695.701) (-1693.505) (-1693.670) * (-1700.415) (-1695.864) (-1694.630) [-1692.459] -- 0:01:42
      594000 -- (-1698.123) (-1709.058) [-1699.221] (-1694.024) * (-1697.310) (-1699.083) (-1698.928) [-1697.534] -- 0:01:42
      594500 -- (-1698.893) (-1698.323) (-1694.664) [-1692.575] * (-1708.910) [-1693.860] (-1699.050) (-1695.505) -- 0:01:42
      595000 -- (-1692.121) (-1698.609) (-1690.470) [-1697.376] * (-1694.454) (-1695.594) [-1694.650] (-1698.274) -- 0:01:42

      Average standard deviation of split frequencies: 0.015226

      595500 -- (-1693.283) (-1697.614) (-1700.169) [-1700.208] * [-1697.290] (-1702.252) (-1694.583) (-1695.130) -- 0:01:41
      596000 -- [-1693.097] (-1699.486) (-1698.115) (-1693.425) * (-1695.290) (-1706.379) (-1692.062) [-1695.167] -- 0:01:42
      596500 -- [-1696.039] (-1697.259) (-1701.795) (-1697.268) * [-1693.271] (-1704.996) (-1697.693) (-1699.620) -- 0:01:42
      597000 -- [-1693.881] (-1710.573) (-1692.472) (-1698.694) * (-1693.146) [-1698.965] (-1694.980) (-1694.675) -- 0:01:41
      597500 -- (-1689.105) [-1693.470] (-1698.605) (-1704.616) * (-1699.297) (-1699.233) [-1691.711] (-1699.643) -- 0:01:41
      598000 -- [-1694.885] (-1695.373) (-1693.635) (-1697.678) * (-1698.746) (-1694.624) (-1698.453) [-1705.385] -- 0:01:41
      598500 -- (-1694.303) (-1698.976) (-1701.801) [-1697.637] * (-1694.628) (-1693.438) [-1696.990] (-1694.729) -- 0:01:41
      599000 -- [-1693.442] (-1703.524) (-1695.860) (-1699.342) * (-1695.312) (-1698.670) (-1690.504) [-1694.793] -- 0:01:41
      599500 -- (-1694.617) (-1694.960) (-1704.423) [-1697.059] * (-1692.043) (-1701.230) [-1693.508] (-1697.479) -- 0:01:40
      600000 -- [-1697.530] (-1700.704) (-1703.572) (-1698.537) * (-1695.537) (-1696.933) [-1691.998] (-1704.830) -- 0:01:41

      Average standard deviation of split frequencies: 0.015107

      600500 -- (-1700.573) (-1694.367) [-1700.944] (-1704.320) * (-1702.098) (-1701.413) (-1693.987) [-1691.461] -- 0:01:41
      601000 -- (-1699.261) (-1699.200) [-1697.385] (-1697.130) * (-1696.939) (-1695.381) [-1695.565] (-1706.828) -- 0:01:40
      601500 -- (-1703.717) (-1699.967) [-1696.276] (-1694.788) * (-1695.814) (-1694.877) [-1695.282] (-1696.021) -- 0:01:40
      602000 -- (-1697.506) (-1700.260) [-1692.911] (-1695.146) * (-1696.366) (-1698.035) [-1695.555] (-1698.581) -- 0:01:40
      602500 -- (-1698.572) (-1704.752) [-1694.667] (-1693.726) * (-1692.838) (-1702.019) [-1696.006] (-1699.586) -- 0:01:40
      603000 -- (-1696.850) (-1694.930) (-1691.761) [-1695.244] * (-1697.392) [-1696.987] (-1695.772) (-1705.032) -- 0:01:40
      603500 -- [-1695.888] (-1698.405) (-1698.694) (-1701.020) * (-1698.087) (-1694.988) [-1690.454] (-1699.134) -- 0:01:39
      604000 -- (-1697.341) (-1698.876) (-1696.715) [-1704.499] * (-1696.973) [-1692.028] (-1693.222) (-1697.848) -- 0:01:40
      604500 -- (-1702.128) (-1704.893) [-1692.404] (-1698.566) * [-1692.675] (-1695.592) (-1695.768) (-1702.336) -- 0:01:40
      605000 -- (-1699.289) (-1701.367) [-1696.379] (-1698.026) * (-1697.854) (-1692.938) [-1695.401] (-1695.810) -- 0:01:39

      Average standard deviation of split frequencies: 0.016530

      605500 -- (-1699.924) [-1693.652] (-1694.022) (-1696.128) * [-1693.867] (-1710.120) (-1690.622) (-1696.482) -- 0:01:39
      606000 -- [-1697.648] (-1696.571) (-1697.607) (-1699.302) * [-1696.887] (-1700.143) (-1696.577) (-1692.339) -- 0:01:39
      606500 -- [-1699.127] (-1701.197) (-1693.957) (-1697.111) * (-1697.677) (-1701.487) [-1698.706] (-1693.828) -- 0:01:39
      607000 -- (-1704.708) (-1703.306) (-1698.192) [-1690.561] * (-1696.316) [-1694.726] (-1696.435) (-1695.089) -- 0:01:39
      607500 -- (-1695.271) (-1701.468) (-1699.718) [-1695.965] * (-1700.357) (-1693.899) [-1696.657] (-1703.608) -- 0:01:39
      608000 -- (-1699.567) (-1702.630) (-1702.045) [-1695.844] * (-1698.318) (-1696.467) (-1704.310) [-1697.476] -- 0:01:39
      608500 -- [-1698.675] (-1693.924) (-1706.013) (-1696.896) * (-1701.553) (-1699.192) (-1706.001) [-1706.954] -- 0:01:39
      609000 -- (-1708.043) (-1697.384) [-1703.815] (-1706.218) * (-1697.368) [-1695.292] (-1701.796) (-1698.427) -- 0:01:38
      609500 -- (-1696.465) (-1698.686) [-1698.518] (-1701.356) * (-1696.374) [-1694.216] (-1695.092) (-1699.473) -- 0:01:38
      610000 -- [-1698.762] (-1695.861) (-1697.398) (-1692.319) * (-1700.767) [-1693.117] (-1694.551) (-1700.433) -- 0:01:38

      Average standard deviation of split frequencies: 0.016211

      610500 -- (-1696.048) (-1701.153) [-1693.350] (-1694.498) * (-1694.731) (-1701.358) (-1708.310) [-1696.611] -- 0:01:38
      611000 -- (-1693.541) (-1695.467) (-1693.997) [-1700.960] * (-1698.019) (-1698.389) (-1703.277) [-1699.424] -- 0:01:38
      611500 -- [-1697.381] (-1703.256) (-1699.830) (-1696.394) * [-1696.409] (-1693.676) (-1709.649) (-1696.802) -- 0:01:38
      612000 -- (-1695.473) (-1699.480) [-1699.013] (-1711.655) * (-1702.901) [-1693.833] (-1709.495) (-1701.515) -- 0:01:38
      612500 -- [-1700.814] (-1700.253) (-1700.844) (-1697.097) * (-1700.530) [-1696.856] (-1701.527) (-1693.023) -- 0:01:38
      613000 -- [-1694.679] (-1695.778) (-1699.083) (-1699.622) * (-1696.320) (-1692.849) (-1708.024) [-1696.629] -- 0:01:37
      613500 -- (-1697.274) (-1703.139) [-1696.066] (-1689.994) * (-1700.008) (-1698.548) (-1714.903) [-1697.021] -- 0:01:37
      614000 -- [-1694.628] (-1699.136) (-1691.944) (-1694.240) * (-1695.119) (-1699.679) (-1698.014) [-1701.064] -- 0:01:37
      614500 -- (-1699.783) [-1699.591] (-1691.424) (-1699.944) * [-1691.497] (-1692.454) (-1698.229) (-1690.349) -- 0:01:37
      615000 -- (-1701.257) (-1698.571) [-1700.338] (-1698.804) * (-1692.898) (-1706.374) [-1694.567] (-1697.864) -- 0:01:37

      Average standard deviation of split frequencies: 0.015688

      615500 -- (-1701.965) (-1694.310) (-1698.326) [-1696.476] * (-1692.294) (-1702.852) [-1692.368] (-1695.791) -- 0:01:37
      616000 -- (-1703.285) [-1695.864] (-1707.670) (-1696.700) * (-1701.236) (-1698.060) [-1693.104] (-1700.562) -- 0:01:37
      616500 -- (-1699.744) [-1703.018] (-1702.536) (-1697.333) * [-1694.595] (-1694.802) (-1693.980) (-1699.126) -- 0:01:37
      617000 -- (-1697.875) (-1693.838) (-1698.382) [-1697.957] * (-1695.037) [-1694.281] (-1693.273) (-1692.460) -- 0:01:36
      617500 -- (-1694.317) [-1694.994] (-1695.610) (-1697.983) * [-1705.280] (-1697.096) (-1697.812) (-1699.377) -- 0:01:36
      618000 -- (-1697.664) (-1702.630) [-1696.913] (-1707.479) * (-1697.080) (-1701.786) (-1699.891) [-1699.244] -- 0:01:36
      618500 -- (-1695.147) (-1692.982) (-1694.411) [-1692.657] * [-1701.471] (-1694.895) (-1699.888) (-1702.411) -- 0:01:36
      619000 -- (-1695.355) (-1694.308) (-1697.697) [-1691.862] * (-1702.358) (-1696.756) (-1699.104) [-1700.804] -- 0:01:36
      619500 -- [-1696.141] (-1693.806) (-1692.422) (-1700.188) * (-1698.891) [-1699.019] (-1693.917) (-1695.365) -- 0:01:36
      620000 -- (-1695.147) [-1697.170] (-1699.094) (-1699.083) * (-1699.040) (-1702.461) (-1694.160) [-1695.635] -- 0:01:36

      Average standard deviation of split frequencies: 0.016519

      620500 -- (-1702.469) (-1695.292) (-1699.292) [-1694.874] * (-1703.321) [-1693.670] (-1694.522) (-1696.576) -- 0:01:36
      621000 -- (-1695.696) [-1693.906] (-1693.988) (-1698.502) * (-1694.438) [-1693.711] (-1702.381) (-1705.646) -- 0:01:35
      621500 -- (-1694.902) (-1703.859) [-1697.353] (-1695.015) * [-1695.749] (-1697.539) (-1697.634) (-1702.255) -- 0:01:35
      622000 -- [-1697.527] (-1704.460) (-1698.178) (-1693.775) * (-1692.833) (-1694.801) (-1705.278) [-1692.929] -- 0:01:35
      622500 -- (-1693.762) (-1700.298) (-1698.045) [-1692.132] * (-1693.944) [-1694.076] (-1698.024) (-1702.184) -- 0:01:35
      623000 -- [-1694.056] (-1696.304) (-1701.116) (-1704.235) * (-1694.212) [-1694.118] (-1697.940) (-1699.900) -- 0:01:35
      623500 -- [-1699.634] (-1695.152) (-1708.068) (-1696.007) * [-1700.813] (-1694.053) (-1699.336) (-1702.039) -- 0:01:35
      624000 -- (-1692.100) (-1691.179) (-1702.769) [-1692.554] * (-1695.583) (-1697.128) [-1699.282] (-1699.286) -- 0:01:35
      624500 -- (-1703.790) (-1701.382) (-1701.200) [-1694.006] * [-1694.364] (-1695.831) (-1691.230) (-1700.175) -- 0:01:35
      625000 -- [-1690.590] (-1699.618) (-1701.920) (-1697.441) * [-1699.479] (-1695.374) (-1695.147) (-1693.548) -- 0:01:34

      Average standard deviation of split frequencies: 0.016379

      625500 -- [-1701.023] (-1707.604) (-1701.805) (-1698.821) * [-1692.156] (-1705.258) (-1698.430) (-1695.930) -- 0:01:34
      626000 -- (-1693.375) [-1701.265] (-1699.130) (-1697.043) * (-1697.034) (-1696.209) (-1701.628) [-1692.571] -- 0:01:34
      626500 -- (-1699.502) (-1691.386) (-1705.514) [-1697.019] * (-1697.802) (-1695.476) [-1693.198] (-1698.456) -- 0:01:34
      627000 -- [-1695.812] (-1692.912) (-1696.875) (-1700.634) * (-1701.150) [-1699.792] (-1699.144) (-1699.068) -- 0:01:33
      627500 -- [-1695.034] (-1695.466) (-1697.176) (-1703.463) * (-1694.809) (-1701.285) [-1700.017] (-1693.029) -- 0:01:34
      628000 -- (-1694.654) (-1699.234) [-1697.575] (-1691.830) * (-1700.436) (-1696.542) (-1702.463) [-1696.271] -- 0:01:34
      628500 -- [-1695.591] (-1698.467) (-1698.073) (-1693.900) * (-1694.955) [-1699.294] (-1700.096) (-1703.235) -- 0:01:33
      629000 -- (-1698.415) [-1696.212] (-1696.390) (-1694.343) * (-1701.306) (-1700.932) (-1704.775) [-1693.713] -- 0:01:33
      629500 -- [-1696.195] (-1690.764) (-1694.994) (-1695.509) * [-1695.902] (-1697.005) (-1696.106) (-1696.585) -- 0:01:33
      630000 -- (-1694.674) (-1694.116) [-1693.391] (-1696.753) * (-1693.891) [-1697.460] (-1700.670) (-1701.607) -- 0:01:33

      Average standard deviation of split frequencies: 0.016818

      630500 -- (-1699.393) [-1695.534] (-1694.858) (-1695.406) * (-1697.584) [-1699.730] (-1695.014) (-1693.917) -- 0:01:33
      631000 -- (-1696.751) (-1703.815) (-1692.199) [-1693.662] * (-1704.519) (-1694.086) [-1696.598] (-1701.722) -- 0:01:32
      631500 -- [-1693.684] (-1700.648) (-1698.635) (-1700.816) * (-1704.598) (-1695.555) (-1699.015) [-1698.684] -- 0:01:33
      632000 -- (-1691.263) (-1697.213) [-1702.965] (-1702.099) * [-1700.437] (-1699.512) (-1698.163) (-1693.750) -- 0:01:33
      632500 -- (-1695.840) (-1699.637) (-1698.410) [-1698.531] * (-1697.864) [-1690.384] (-1702.664) (-1693.872) -- 0:01:32
      633000 -- (-1696.815) [-1694.044] (-1704.608) (-1698.018) * (-1704.202) [-1698.355] (-1702.966) (-1694.663) -- 0:01:32
      633500 -- (-1704.021) [-1698.672] (-1694.808) (-1704.430) * (-1696.341) [-1700.115] (-1701.056) (-1698.292) -- 0:01:32
      634000 -- (-1705.628) (-1702.431) [-1691.258] (-1692.987) * (-1694.184) [-1696.568] (-1704.895) (-1696.931) -- 0:01:32
      634500 -- [-1694.558] (-1708.896) (-1702.022) (-1696.702) * (-1692.842) [-1693.111] (-1698.396) (-1700.570) -- 0:01:32
      635000 -- (-1696.401) [-1694.162] (-1701.143) (-1696.123) * (-1694.602) (-1698.950) (-1699.704) [-1695.058] -- 0:01:31

      Average standard deviation of split frequencies: 0.017418

      635500 -- (-1698.254) (-1699.257) (-1695.035) [-1692.067] * [-1690.716] (-1693.675) (-1700.184) (-1698.862) -- 0:01:32
      636000 -- (-1690.935) (-1706.060) (-1696.610) [-1692.274] * (-1698.497) (-1695.914) (-1694.257) [-1698.526] -- 0:01:32
      636500 -- (-1692.179) (-1700.630) (-1697.037) [-1696.472] * (-1700.524) [-1691.381] (-1702.805) (-1701.346) -- 0:01:31
      637000 -- (-1701.038) (-1692.093) [-1699.446] (-1695.957) * [-1699.687] (-1692.957) (-1697.246) (-1704.165) -- 0:01:31
      637500 -- (-1699.790) [-1698.579] (-1695.366) (-1699.106) * (-1703.403) [-1689.903] (-1715.557) (-1702.260) -- 0:01:31
      638000 -- (-1702.024) (-1695.722) (-1696.266) [-1694.938] * (-1694.080) (-1694.047) [-1703.500] (-1706.626) -- 0:01:31
      638500 -- (-1695.921) [-1693.408] (-1701.397) (-1694.524) * [-1690.886] (-1693.207) (-1703.005) (-1696.805) -- 0:01:31
      639000 -- (-1694.050) [-1700.615] (-1699.147) (-1697.890) * (-1695.731) (-1709.056) [-1695.378] (-1701.173) -- 0:01:30
      639500 -- (-1702.775) (-1701.243) [-1695.747] (-1703.491) * (-1696.909) [-1692.140] (-1694.727) (-1695.952) -- 0:01:31
      640000 -- (-1693.644) (-1696.354) [-1693.050] (-1706.341) * [-1696.650] (-1705.889) (-1693.489) (-1703.001) -- 0:01:31

      Average standard deviation of split frequencies: 0.018763

      640500 -- (-1695.478) (-1692.518) [-1699.181] (-1702.236) * [-1697.795] (-1696.020) (-1697.413) (-1699.386) -- 0:01:30
      641000 -- [-1698.345] (-1691.692) (-1693.762) (-1701.812) * (-1698.577) (-1691.733) (-1693.643) [-1698.755] -- 0:01:30
      641500 -- (-1693.505) [-1693.507] (-1699.683) (-1696.622) * (-1702.326) (-1695.530) (-1695.178) [-1696.959] -- 0:01:30
      642000 -- [-1695.722] (-1698.547) (-1695.294) (-1696.142) * [-1706.752] (-1695.893) (-1695.179) (-1695.860) -- 0:01:30
      642500 -- (-1698.643) [-1695.953] (-1693.490) (-1699.137) * (-1700.050) [-1695.260] (-1698.196) (-1694.355) -- 0:01:30
      643000 -- (-1697.367) [-1693.542] (-1695.300) (-1693.911) * (-1701.018) (-1691.846) [-1694.434] (-1696.036) -- 0:01:29
      643500 -- (-1704.461) [-1699.783] (-1697.340) (-1695.110) * [-1702.585] (-1705.787) (-1702.558) (-1695.787) -- 0:01:30
      644000 -- (-1703.830) [-1694.345] (-1702.721) (-1694.498) * (-1696.457) [-1695.735] (-1700.406) (-1691.633) -- 0:01:30
      644500 -- (-1706.120) (-1694.902) (-1691.097) [-1696.906] * (-1697.994) [-1697.061] (-1695.733) (-1702.855) -- 0:01:29
      645000 -- (-1702.670) (-1693.692) (-1693.741) [-1699.018] * (-1700.196) [-1693.023] (-1700.879) (-1703.151) -- 0:01:29

      Average standard deviation of split frequencies: 0.018243

      645500 -- (-1693.984) (-1702.222) (-1699.055) [-1694.840] * [-1695.601] (-1691.536) (-1706.042) (-1699.873) -- 0:01:29
      646000 -- (-1702.691) (-1692.891) (-1693.827) [-1701.670] * (-1698.991) [-1699.683] (-1700.360) (-1705.391) -- 0:01:29
      646500 -- (-1696.847) (-1696.721) [-1693.725] (-1702.418) * (-1699.089) [-1696.776] (-1696.295) (-1695.780) -- 0:01:29
      647000 -- (-1702.872) [-1695.837] (-1698.260) (-1696.299) * (-1699.943) (-1704.046) [-1700.721] (-1698.178) -- 0:01:28
      647500 -- [-1701.127] (-1691.980) (-1697.150) (-1697.167) * (-1705.328) (-1704.842) (-1694.862) [-1690.952] -- 0:01:29
      648000 -- (-1700.883) (-1706.114) (-1693.487) [-1698.215] * (-1700.382) [-1693.486] (-1696.495) (-1695.101) -- 0:01:29
      648500 -- [-1698.591] (-1698.287) (-1693.757) (-1697.007) * (-1697.118) [-1702.013] (-1699.071) (-1694.666) -- 0:01:28
      649000 -- (-1691.571) (-1699.680) (-1696.688) [-1694.535] * (-1701.982) [-1693.176] (-1703.463) (-1698.025) -- 0:01:28
      649500 -- (-1696.897) (-1694.594) (-1701.973) [-1697.697] * (-1697.022) [-1699.567] (-1702.362) (-1699.312) -- 0:01:28
      650000 -- [-1696.365] (-1695.513) (-1695.417) (-1698.041) * (-1695.897) [-1696.570] (-1699.123) (-1693.513) -- 0:01:28

      Average standard deviation of split frequencies: 0.018475

      650500 -- (-1698.754) (-1692.251) (-1696.293) [-1696.444] * [-1701.547] (-1698.784) (-1700.457) (-1694.276) -- 0:01:28
      651000 -- (-1697.335) (-1705.033) (-1696.833) [-1694.036] * (-1714.689) (-1698.892) [-1699.271] (-1693.820) -- 0:01:28
      651500 -- [-1693.642] (-1700.581) (-1694.847) (-1694.756) * [-1694.147] (-1696.150) (-1694.002) (-1697.334) -- 0:01:28
      652000 -- [-1699.748] (-1689.764) (-1700.680) (-1696.199) * (-1693.270) (-1698.256) [-1695.173] (-1695.209) -- 0:01:28
      652500 -- (-1691.405) (-1697.473) (-1702.746) [-1693.445] * (-1705.280) [-1697.122] (-1697.190) (-1697.497) -- 0:01:27
      653000 -- (-1697.595) (-1703.823) [-1697.857] (-1699.214) * (-1698.424) (-1705.290) (-1702.294) [-1695.094] -- 0:01:27
      653500 -- (-1696.533) (-1700.510) (-1704.651) [-1695.058] * (-1702.169) (-1700.273) (-1702.372) [-1698.645] -- 0:01:27
      654000 -- [-1699.141] (-1695.854) (-1694.902) (-1693.664) * (-1697.770) (-1705.612) (-1698.227) [-1695.412] -- 0:01:27
      654500 -- [-1695.407] (-1701.602) (-1698.200) (-1697.389) * [-1707.229] (-1702.795) (-1699.064) (-1696.207) -- 0:01:27
      655000 -- (-1698.862) (-1698.750) (-1691.076) [-1696.632] * (-1695.747) [-1699.631] (-1696.370) (-1696.094) -- 0:01:27

      Average standard deviation of split frequencies: 0.017965

      655500 -- (-1695.563) (-1698.554) [-1695.982] (-1698.711) * [-1699.316] (-1697.157) (-1697.087) (-1700.413) -- 0:01:27
      656000 -- (-1692.814) (-1699.066) [-1693.078] (-1700.165) * [-1698.599] (-1694.261) (-1696.904) (-1701.854) -- 0:01:27
      656500 -- (-1697.110) (-1705.588) (-1697.374) [-1695.673] * [-1695.964] (-1695.136) (-1700.066) (-1694.759) -- 0:01:26
      657000 -- (-1696.562) (-1695.697) (-1693.336) [-1690.211] * (-1698.142) (-1696.482) (-1709.308) [-1694.352] -- 0:01:26
      657500 -- (-1692.801) (-1701.461) [-1697.998] (-1696.353) * (-1695.623) (-1695.706) [-1696.419] (-1700.842) -- 0:01:26
      658000 -- (-1693.564) (-1704.664) (-1692.647) [-1696.514] * (-1699.637) [-1695.662] (-1692.390) (-1699.045) -- 0:01:26
      658500 -- (-1701.069) (-1696.854) (-1700.998) [-1691.818] * (-1693.906) [-1695.641] (-1698.878) (-1713.752) -- 0:01:26
      659000 -- (-1693.411) [-1692.814] (-1701.195) (-1696.224) * (-1697.535) (-1704.222) [-1695.466] (-1701.664) -- 0:01:26
      659500 -- [-1692.571] (-1699.102) (-1698.953) (-1697.071) * (-1702.825) [-1700.258] (-1698.415) (-1703.130) -- 0:01:26
      660000 -- (-1698.907) [-1694.516] (-1695.279) (-1698.843) * [-1699.712] (-1694.885) (-1695.622) (-1698.322) -- 0:01:26

      Average standard deviation of split frequencies: 0.017660

      660500 -- [-1695.062] (-1697.940) (-1699.075) (-1694.912) * (-1693.126) (-1697.323) [-1692.617] (-1698.714) -- 0:01:25
      661000 -- (-1699.107) [-1693.701] (-1689.673) (-1695.066) * (-1701.133) (-1695.003) [-1696.366] (-1705.993) -- 0:01:25
      661500 -- (-1698.512) [-1701.950] (-1691.496) (-1701.508) * (-1698.153) [-1693.643] (-1696.581) (-1702.017) -- 0:01:25
      662000 -- (-1700.460) [-1698.149] (-1701.425) (-1694.718) * (-1698.751) [-1693.956] (-1697.206) (-1704.310) -- 0:01:25
      662500 -- (-1695.003) (-1704.838) (-1700.517) [-1697.561] * [-1695.169] (-1698.804) (-1695.990) (-1697.644) -- 0:01:25
      663000 -- (-1696.899) (-1697.023) (-1694.909) [-1692.851] * (-1694.278) [-1693.497] (-1704.985) (-1695.563) -- 0:01:25
      663500 -- [-1695.384] (-1706.475) (-1693.797) (-1696.661) * (-1701.979) [-1698.172] (-1698.630) (-1700.901) -- 0:01:25
      664000 -- (-1694.021) (-1699.677) (-1701.008) [-1695.677] * [-1698.393] (-1694.930) (-1695.996) (-1698.227) -- 0:01:25
      664500 -- (-1695.663) (-1698.516) (-1707.292) [-1691.791] * [-1695.340] (-1701.362) (-1700.648) (-1702.787) -- 0:01:24
      665000 -- (-1693.735) [-1695.538] (-1700.012) (-1693.469) * [-1695.502] (-1697.962) (-1693.439) (-1700.469) -- 0:01:24

      Average standard deviation of split frequencies: 0.015926

      665500 -- (-1690.395) (-1699.050) (-1699.391) [-1691.756] * [-1693.744] (-1707.467) (-1702.386) (-1695.370) -- 0:01:24
      666000 -- [-1692.517] (-1701.835) (-1699.836) (-1699.998) * (-1697.946) (-1708.982) (-1692.930) [-1691.941] -- 0:01:24
      666500 -- (-1691.760) [-1696.635] (-1701.241) (-1695.995) * (-1704.704) (-1696.050) [-1689.034] (-1702.114) -- 0:01:24
      667000 -- (-1700.030) (-1691.156) [-1702.785] (-1700.333) * (-1691.280) (-1699.071) [-1698.982] (-1697.481) -- 0:01:24
      667500 -- [-1698.081] (-1692.765) (-1696.002) (-1696.384) * (-1694.908) [-1692.681] (-1697.632) (-1698.345) -- 0:01:24
      668000 -- (-1695.630) (-1705.234) (-1698.857) [-1694.497] * (-1697.877) (-1696.139) [-1693.876] (-1699.167) -- 0:01:23
      668500 -- [-1697.966] (-1703.224) (-1701.183) (-1699.841) * (-1698.784) (-1695.973) (-1695.780) [-1696.772] -- 0:01:23
      669000 -- [-1696.316] (-1697.398) (-1697.933) (-1706.223) * (-1701.812) (-1700.850) (-1691.815) [-1694.140] -- 0:01:23
      669500 -- (-1696.015) (-1697.739) [-1696.118] (-1706.951) * (-1696.868) (-1703.003) [-1690.595] (-1692.520) -- 0:01:23
      670000 -- (-1696.880) (-1705.368) [-1693.313] (-1696.688) * (-1697.775) (-1702.472) (-1693.250) [-1701.501] -- 0:01:23

      Average standard deviation of split frequencies: 0.015288

      670500 -- (-1693.260) (-1698.451) (-1698.340) [-1700.079] * (-1692.933) (-1697.071) [-1694.588] (-1699.810) -- 0:01:23
      671000 -- (-1695.332) (-1696.180) [-1701.657] (-1695.178) * (-1701.024) (-1694.379) [-1693.313] (-1703.468) -- 0:01:23
      671500 -- (-1692.427) (-1706.422) [-1698.674] (-1695.485) * (-1694.347) (-1702.442) (-1696.396) [-1695.648] -- 0:01:23
      672000 -- [-1695.402] (-1707.422) (-1699.026) (-1699.920) * (-1692.691) (-1700.128) (-1696.348) [-1695.837] -- 0:01:22
      672500 -- [-1690.715] (-1699.482) (-1699.694) (-1691.419) * (-1701.769) (-1703.446) (-1695.027) [-1696.551] -- 0:01:22
      673000 -- (-1702.045) [-1694.886] (-1692.294) (-1699.570) * (-1697.316) [-1698.928] (-1697.410) (-1703.272) -- 0:01:22
      673500 -- (-1700.169) [-1693.784] (-1697.661) (-1695.184) * [-1694.391] (-1695.854) (-1691.974) (-1704.857) -- 0:01:22
      674000 -- (-1696.486) [-1697.483] (-1699.547) (-1693.026) * (-1695.717) (-1697.587) [-1690.287] (-1695.913) -- 0:01:22
      674500 -- (-1696.873) (-1693.444) (-1703.273) [-1701.495] * [-1693.577] (-1701.910) (-1702.102) (-1696.323) -- 0:01:22
      675000 -- (-1697.120) (-1700.100) [-1695.966] (-1698.069) * (-1704.958) [-1703.617] (-1691.759) (-1699.540) -- 0:01:22

      Average standard deviation of split frequencies: 0.015342

      675500 -- (-1693.255) (-1698.854) [-1695.258] (-1695.137) * [-1696.007] (-1701.698) (-1695.659) (-1698.572) -- 0:01:22
      676000 -- (-1697.174) (-1697.302) [-1692.206] (-1701.794) * (-1695.527) [-1692.591] (-1702.854) (-1700.946) -- 0:01:21
      676500 -- (-1697.224) [-1694.408] (-1693.620) (-1693.962) * (-1693.179) (-1696.558) [-1696.372] (-1700.550) -- 0:01:21
      677000 -- [-1696.290] (-1697.065) (-1697.519) (-1700.374) * (-1699.931) (-1700.618) (-1701.472) [-1695.571] -- 0:01:21
      677500 -- [-1694.457] (-1692.010) (-1706.859) (-1698.822) * (-1703.334) (-1700.348) (-1713.165) [-1693.735] -- 0:01:21
      678000 -- (-1697.174) (-1696.304) [-1696.592] (-1690.998) * (-1693.734) (-1696.672) (-1703.866) [-1694.953] -- 0:01:21
      678500 -- (-1696.642) [-1695.641] (-1696.802) (-1691.509) * (-1696.814) [-1691.961] (-1701.798) (-1696.192) -- 0:01:21
      679000 -- (-1695.193) (-1701.955) [-1697.327] (-1694.121) * (-1693.927) (-1694.462) (-1699.025) [-1696.251] -- 0:01:21
      679500 -- (-1694.337) (-1700.730) (-1697.205) [-1691.195] * (-1696.117) [-1695.898] (-1697.378) (-1698.606) -- 0:01:21
      680000 -- (-1690.432) (-1702.895) (-1699.790) [-1694.569] * (-1695.026) (-1694.196) [-1694.642] (-1694.708) -- 0:01:20

      Average standard deviation of split frequencies: 0.015756

      680500 -- (-1696.754) (-1698.249) (-1697.023) [-1696.912] * (-1696.800) [-1696.189] (-1695.856) (-1709.377) -- 0:01:20
      681000 -- (-1698.966) (-1696.855) (-1696.788) [-1697.903] * (-1695.842) [-1696.848] (-1693.041) (-1699.914) -- 0:01:20
      681500 -- (-1701.431) (-1702.943) (-1698.451) [-1697.273] * (-1693.361) [-1697.834] (-1697.054) (-1694.540) -- 0:01:20
      682000 -- (-1712.616) [-1699.076] (-1694.924) (-1694.825) * (-1697.155) (-1703.019) (-1701.690) [-1694.350] -- 0:01:20
      682500 -- (-1698.978) (-1700.292) (-1698.967) [-1690.315] * (-1698.455) [-1699.654] (-1693.684) (-1696.782) -- 0:01:20
      683000 -- (-1702.386) [-1692.601] (-1696.070) (-1696.460) * (-1697.830) (-1697.481) [-1697.319] (-1712.083) -- 0:01:20
      683500 -- (-1696.785) (-1696.075) [-1698.968] (-1694.499) * [-1694.663] (-1702.722) (-1695.648) (-1695.640) -- 0:01:20
      684000 -- [-1698.133] (-1694.316) (-1704.213) (-1700.802) * (-1694.461) [-1700.923] (-1698.088) (-1698.399) -- 0:01:19
      684500 -- [-1699.465] (-1697.203) (-1696.362) (-1701.799) * (-1694.177) (-1701.320) [-1692.776] (-1698.822) -- 0:01:19
      685000 -- (-1699.606) [-1694.439] (-1698.749) (-1702.907) * [-1696.105] (-1701.158) (-1695.661) (-1696.120) -- 0:01:19

      Average standard deviation of split frequencies: 0.014774

      685500 -- (-1697.821) (-1695.830) (-1700.670) [-1699.452] * [-1692.655] (-1705.536) (-1701.495) (-1702.357) -- 0:01:19
      686000 -- (-1695.852) (-1696.059) [-1695.297] (-1693.924) * (-1698.812) (-1697.140) (-1704.235) [-1692.109] -- 0:01:19
      686500 -- [-1696.618] (-1697.485) (-1696.078) (-1702.744) * (-1692.312) [-1694.535] (-1697.164) (-1697.743) -- 0:01:19
      687000 -- [-1691.884] (-1698.082) (-1698.268) (-1704.451) * (-1690.658) (-1697.989) (-1699.141) [-1697.216] -- 0:01:19
      687500 -- (-1697.218) [-1693.877] (-1690.701) (-1701.553) * (-1694.454) (-1692.816) [-1698.071] (-1691.782) -- 0:01:19
      688000 -- (-1694.510) [-1696.406] (-1697.486) (-1694.750) * (-1705.149) [-1694.059] (-1707.085) (-1705.093) -- 0:01:18
      688500 -- (-1695.139) (-1696.847) [-1697.397] (-1694.978) * (-1697.090) [-1691.708] (-1699.656) (-1699.092) -- 0:01:18
      689000 -- [-1691.650] (-1695.335) (-1698.026) (-1699.107) * (-1695.406) (-1696.324) (-1703.360) [-1701.727] -- 0:01:18
      689500 -- (-1691.618) [-1696.260] (-1696.356) (-1693.542) * (-1699.344) (-1695.022) [-1699.554] (-1702.208) -- 0:01:18
      690000 -- (-1695.721) [-1697.503] (-1698.097) (-1698.620) * (-1695.783) (-1697.002) (-1695.041) [-1703.438] -- 0:01:18

      Average standard deviation of split frequencies: 0.014675

      690500 -- (-1700.641) (-1705.740) [-1694.654] (-1692.857) * [-1698.829] (-1697.929) (-1696.209) (-1703.069) -- 0:01:18
      691000 -- [-1693.482] (-1692.540) (-1693.299) (-1700.861) * (-1693.585) (-1695.592) (-1698.346) [-1704.248] -- 0:01:18
      691500 -- (-1697.736) [-1696.405] (-1691.651) (-1695.724) * (-1693.094) (-1696.457) (-1700.222) [-1697.295] -- 0:01:18
      692000 -- (-1702.516) (-1694.206) (-1700.822) [-1695.196] * (-1692.892) (-1704.897) [-1706.614] (-1695.776) -- 0:01:17
      692500 -- (-1698.957) [-1690.661] (-1699.597) (-1698.244) * [-1693.079] (-1693.053) (-1692.340) (-1694.707) -- 0:01:17
      693000 -- [-1696.653] (-1703.247) (-1696.647) (-1703.791) * (-1695.889) [-1701.480] (-1702.739) (-1700.011) -- 0:01:17
      693500 -- (-1693.550) (-1695.950) (-1698.483) [-1694.072] * (-1698.629) [-1695.205] (-1693.888) (-1701.911) -- 0:01:17
      694000 -- (-1696.621) [-1696.095] (-1697.686) (-1700.631) * [-1697.306] (-1697.647) (-1698.518) (-1697.238) -- 0:01:17
      694500 -- (-1695.148) (-1702.503) (-1699.497) [-1694.229] * (-1702.713) (-1690.004) (-1694.007) [-1703.524] -- 0:01:17
      695000 -- (-1696.799) [-1698.972] (-1696.323) (-1699.814) * (-1699.487) (-1696.868) [-1692.037] (-1702.182) -- 0:01:17

      Average standard deviation of split frequencies: 0.015239

      695500 -- (-1694.126) (-1698.848) (-1694.238) [-1697.013] * [-1696.953] (-1699.102) (-1697.466) (-1693.943) -- 0:01:17
      696000 -- [-1693.935] (-1697.133) (-1697.615) (-1694.974) * [-1693.775] (-1696.197) (-1694.680) (-1695.174) -- 0:01:16
      696500 -- (-1692.099) [-1693.975] (-1692.314) (-1694.848) * (-1696.324) (-1699.329) (-1699.478) [-1693.616] -- 0:01:16
      697000 -- (-1694.236) (-1695.978) [-1694.351] (-1693.721) * (-1699.039) (-1699.603) (-1703.774) [-1696.474] -- 0:01:16
      697500 -- (-1705.766) (-1692.648) [-1698.154] (-1698.768) * (-1690.590) [-1694.514] (-1699.369) (-1702.362) -- 0:01:16
      698000 -- (-1700.849) (-1694.844) [-1694.142] (-1693.954) * (-1698.785) [-1700.147] (-1700.769) (-1695.367) -- 0:01:16
      698500 -- (-1694.634) [-1702.158] (-1696.706) (-1693.794) * [-1700.800] (-1697.565) (-1702.010) (-1693.169) -- 0:01:16
      699000 -- (-1691.971) (-1691.341) (-1700.584) [-1692.668] * (-1699.924) [-1699.632] (-1691.356) (-1695.006) -- 0:01:16
      699500 -- [-1691.708] (-1692.322) (-1694.195) (-1696.911) * (-1695.544) [-1692.750] (-1695.835) (-1697.765) -- 0:01:16
      700000 -- [-1701.125] (-1695.663) (-1692.509) (-1695.689) * (-1697.884) [-1698.819] (-1697.983) (-1704.419) -- 0:01:15

      Average standard deviation of split frequencies: 0.014297

      700500 -- (-1696.059) (-1702.354) (-1693.723) [-1701.006] * (-1697.707) (-1699.749) [-1691.917] (-1695.821) -- 0:01:15
      701000 -- (-1697.212) (-1699.592) (-1701.410) [-1696.477] * (-1695.616) (-1692.235) (-1697.814) [-1694.377] -- 0:01:15
      701500 -- [-1698.301] (-1694.291) (-1700.246) (-1694.873) * (-1698.702) (-1699.769) (-1696.871) [-1690.042] -- 0:01:15
      702000 -- (-1700.949) (-1695.105) (-1698.568) [-1695.417] * (-1701.316) (-1698.451) [-1701.973] (-1696.460) -- 0:01:15
      702500 -- (-1701.551) (-1696.400) (-1694.441) [-1697.157] * (-1699.900) (-1698.332) (-1693.281) [-1693.417] -- 0:01:15
      703000 -- (-1699.848) (-1702.691) [-1698.302] (-1695.765) * (-1697.186) (-1699.350) (-1691.179) [-1694.712] -- 0:01:15
      703500 -- [-1693.746] (-1700.511) (-1689.913) (-1699.456) * (-1706.953) (-1698.385) (-1698.290) [-1695.674] -- 0:01:15
      704000 -- [-1692.607] (-1702.823) (-1692.043) (-1693.567) * (-1698.656) (-1697.840) [-1694.010] (-1696.706) -- 0:01:14
      704500 -- (-1692.216) (-1695.203) [-1696.848] (-1697.366) * (-1696.353) (-1703.779) (-1694.819) [-1696.222] -- 0:01:14
      705000 -- [-1693.606] (-1694.558) (-1693.724) (-1696.271) * (-1696.563) (-1695.863) (-1701.784) [-1694.670] -- 0:01:14

      Average standard deviation of split frequencies: 0.014356

      705500 -- (-1699.291) [-1695.066] (-1701.924) (-1705.341) * (-1699.609) [-1697.456] (-1699.029) (-1699.380) -- 0:01:14
      706000 -- [-1696.910] (-1694.461) (-1699.194) (-1699.853) * (-1704.912) (-1700.445) [-1701.559] (-1696.611) -- 0:01:14
      706500 -- (-1692.508) [-1691.529] (-1703.184) (-1695.895) * (-1700.268) (-1699.843) [-1693.129] (-1707.025) -- 0:01:14
      707000 -- [-1698.154] (-1696.634) (-1693.583) (-1701.940) * (-1692.350) [-1692.023] (-1695.932) (-1709.559) -- 0:01:14
      707500 -- (-1696.700) (-1698.452) (-1700.363) [-1698.745] * [-1691.581] (-1694.861) (-1701.551) (-1701.208) -- 0:01:14
      708000 -- (-1694.920) (-1697.316) [-1693.719] (-1697.759) * [-1702.533] (-1696.446) (-1696.667) (-1700.575) -- 0:01:13
      708500 -- (-1696.468) (-1695.692) (-1698.856) [-1697.275] * (-1698.921) [-1697.405] (-1694.281) (-1699.620) -- 0:01:13
      709000 -- (-1691.650) [-1697.055] (-1698.040) (-1699.651) * (-1696.442) (-1696.201) [-1694.257] (-1697.223) -- 0:01:13
      709500 -- [-1698.162] (-1704.297) (-1699.121) (-1705.825) * (-1696.531) (-1693.132) [-1693.483] (-1696.016) -- 0:01:13
      710000 -- [-1692.631] (-1701.991) (-1694.803) (-1704.123) * [-1692.432] (-1701.111) (-1694.215) (-1696.677) -- 0:01:13

      Average standard deviation of split frequencies: 0.015091

      710500 -- (-1697.239) (-1700.273) (-1696.388) [-1691.968] * (-1701.806) [-1695.972] (-1693.333) (-1693.610) -- 0:01:13
      711000 -- [-1696.360] (-1702.667) (-1695.535) (-1694.244) * (-1696.850) (-1699.058) (-1695.924) [-1689.890] -- 0:01:13
      711500 -- [-1694.741] (-1704.466) (-1692.521) (-1699.913) * (-1702.922) (-1703.440) (-1696.217) [-1692.872] -- 0:01:12
      712000 -- (-1697.574) (-1698.113) (-1692.878) [-1695.910] * [-1697.833] (-1693.847) (-1700.416) (-1695.366) -- 0:01:12
      712500 -- [-1697.679] (-1699.099) (-1699.228) (-1698.716) * (-1703.020) (-1694.534) [-1695.284] (-1703.687) -- 0:01:12
      713000 -- [-1697.715] (-1696.663) (-1696.568) (-1707.911) * [-1694.512] (-1691.839) (-1696.264) (-1696.758) -- 0:01:12
      713500 -- [-1694.227] (-1696.707) (-1694.436) (-1701.612) * (-1698.925) (-1695.598) [-1697.285] (-1697.042) -- 0:01:12
      714000 -- [-1696.677] (-1699.161) (-1693.111) (-1693.855) * [-1692.736] (-1697.657) (-1694.736) (-1701.737) -- 0:01:12
      714500 -- (-1695.204) (-1696.986) [-1697.530] (-1701.259) * [-1697.512] (-1697.110) (-1699.567) (-1704.273) -- 0:01:12
      715000 -- (-1697.722) (-1697.442) [-1693.947] (-1695.942) * [-1696.672] (-1703.739) (-1693.311) (-1711.240) -- 0:01:12

      Average standard deviation of split frequencies: 0.014484

      715500 -- (-1692.504) (-1698.304) (-1692.437) [-1696.781] * (-1703.271) (-1694.172) (-1689.160) [-1701.054] -- 0:01:11
      716000 -- [-1696.250] (-1702.671) (-1692.181) (-1703.663) * (-1695.687) (-1699.037) [-1692.956] (-1696.111) -- 0:01:11
      716500 -- [-1695.976] (-1698.081) (-1700.203) (-1695.417) * (-1697.221) (-1706.104) (-1696.380) [-1691.285] -- 0:01:11
      717000 -- (-1699.428) (-1698.518) (-1701.129) [-1698.848] * (-1694.478) [-1693.819] (-1700.419) (-1704.330) -- 0:01:11
      717500 -- (-1705.682) (-1692.142) (-1694.062) [-1698.138] * (-1700.181) (-1700.879) (-1706.846) [-1694.850] -- 0:01:11
      718000 -- (-1703.839) [-1692.943] (-1693.536) (-1697.409) * (-1703.755) [-1700.689] (-1698.812) (-1697.017) -- 0:01:11
      718500 -- (-1701.330) (-1699.389) (-1693.095) [-1691.132] * [-1693.085] (-1695.886) (-1693.932) (-1691.780) -- 0:01:11
      719000 -- (-1697.235) (-1703.637) [-1698.947] (-1698.153) * (-1694.658) (-1689.203) (-1692.627) [-1703.565] -- 0:01:11
      719500 -- (-1697.683) (-1695.017) (-1714.739) [-1695.339] * (-1697.618) [-1697.899] (-1695.751) (-1693.469) -- 0:01:10
      720000 -- [-1697.867] (-1697.624) (-1699.513) (-1699.263) * (-1704.363) (-1701.934) [-1694.355] (-1694.033) -- 0:01:10

      Average standard deviation of split frequencies: 0.015208

      720500 -- [-1696.726] (-1694.206) (-1697.052) (-1697.515) * [-1694.861] (-1695.403) (-1699.626) (-1699.249) -- 0:01:10
      721000 -- (-1696.859) (-1699.576) (-1702.754) [-1692.716] * (-1698.040) [-1691.839] (-1696.144) (-1696.338) -- 0:01:10
      721500 -- (-1696.724) [-1698.456] (-1696.097) (-1694.944) * [-1695.853] (-1701.455) (-1695.823) (-1695.613) -- 0:01:10
      722000 -- (-1697.139) [-1697.575] (-1696.045) (-1699.315) * (-1694.719) (-1697.839) (-1701.141) [-1700.296] -- 0:01:10
      722500 -- [-1695.237] (-1700.317) (-1698.655) (-1695.596) * [-1692.517] (-1696.701) (-1698.916) (-1702.840) -- 0:01:10
      723000 -- [-1694.761] (-1694.668) (-1695.231) (-1697.527) * (-1694.149) (-1694.817) [-1694.996] (-1700.980) -- 0:01:10
      723500 -- (-1695.908) (-1694.541) (-1701.951) [-1697.082] * [-1695.001] (-1695.301) (-1699.754) (-1701.707) -- 0:01:09
      724000 -- (-1697.583) (-1696.514) [-1697.605] (-1698.450) * (-1694.765) [-1694.366] (-1698.109) (-1696.291) -- 0:01:09
      724500 -- (-1696.764) (-1695.057) [-1694.913] (-1695.565) * (-1697.716) [-1698.505] (-1701.614) (-1704.957) -- 0:01:09
      725000 -- (-1695.260) [-1692.256] (-1697.092) (-1697.008) * (-1702.288) (-1701.231) [-1699.736] (-1701.789) -- 0:01:09

      Average standard deviation of split frequencies: 0.015421

      725500 -- (-1694.084) [-1691.489] (-1693.870) (-1697.149) * (-1695.533) [-1698.250] (-1695.707) (-1708.319) -- 0:01:09
      726000 -- (-1699.695) (-1692.142) [-1694.350] (-1702.242) * (-1702.336) [-1694.679] (-1698.880) (-1708.554) -- 0:01:09
      726500 -- (-1698.500) (-1697.123) (-1697.227) [-1698.238] * (-1703.827) (-1706.543) [-1693.817] (-1700.965) -- 0:01:09
      727000 -- (-1691.206) (-1696.762) [-1692.712] (-1697.518) * (-1703.745) (-1704.830) [-1699.527] (-1691.182) -- 0:01:09
      727500 -- (-1698.422) (-1696.329) [-1694.553] (-1701.492) * [-1695.349] (-1702.047) (-1698.675) (-1692.951) -- 0:01:08
      728000 -- [-1692.034] (-1698.057) (-1698.615) (-1694.802) * [-1697.002] (-1698.760) (-1692.495) (-1694.323) -- 0:01:08
      728500 -- [-1698.061] (-1694.553) (-1693.930) (-1697.858) * (-1695.626) (-1694.419) [-1696.456] (-1696.709) -- 0:01:08
      729000 -- (-1696.592) (-1693.311) [-1697.795] (-1703.972) * (-1690.963) [-1693.685] (-1695.343) (-1690.515) -- 0:01:08
      729500 -- [-1697.953] (-1694.857) (-1691.063) (-1699.783) * (-1699.945) [-1696.124] (-1698.329) (-1700.049) -- 0:01:08
      730000 -- [-1701.259] (-1701.695) (-1697.168) (-1702.809) * (-1696.239) [-1694.941] (-1691.084) (-1699.904) -- 0:01:08

      Average standard deviation of split frequencies: 0.017581

      730500 -- [-1692.664] (-1694.330) (-1702.455) (-1698.296) * (-1697.405) [-1698.880] (-1692.823) (-1692.834) -- 0:01:08
      731000 -- [-1693.297] (-1700.344) (-1698.296) (-1693.684) * [-1691.936] (-1700.911) (-1697.927) (-1693.783) -- 0:01:08
      731500 -- [-1695.736] (-1693.484) (-1695.054) (-1696.336) * (-1693.507) (-1696.103) (-1693.125) [-1693.562] -- 0:01:07
      732000 -- (-1694.624) (-1694.570) [-1700.581] (-1694.288) * (-1696.472) [-1701.380] (-1700.314) (-1697.907) -- 0:01:07
      732500 -- [-1695.993] (-1695.837) (-1698.268) (-1699.561) * (-1701.404) (-1698.319) (-1695.638) [-1697.912] -- 0:01:07
      733000 -- (-1696.534) (-1700.466) (-1693.812) [-1701.746] * (-1696.324) (-1696.366) (-1696.313) [-1699.074] -- 0:01:07
      733500 -- [-1696.332] (-1697.356) (-1689.759) (-1702.918) * (-1701.102) [-1700.820] (-1692.813) (-1698.605) -- 0:01:07
      734000 -- (-1691.808) (-1695.253) [-1696.415] (-1702.769) * (-1707.853) (-1695.782) [-1694.733] (-1697.267) -- 0:01:07
      734500 -- (-1696.665) (-1702.129) (-1698.002) [-1705.718] * (-1703.791) (-1695.654) [-1696.833] (-1695.832) -- 0:01:07
      735000 -- (-1697.113) (-1703.673) (-1692.874) [-1702.950] * [-1696.596] (-1698.007) (-1693.479) (-1700.162) -- 0:01:07

      Average standard deviation of split frequencies: 0.017774

      735500 -- (-1698.774) (-1694.709) (-1693.571) [-1700.454] * (-1694.816) [-1694.086] (-1701.774) (-1700.541) -- 0:01:06
      736000 -- (-1708.427) (-1699.053) (-1694.193) [-1693.325] * (-1700.868) [-1698.931] (-1697.916) (-1695.786) -- 0:01:06
      736500 -- (-1696.072) (-1698.625) [-1691.439] (-1700.058) * (-1697.123) (-1697.081) [-1704.177] (-1692.546) -- 0:01:06
      737000 -- (-1695.792) (-1700.877) (-1694.717) [-1695.603] * (-1695.688) [-1694.716] (-1704.361) (-1693.266) -- 0:01:06
      737500 -- (-1696.364) [-1693.897] (-1694.074) (-1698.484) * (-1691.933) (-1695.782) (-1699.371) [-1694.044] -- 0:01:06
      738000 -- [-1701.231] (-1691.119) (-1694.006) (-1700.274) * (-1695.732) (-1698.389) [-1695.840] (-1694.457) -- 0:01:06
      738500 -- (-1692.647) (-1697.489) [-1694.250] (-1699.720) * [-1693.690] (-1708.854) (-1706.881) (-1701.647) -- 0:01:06
      739000 -- (-1698.685) (-1698.159) [-1699.020] (-1696.577) * (-1691.996) [-1698.486] (-1704.739) (-1699.720) -- 0:01:06
      739500 -- (-1693.954) (-1696.430) (-1695.568) [-1692.346] * [-1698.853] (-1699.652) (-1695.509) (-1701.241) -- 0:01:05
      740000 -- (-1697.209) [-1696.977] (-1700.675) (-1692.785) * (-1691.828) [-1698.004] (-1699.938) (-1700.347) -- 0:01:05

      Average standard deviation of split frequencies: 0.017662

      740500 -- (-1698.892) (-1696.443) [-1696.379] (-1702.213) * [-1691.112] (-1697.216) (-1697.184) (-1697.202) -- 0:01:05
      741000 -- [-1698.279] (-1699.636) (-1695.922) (-1697.248) * (-1694.327) (-1703.122) [-1697.958] (-1708.800) -- 0:01:05
      741500 -- (-1696.888) (-1694.777) [-1694.000] (-1706.336) * (-1705.070) [-1693.592] (-1696.631) (-1702.223) -- 0:01:05
      742000 -- [-1695.694] (-1700.246) (-1699.118) (-1695.779) * (-1701.995) (-1698.057) (-1698.339) [-1704.112] -- 0:01:05
      742500 -- (-1702.495) (-1702.988) (-1707.028) [-1695.778] * (-1698.218) (-1705.834) [-1696.193] (-1704.884) -- 0:01:05
      743000 -- (-1696.996) [-1693.260] (-1701.034) (-1692.118) * (-1698.805) [-1697.667] (-1694.196) (-1699.415) -- 0:01:05
      743500 -- (-1696.789) (-1696.987) (-1695.658) [-1699.133] * (-1693.050) (-1701.604) [-1694.149] (-1695.156) -- 0:01:04
      744000 -- [-1693.162] (-1694.978) (-1696.438) (-1695.442) * (-1690.815) (-1709.728) (-1692.662) [-1690.967] -- 0:01:04
      744500 -- [-1694.940] (-1697.799) (-1692.494) (-1694.860) * (-1703.541) [-1700.181] (-1695.110) (-1694.698) -- 0:01:04
      745000 -- (-1696.348) [-1693.548] (-1701.345) (-1705.166) * (-1697.880) (-1699.496) (-1693.748) [-1697.380] -- 0:01:04

      Average standard deviation of split frequencies: 0.016588

      745500 -- (-1694.261) [-1697.055] (-1698.910) (-1709.917) * [-1696.855] (-1698.180) (-1696.745) (-1695.672) -- 0:01:04
      746000 -- (-1697.167) [-1694.627] (-1697.150) (-1703.225) * [-1693.001] (-1696.896) (-1696.502) (-1697.917) -- 0:01:04
      746500 -- (-1698.344) (-1697.766) (-1697.441) [-1701.419] * [-1694.593] (-1700.948) (-1693.528) (-1699.393) -- 0:01:04
      747000 -- (-1696.151) (-1703.023) (-1698.327) [-1697.193] * (-1694.730) (-1697.205) [-1695.452] (-1695.568) -- 0:01:04
      747500 -- (-1692.691) (-1704.792) [-1696.069] (-1696.079) * (-1702.152) (-1700.021) [-1694.144] (-1690.510) -- 0:01:03
      748000 -- [-1703.609] (-1695.874) (-1697.391) (-1700.071) * [-1695.189] (-1694.347) (-1698.898) (-1693.019) -- 0:01:03
      748500 -- (-1708.170) [-1698.461] (-1698.402) (-1695.886) * (-1692.191) [-1696.081] (-1703.428) (-1695.869) -- 0:01:03
      749000 -- (-1706.198) (-1701.219) [-1699.482] (-1695.286) * (-1698.268) (-1695.852) (-1697.094) [-1703.507] -- 0:01:03
      749500 -- [-1697.047] (-1700.132) (-1700.588) (-1697.272) * (-1703.205) [-1691.662] (-1701.728) (-1693.935) -- 0:01:03
      750000 -- (-1699.104) (-1694.712) (-1699.930) [-1695.445] * (-1699.185) (-1693.474) (-1698.253) [-1700.990] -- 0:01:03

      Average standard deviation of split frequencies: 0.016328

      750500 -- (-1703.713) (-1702.673) (-1699.095) [-1692.955] * (-1699.694) [-1695.507] (-1700.457) (-1700.636) -- 0:01:03
      751000 -- (-1694.322) (-1693.848) (-1704.367) [-1693.968] * (-1700.316) (-1695.262) [-1702.202] (-1700.859) -- 0:01:02
      751500 -- (-1695.802) [-1696.317] (-1695.204) (-1696.952) * (-1692.768) (-1694.190) (-1699.078) [-1702.482] -- 0:01:02
      752000 -- (-1701.609) [-1693.802] (-1695.741) (-1701.735) * [-1694.734] (-1697.598) (-1698.761) (-1698.584) -- 0:01:02
      752500 -- (-1692.309) [-1691.403] (-1699.190) (-1700.466) * (-1702.875) [-1693.360] (-1695.311) (-1692.217) -- 0:01:02
      753000 -- (-1692.452) (-1697.286) (-1700.610) [-1695.657] * (-1699.668) [-1693.196] (-1698.211) (-1701.339) -- 0:01:02
      753500 -- (-1690.200) (-1693.170) [-1695.093] (-1694.493) * [-1694.205] (-1694.664) (-1701.960) (-1699.743) -- 0:01:02
      754000 -- (-1697.098) (-1696.939) [-1691.678] (-1698.741) * (-1694.156) [-1698.393] (-1693.883) (-1701.522) -- 0:01:02
      754500 -- [-1700.524] (-1701.616) (-1693.690) (-1699.485) * [-1696.011] (-1697.686) (-1699.536) (-1701.044) -- 0:01:02
      755000 -- (-1700.650) (-1700.007) (-1702.941) [-1697.116] * (-1698.758) (-1699.037) [-1696.100] (-1696.091) -- 0:01:01

      Average standard deviation of split frequencies: 0.015745

      755500 -- (-1707.619) (-1695.297) [-1698.793] (-1697.291) * [-1698.431] (-1694.216) (-1699.104) (-1703.239) -- 0:01:01
      756000 -- (-1705.832) [-1703.707] (-1696.203) (-1695.304) * [-1697.114] (-1697.356) (-1691.098) (-1698.354) -- 0:01:01
      756500 -- (-1702.743) (-1706.515) [-1697.279] (-1693.724) * (-1693.595) (-1698.204) [-1695.963] (-1695.425) -- 0:01:01
      757000 -- (-1697.610) [-1693.117] (-1702.428) (-1697.116) * [-1699.711] (-1691.872) (-1698.714) (-1696.894) -- 0:01:01
      757500 -- (-1693.105) (-1699.146) [-1700.951] (-1693.854) * (-1698.317) (-1692.446) [-1693.096] (-1696.554) -- 0:01:01
      758000 -- (-1695.029) (-1702.046) (-1699.728) [-1691.311] * [-1696.223] (-1691.296) (-1699.999) (-1694.678) -- 0:01:01
      758500 -- (-1700.034) (-1696.895) (-1694.738) [-1696.065] * (-1696.661) (-1696.783) (-1699.134) [-1699.218] -- 0:01:01
      759000 -- [-1697.777] (-1696.363) (-1700.714) (-1697.422) * [-1697.373] (-1695.078) (-1699.652) (-1695.051) -- 0:01:00
      759500 -- (-1697.291) (-1693.747) (-1699.241) [-1693.446] * (-1691.813) (-1696.431) (-1708.755) [-1694.883] -- 0:01:00
      760000 -- (-1695.941) [-1693.514] (-1697.692) (-1696.956) * (-1694.785) [-1698.131] (-1696.508) (-1692.465) -- 0:01:00

      Average standard deviation of split frequencies: 0.015648

      760500 -- (-1698.011) (-1692.101) (-1692.842) [-1702.100] * (-1701.343) (-1693.118) (-1699.397) [-1698.107] -- 0:01:00
      761000 -- (-1699.513) [-1700.577] (-1697.609) (-1700.830) * (-1697.560) (-1698.141) (-1698.733) [-1695.869] -- 0:01:00
      761500 -- (-1697.161) (-1699.760) (-1694.150) [-1698.266] * (-1695.556) [-1701.453] (-1699.581) (-1695.702) -- 0:01:00
      762000 -- (-1704.489) (-1700.803) (-1698.172) [-1696.682] * [-1700.032] (-1696.233) (-1702.885) (-1697.497) -- 0:01:00
      762500 -- (-1699.142) (-1696.860) [-1699.588] (-1695.328) * [-1691.727] (-1697.626) (-1694.372) (-1707.154) -- 0:01:00
      763000 -- (-1697.879) (-1699.252) [-1693.662] (-1703.332) * [-1701.122] (-1708.532) (-1699.246) (-1703.939) -- 0:00:59
      763500 -- (-1696.935) (-1698.341) (-1701.966) [-1698.629] * (-1698.586) (-1699.196) (-1698.340) [-1694.005] -- 0:00:59
      764000 -- [-1693.590] (-1699.233) (-1699.935) (-1701.634) * [-1693.573] (-1695.648) (-1695.072) (-1695.856) -- 0:00:59
      764500 -- [-1691.485] (-1696.608) (-1697.399) (-1697.353) * (-1696.745) (-1706.876) [-1695.621] (-1700.759) -- 0:00:59
      765000 -- (-1693.569) (-1693.959) (-1694.940) [-1694.074] * (-1700.045) (-1703.003) (-1697.214) [-1693.123] -- 0:00:59

      Average standard deviation of split frequencies: 0.015231

      765500 -- (-1698.926) (-1697.788) [-1688.633] (-1696.796) * [-1695.149] (-1695.841) (-1695.736) (-1698.526) -- 0:00:59
      766000 -- [-1694.814] (-1696.922) (-1691.720) (-1690.338) * (-1698.725) (-1697.635) [-1693.980] (-1710.577) -- 0:00:59
      766500 -- (-1697.071) (-1695.005) (-1697.307) [-1696.661] * (-1697.819) (-1697.331) [-1702.706] (-1703.668) -- 0:00:59
      767000 -- [-1692.988] (-1697.431) (-1706.120) (-1701.634) * (-1697.092) (-1698.856) (-1696.024) [-1693.171] -- 0:00:58
      767500 -- (-1694.445) (-1700.859) [-1695.294] (-1697.640) * (-1696.739) (-1696.362) (-1690.040) [-1694.493] -- 0:00:58
      768000 -- (-1696.256) [-1695.407] (-1695.243) (-1698.663) * (-1702.114) (-1702.416) (-1695.420) [-1693.219] -- 0:00:58
      768500 -- (-1702.979) (-1693.085) [-1691.951] (-1702.375) * (-1700.171) (-1702.635) (-1702.810) [-1692.568] -- 0:00:58
      769000 -- (-1702.769) [-1693.797] (-1693.964) (-1699.115) * (-1708.831) (-1698.811) (-1692.573) [-1693.083] -- 0:00:58
      769500 -- (-1696.598) [-1699.390] (-1693.406) (-1696.108) * (-1701.385) (-1698.124) [-1696.375] (-1703.079) -- 0:00:58
      770000 -- (-1698.890) (-1699.776) [-1690.686] (-1699.068) * (-1712.469) (-1698.722) [-1697.433] (-1694.680) -- 0:00:58

      Average standard deviation of split frequencies: 0.014986

      770500 -- (-1701.559) (-1709.897) [-1696.649] (-1701.612) * (-1708.861) (-1698.036) [-1691.209] (-1698.557) -- 0:00:58
      771000 -- [-1697.031] (-1703.655) (-1694.336) (-1699.628) * (-1697.233) (-1689.840) (-1695.529) [-1703.278] -- 0:00:57
      771500 -- (-1696.143) (-1705.792) (-1691.063) [-1700.135] * (-1699.131) [-1696.332] (-1692.305) (-1696.816) -- 0:00:57
      772000 -- [-1695.762] (-1704.305) (-1696.080) (-1691.371) * (-1693.143) (-1699.325) [-1694.083] (-1693.272) -- 0:00:57
      772500 -- (-1706.955) (-1703.718) [-1691.866] (-1697.161) * [-1693.223] (-1693.812) (-1694.084) (-1693.162) -- 0:00:57
      773000 -- (-1699.587) (-1694.950) [-1699.761] (-1689.713) * (-1691.989) (-1697.494) [-1697.050] (-1700.960) -- 0:00:57
      773500 -- (-1695.714) (-1697.199) [-1696.193] (-1700.473) * (-1695.519) (-1695.451) (-1693.166) [-1691.473] -- 0:00:57
      774000 -- (-1696.207) [-1694.012] (-1693.142) (-1694.934) * [-1693.213] (-1697.539) (-1697.409) (-1692.797) -- 0:00:57
      774500 -- [-1697.155] (-1697.029) (-1697.702) (-1698.435) * [-1692.979] (-1692.717) (-1691.684) (-1699.626) -- 0:00:57
      775000 -- (-1698.532) [-1693.542] (-1694.335) (-1696.512) * (-1695.948) [-1697.043] (-1700.598) (-1695.858) -- 0:00:56

      Average standard deviation of split frequencies: 0.015187

      775500 -- (-1693.215) [-1702.930] (-1702.952) (-1698.788) * [-1698.260] (-1696.799) (-1699.797) (-1705.654) -- 0:00:56
      776000 -- (-1692.283) [-1697.767] (-1698.876) (-1698.468) * (-1698.247) (-1696.653) [-1697.068] (-1696.430) -- 0:00:56
      776500 -- (-1692.789) (-1693.019) (-1696.175) [-1697.627] * [-1697.234] (-1693.647) (-1702.062) (-1698.799) -- 0:00:56
      777000 -- (-1698.574) (-1700.331) [-1701.210] (-1698.824) * (-1698.220) (-1699.847) (-1694.312) [-1697.516] -- 0:00:56
      777500 -- [-1695.392] (-1693.416) (-1701.873) (-1696.595) * (-1700.489) (-1702.827) (-1699.161) [-1695.266] -- 0:00:56
      778000 -- (-1695.637) (-1699.298) (-1696.628) [-1695.622] * (-1704.182) (-1700.317) [-1701.853] (-1700.034) -- 0:00:56
      778500 -- (-1707.667) (-1689.363) [-1699.602] (-1695.875) * (-1696.370) (-1703.235) [-1698.216] (-1696.970) -- 0:00:56
      779000 -- (-1696.559) (-1696.162) (-1699.824) [-1698.813] * [-1697.607] (-1697.013) (-1695.652) (-1695.772) -- 0:00:55
      779500 -- (-1703.393) (-1690.299) (-1696.697) [-1700.613] * (-1697.268) (-1697.134) [-1698.861] (-1692.806) -- 0:00:55
      780000 -- (-1698.732) (-1697.860) [-1698.363] (-1699.222) * (-1700.221) (-1702.573) [-1694.458] (-1696.252) -- 0:00:55

      Average standard deviation of split frequencies: 0.014039

      780500 -- [-1699.835] (-1691.713) (-1698.275) (-1693.023) * [-1697.541] (-1700.475) (-1696.291) (-1704.591) -- 0:00:55
      781000 -- (-1704.558) [-1692.988] (-1707.431) (-1698.620) * [-1695.415] (-1697.559) (-1696.401) (-1699.829) -- 0:00:55
      781500 -- (-1696.340) (-1697.687) (-1700.634) [-1702.867] * (-1697.120) (-1696.108) (-1691.853) [-1697.893] -- 0:00:55
      782000 -- (-1691.974) [-1692.274] (-1701.896) (-1704.527) * (-1697.621) [-1696.846] (-1698.215) (-1700.632) -- 0:00:55
      782500 -- (-1695.967) (-1695.325) (-1697.380) [-1696.907] * (-1697.092) (-1701.732) (-1693.959) [-1690.116] -- 0:00:55
      783000 -- [-1703.565] (-1694.224) (-1696.138) (-1694.656) * (-1699.771) (-1702.005) [-1690.144] (-1695.955) -- 0:00:54
      783500 -- (-1704.234) (-1698.522) [-1696.606] (-1695.692) * (-1694.244) (-1696.321) (-1694.843) [-1697.935] -- 0:00:54
      784000 -- (-1701.070) (-1705.264) (-1697.991) [-1695.811] * (-1691.891) [-1690.888] (-1690.659) (-1694.405) -- 0:00:54
      784500 -- (-1705.930) (-1697.620) [-1694.459] (-1693.201) * (-1700.542) (-1693.227) [-1697.559] (-1701.849) -- 0:00:54
      785000 -- (-1699.885) [-1695.511] (-1699.314) (-1693.604) * (-1697.159) (-1693.533) [-1693.094] (-1699.388) -- 0:00:54

      Average standard deviation of split frequencies: 0.014694

      785500 -- (-1704.428) (-1696.367) (-1695.619) [-1696.873] * [-1691.561] (-1697.237) (-1698.094) (-1702.719) -- 0:00:54
      786000 -- (-1699.003) [-1698.632] (-1694.786) (-1697.880) * (-1703.789) (-1695.835) [-1694.533] (-1696.559) -- 0:00:54
      786500 -- [-1701.955] (-1692.668) (-1699.660) (-1696.186) * [-1693.009] (-1701.125) (-1696.835) (-1695.264) -- 0:00:54
      787000 -- (-1695.759) (-1697.365) (-1697.386) [-1710.667] * (-1695.816) (-1700.528) [-1694.239] (-1696.023) -- 0:00:53
      787500 -- [-1690.988] (-1701.924) (-1694.235) (-1704.479) * (-1694.213) (-1702.417) [-1701.461] (-1694.211) -- 0:00:53
      788000 -- [-1695.059] (-1692.645) (-1698.038) (-1707.256) * (-1694.895) (-1704.489) [-1694.540] (-1696.969) -- 0:00:53
      788500 -- (-1694.143) (-1701.928) [-1694.996] (-1696.520) * (-1696.534) [-1699.562] (-1693.453) (-1696.423) -- 0:00:53
      789000 -- [-1702.712] (-1697.223) (-1707.215) (-1699.669) * [-1702.387] (-1696.047) (-1694.570) (-1694.198) -- 0:00:53
      789500 -- (-1697.241) [-1695.988] (-1697.306) (-1695.670) * (-1697.802) [-1694.348] (-1693.704) (-1700.414) -- 0:00:53
      790000 -- (-1697.268) (-1701.892) [-1699.112] (-1696.244) * (-1699.027) (-1695.595) [-1695.108] (-1696.900) -- 0:00:53

      Average standard deviation of split frequencies: 0.013713

      790500 -- (-1702.139) [-1698.859] (-1693.054) (-1693.661) * (-1697.442) (-1693.912) [-1694.990] (-1699.414) -- 0:00:53
      791000 -- (-1692.960) [-1701.787] (-1698.193) (-1705.408) * [-1696.951] (-1699.841) (-1691.692) (-1697.472) -- 0:00:52
      791500 -- (-1693.969) (-1696.723) (-1697.389) [-1697.048] * [-1691.068] (-1692.978) (-1698.523) (-1698.743) -- 0:00:52
      792000 -- [-1690.734] (-1704.401) (-1692.234) (-1696.494) * (-1695.198) [-1695.524] (-1699.887) (-1693.820) -- 0:00:52
      792500 -- (-1695.098) (-1699.338) (-1692.818) [-1700.054] * [-1699.958] (-1695.252) (-1701.777) (-1697.021) -- 0:00:52
      793000 -- [-1694.078] (-1701.495) (-1700.755) (-1704.865) * (-1693.690) [-1694.941] (-1699.466) (-1700.242) -- 0:00:52
      793500 -- (-1692.234) (-1699.358) [-1693.393] (-1699.622) * (-1691.866) [-1699.193] (-1702.608) (-1694.802) -- 0:00:52
      794000 -- [-1696.863] (-1707.139) (-1698.869) (-1697.181) * (-1695.216) (-1692.877) [-1701.585] (-1697.983) -- 0:00:52
      794500 -- (-1696.914) (-1701.238) [-1693.519] (-1697.580) * (-1695.650) [-1693.801] (-1698.953) (-1694.303) -- 0:00:51
      795000 -- (-1700.366) (-1701.931) [-1697.805] (-1706.333) * (-1704.453) (-1699.640) [-1699.464] (-1694.640) -- 0:00:51

      Average standard deviation of split frequencies: 0.013621

      795500 -- [-1699.272] (-1697.621) (-1696.674) (-1701.825) * [-1696.253] (-1697.810) (-1699.078) (-1690.663) -- 0:00:51
      796000 -- (-1700.533) (-1701.926) (-1693.941) [-1699.859] * (-1696.479) [-1696.168] (-1701.807) (-1690.587) -- 0:00:51
      796500 -- [-1703.153] (-1702.984) (-1698.613) (-1695.758) * [-1694.646] (-1695.121) (-1700.630) (-1692.050) -- 0:00:51
      797000 -- [-1697.164] (-1695.651) (-1699.533) (-1698.044) * (-1697.434) [-1691.480] (-1693.754) (-1695.328) -- 0:00:51
      797500 -- [-1691.768] (-1700.713) (-1700.948) (-1697.332) * (-1697.263) (-1702.986) (-1695.317) [-1700.331] -- 0:00:51
      798000 -- (-1692.648) (-1704.590) (-1698.483) [-1692.710] * [-1694.094] (-1699.289) (-1697.929) (-1693.457) -- 0:00:51
      798500 -- [-1700.572] (-1704.037) (-1697.390) (-1695.377) * [-1698.801] (-1697.366) (-1697.946) (-1697.569) -- 0:00:50
      799000 -- (-1699.664) [-1696.150] (-1696.902) (-1696.924) * (-1700.033) [-1692.396] (-1700.268) (-1696.733) -- 0:00:50
      799500 -- (-1700.699) [-1696.491] (-1692.338) (-1693.262) * (-1696.168) (-1696.623) (-1702.462) [-1698.247] -- 0:00:50
      800000 -- (-1701.081) [-1703.885] (-1693.439) (-1703.936) * [-1697.722] (-1695.397) (-1693.289) (-1697.903) -- 0:00:50

      Average standard deviation of split frequencies: 0.014572

      800500 -- (-1697.671) (-1701.425) [-1696.102] (-1692.104) * (-1703.674) [-1692.209] (-1699.523) (-1701.978) -- 0:00:50
      801000 -- (-1704.554) [-1693.426] (-1696.168) (-1697.900) * (-1701.138) [-1700.810] (-1699.450) (-1694.248) -- 0:00:50
      801500 -- (-1703.809) [-1700.799] (-1699.048) (-1691.433) * [-1695.690] (-1707.924) (-1705.369) (-1695.821) -- 0:00:50
      802000 -- (-1699.855) [-1692.911] (-1693.521) (-1697.065) * [-1695.702] (-1698.099) (-1699.763) (-1703.964) -- 0:00:50
      802500 -- [-1690.204] (-1694.140) (-1696.823) (-1698.814) * (-1691.860) (-1702.805) [-1695.498] (-1697.832) -- 0:00:49
      803000 -- (-1699.359) (-1702.378) (-1703.376) [-1696.506] * (-1696.463) (-1700.462) [-1695.731] (-1706.351) -- 0:00:49
      803500 -- (-1691.489) (-1696.551) (-1695.154) [-1700.399] * (-1702.811) [-1693.266] (-1696.189) (-1705.150) -- 0:00:49
      804000 -- (-1697.171) (-1697.592) [-1691.946] (-1700.584) * (-1696.248) [-1695.158] (-1701.460) (-1695.163) -- 0:00:49
      804500 -- (-1705.846) (-1696.975) (-1691.337) [-1692.026] * (-1699.755) [-1697.917] (-1698.361) (-1694.541) -- 0:00:49
      805000 -- (-1702.859) [-1698.172] (-1699.215) (-1697.881) * (-1704.566) [-1696.450] (-1698.402) (-1697.306) -- 0:00:49

      Average standard deviation of split frequencies: 0.013891

      805500 -- [-1698.346] (-1694.719) (-1699.037) (-1701.664) * (-1699.380) (-1698.541) [-1701.484] (-1695.442) -- 0:00:49
      806000 -- (-1703.110) [-1694.845] (-1701.170) (-1694.377) * [-1698.497] (-1691.547) (-1699.149) (-1694.378) -- 0:00:49
      806500 -- (-1699.048) [-1690.642] (-1700.430) (-1696.850) * (-1697.133) (-1703.020) [-1693.146] (-1702.661) -- 0:00:48
      807000 -- (-1694.921) (-1697.659) [-1692.501] (-1694.189) * (-1699.804) (-1693.888) [-1699.509] (-1705.262) -- 0:00:48
      807500 -- (-1695.378) [-1697.330] (-1697.069) (-1696.528) * (-1696.837) (-1698.043) [-1692.869] (-1698.993) -- 0:00:48
      808000 -- [-1695.408] (-1696.588) (-1702.150) (-1697.866) * (-1702.217) [-1706.074] (-1699.827) (-1708.198) -- 0:00:48
      808500 -- [-1697.148] (-1698.898) (-1705.547) (-1695.438) * (-1696.483) (-1695.054) [-1694.074] (-1697.541) -- 0:00:48
      809000 -- (-1700.706) (-1696.159) [-1701.605] (-1695.867) * (-1702.783) (-1700.758) (-1694.146) [-1695.815] -- 0:00:48
      809500 -- (-1697.021) (-1695.538) (-1705.829) [-1698.039] * (-1701.013) (-1692.643) (-1691.649) [-1696.595] -- 0:00:48
      810000 -- (-1700.314) (-1695.454) (-1697.483) [-1703.018] * (-1694.387) (-1691.336) (-1699.690) [-1697.205] -- 0:00:48

      Average standard deviation of split frequencies: 0.013956

      810500 -- (-1703.600) (-1699.331) [-1697.499] (-1698.555) * (-1696.228) (-1701.590) (-1700.818) [-1699.938] -- 0:00:47
      811000 -- [-1697.449] (-1696.311) (-1693.438) (-1701.260) * (-1695.631) (-1698.861) [-1695.515] (-1700.957) -- 0:00:47
      811500 -- (-1700.727) [-1698.557] (-1695.843) (-1706.634) * (-1693.734) [-1697.124] (-1704.585) (-1696.192) -- 0:00:47
      812000 -- (-1697.354) (-1707.525) (-1698.643) [-1700.935] * (-1697.429) (-1701.468) (-1695.081) [-1695.725] -- 0:00:47
      812500 -- (-1697.143) (-1706.028) (-1712.723) [-1697.589] * (-1697.758) (-1697.088) [-1695.294] (-1698.952) -- 0:00:47
      813000 -- (-1694.973) [-1703.983] (-1698.458) (-1697.429) * [-1698.919] (-1694.015) (-1694.158) (-1695.368) -- 0:00:47
      813500 -- [-1695.235] (-1697.255) (-1699.267) (-1696.533) * (-1699.462) [-1691.295] (-1702.894) (-1701.852) -- 0:00:47
      814000 -- [-1695.525] (-1695.704) (-1699.510) (-1707.808) * [-1697.393] (-1694.497) (-1705.441) (-1692.558) -- 0:00:47
      814500 -- (-1697.077) (-1703.062) (-1697.948) [-1695.006] * (-1700.268) (-1703.721) (-1694.704) [-1692.848] -- 0:00:46
      815000 -- (-1694.331) (-1704.446) (-1695.147) [-1698.147] * (-1700.214) (-1701.908) (-1700.381) [-1697.392] -- 0:00:46

      Average standard deviation of split frequencies: 0.015309

      815500 -- (-1693.301) [-1694.101] (-1698.225) (-1696.952) * (-1698.842) (-1699.936) (-1700.221) [-1696.609] -- 0:00:46
      816000 -- (-1693.997) (-1693.580) (-1698.293) [-1694.529] * (-1702.804) (-1699.661) (-1702.626) [-1692.333] -- 0:00:46
      816500 -- (-1691.366) (-1697.514) [-1694.975] (-1691.816) * (-1697.178) (-1702.336) (-1700.780) [-1696.267] -- 0:00:46
      817000 -- [-1690.480] (-1693.483) (-1702.432) (-1697.008) * (-1695.886) (-1699.876) [-1703.046] (-1701.752) -- 0:00:46
      817500 -- (-1694.821) [-1698.409] (-1702.900) (-1694.545) * (-1701.799) (-1696.881) [-1696.647] (-1702.483) -- 0:00:46
      818000 -- [-1697.156] (-1698.872) (-1704.247) (-1695.950) * (-1695.754) (-1699.251) (-1696.919) [-1692.921] -- 0:00:46
      818500 -- (-1693.918) [-1696.365] (-1695.369) (-1697.660) * (-1694.082) [-1698.709] (-1697.331) (-1696.464) -- 0:00:45
      819000 -- (-1696.342) (-1702.272) (-1700.741) [-1696.811] * [-1695.902] (-1695.467) (-1694.072) (-1694.236) -- 0:00:45
      819500 -- (-1691.155) (-1693.212) (-1697.757) [-1696.414] * [-1699.747] (-1695.784) (-1695.428) (-1693.353) -- 0:00:45
      820000 -- (-1697.534) (-1698.891) [-1698.536] (-1698.201) * (-1693.084) [-1696.734] (-1693.686) (-1700.057) -- 0:00:45

      Average standard deviation of split frequencies: 0.015796

      820500 -- (-1701.250) [-1698.404] (-1695.954) (-1703.046) * [-1693.357] (-1699.817) (-1705.435) (-1691.064) -- 0:00:45
      821000 -- (-1706.750) (-1693.971) [-1696.252] (-1696.085) * [-1689.612] (-1707.384) (-1696.142) (-1698.246) -- 0:00:45
      821500 -- (-1701.077) [-1702.461] (-1695.786) (-1698.199) * [-1700.343] (-1697.578) (-1705.715) (-1699.576) -- 0:00:45
      822000 -- (-1696.338) (-1701.331) [-1692.218] (-1702.199) * (-1696.552) (-1701.334) [-1704.352] (-1698.482) -- 0:00:45
      822500 -- (-1699.480) (-1698.775) (-1702.407) [-1694.226] * [-1693.266] (-1695.258) (-1700.804) (-1693.069) -- 0:00:44
      823000 -- [-1695.502] (-1694.909) (-1690.870) (-1702.971) * (-1697.781) [-1694.544] (-1696.101) (-1696.617) -- 0:00:44
      823500 -- [-1695.365] (-1698.942) (-1697.678) (-1699.506) * (-1698.492) (-1692.779) (-1693.725) [-1695.338] -- 0:00:44
      824000 -- (-1701.639) (-1698.250) (-1696.227) [-1697.698] * [-1701.611] (-1695.054) (-1697.534) (-1697.920) -- 0:00:44
      824500 -- [-1699.202] (-1701.474) (-1692.359) (-1701.265) * (-1698.481) [-1697.535] (-1702.519) (-1695.116) -- 0:00:44
      825000 -- (-1701.040) [-1702.534] (-1696.685) (-1697.884) * (-1703.425) [-1693.005] (-1702.694) (-1699.825) -- 0:00:44

      Average standard deviation of split frequencies: 0.015980

      825500 -- (-1702.104) [-1693.639] (-1694.023) (-1692.029) * (-1704.390) [-1694.467] (-1696.461) (-1698.137) -- 0:00:44
      826000 -- (-1691.880) (-1697.036) [-1699.903] (-1704.950) * (-1690.855) (-1694.160) [-1689.817] (-1699.924) -- 0:00:44
      826500 -- (-1695.120) [-1697.435] (-1703.653) (-1694.365) * (-1697.352) [-1695.796] (-1699.929) (-1703.672) -- 0:00:43
      827000 -- (-1697.752) (-1704.802) (-1695.491) [-1703.809] * (-1695.326) (-1696.122) (-1700.449) [-1696.942] -- 0:00:43
      827500 -- (-1695.453) (-1706.900) (-1702.933) [-1695.077] * [-1693.932] (-1696.194) (-1697.767) (-1691.321) -- 0:00:43
      828000 -- (-1697.504) (-1695.429) (-1699.470) [-1692.479] * [-1691.820] (-1698.129) (-1694.283) (-1693.432) -- 0:00:43
      828500 -- (-1691.237) [-1697.503] (-1703.296) (-1694.663) * (-1700.821) (-1701.489) [-1691.841] (-1693.659) -- 0:00:43
      829000 -- (-1700.956) (-1700.341) (-1699.763) [-1694.724] * [-1697.056] (-1694.887) (-1697.329) (-1697.731) -- 0:00:43
      829500 -- (-1698.148) (-1702.238) (-1698.199) [-1700.848] * (-1695.492) (-1696.419) (-1696.950) [-1694.324] -- 0:00:43
      830000 -- [-1700.414] (-1693.167) (-1698.196) (-1701.363) * (-1696.638) [-1694.831] (-1702.464) (-1692.327) -- 0:00:43

      Average standard deviation of split frequencies: 0.015606

      830500 -- (-1699.391) (-1691.874) (-1696.352) [-1701.005] * (-1699.617) [-1697.569] (-1696.584) (-1694.509) -- 0:00:42
      831000 -- (-1701.923) (-1701.372) (-1700.731) [-1698.353] * (-1703.466) (-1702.729) (-1696.608) [-1697.240] -- 0:00:42
      831500 -- (-1694.550) (-1696.403) (-1696.028) [-1695.831] * (-1693.842) (-1696.994) [-1695.119] (-1705.118) -- 0:00:42
      832000 -- (-1694.696) (-1699.419) [-1694.000] (-1700.552) * [-1693.689] (-1694.365) (-1695.670) (-1693.809) -- 0:00:42
      832500 -- [-1693.391] (-1695.230) (-1698.728) (-1694.941) * (-1697.721) (-1701.091) [-1699.477] (-1697.370) -- 0:00:42
      833000 -- (-1690.187) (-1696.848) [-1695.947] (-1698.265) * (-1694.125) [-1696.350] (-1694.920) (-1698.175) -- 0:00:42
      833500 -- (-1696.379) (-1696.968) (-1692.240) [-1698.491] * (-1694.538) (-1699.401) (-1704.239) [-1695.322] -- 0:00:42
      834000 -- (-1696.477) (-1698.983) [-1695.512] (-1697.482) * (-1699.407) (-1699.525) (-1698.245) [-1694.249] -- 0:00:41
      834500 -- (-1694.632) (-1698.384) (-1700.027) [-1701.692] * [-1699.104] (-1700.628) (-1700.062) (-1698.037) -- 0:00:41
      835000 -- (-1691.063) [-1694.237] (-1690.538) (-1694.228) * [-1694.934] (-1697.479) (-1697.763) (-1705.464) -- 0:00:41

      Average standard deviation of split frequencies: 0.014661

      835500 -- (-1695.092) [-1702.474] (-1701.873) (-1709.672) * (-1697.023) (-1702.499) (-1697.816) [-1703.291] -- 0:00:41
      836000 -- (-1694.114) (-1702.624) [-1697.055] (-1699.621) * (-1696.919) (-1696.669) [-1697.236] (-1694.618) -- 0:00:41
      836500 -- (-1695.833) [-1695.012] (-1699.550) (-1694.203) * (-1696.731) (-1700.743) (-1691.569) [-1695.165] -- 0:00:41
      837000 -- (-1702.226) (-1694.240) [-1691.822] (-1693.735) * [-1702.818] (-1692.888) (-1696.052) (-1701.089) -- 0:00:41
      837500 -- (-1699.883) (-1701.326) (-1698.491) [-1694.333] * (-1695.911) [-1696.783] (-1695.919) (-1695.217) -- 0:00:41
      838000 -- (-1705.478) [-1691.430] (-1693.469) (-1698.249) * [-1692.766] (-1696.475) (-1696.426) (-1702.603) -- 0:00:40
      838500 -- (-1696.981) (-1694.760) (-1695.600) [-1691.408] * (-1702.475) [-1699.835] (-1697.677) (-1697.331) -- 0:00:40
      839000 -- (-1694.812) (-1705.645) [-1694.084] (-1695.683) * (-1692.779) (-1695.183) (-1694.139) [-1701.269] -- 0:00:40
      839500 -- [-1695.744] (-1701.704) (-1693.554) (-1696.810) * [-1694.556] (-1701.386) (-1693.122) (-1698.365) -- 0:00:40
      840000 -- (-1696.847) (-1699.013) [-1697.313] (-1695.443) * [-1690.038] (-1700.811) (-1694.808) (-1692.875) -- 0:00:40

      Average standard deviation of split frequencies: 0.015421

      840500 -- (-1702.993) [-1694.304] (-1689.933) (-1695.089) * (-1696.379) (-1695.857) (-1694.379) [-1694.502] -- 0:00:40
      841000 -- [-1698.881] (-1697.105) (-1694.815) (-1694.146) * (-1696.879) (-1693.790) [-1693.796] (-1690.785) -- 0:00:40
      841500 -- (-1700.281) [-1700.043] (-1694.977) (-1694.614) * (-1694.227) (-1696.249) (-1699.965) [-1697.618] -- 0:00:40
      842000 -- (-1696.538) [-1696.041] (-1697.366) (-1694.963) * [-1694.817] (-1702.152) (-1696.079) (-1696.655) -- 0:00:39
      842500 -- [-1693.835] (-1698.796) (-1696.621) (-1697.514) * [-1692.015] (-1692.945) (-1692.342) (-1699.291) -- 0:00:39
      843000 -- [-1693.241] (-1693.673) (-1698.279) (-1695.060) * (-1694.368) (-1700.581) (-1698.909) [-1695.005] -- 0:00:39
      843500 -- [-1695.353] (-1694.902) (-1701.235) (-1702.325) * [-1697.331] (-1703.001) (-1696.977) (-1698.071) -- 0:00:39
      844000 -- (-1693.717) [-1695.469] (-1695.236) (-1695.519) * (-1694.134) [-1696.237] (-1698.035) (-1701.323) -- 0:00:39
      844500 -- (-1699.048) (-1693.963) [-1699.698] (-1699.063) * (-1697.178) (-1693.131) (-1700.334) [-1700.373] -- 0:00:39
      845000 -- [-1693.023] (-1700.281) (-1701.351) (-1701.567) * (-1704.716) [-1698.266] (-1696.767) (-1696.216) -- 0:00:39

      Average standard deviation of split frequencies: 0.015881

      845500 -- [-1694.935] (-1701.270) (-1702.015) (-1700.217) * (-1702.717) [-1694.985] (-1693.333) (-1697.368) -- 0:00:39
      846000 -- (-1697.404) (-1695.255) [-1702.463] (-1697.634) * (-1695.641) (-1696.719) (-1703.238) [-1695.873] -- 0:00:38
      846500 -- [-1692.312] (-1696.761) (-1699.307) (-1695.757) * (-1698.415) (-1696.272) (-1700.773) [-1693.035] -- 0:00:38
      847000 -- (-1696.806) (-1699.399) (-1699.809) [-1699.715] * [-1698.883] (-1699.735) (-1699.933) (-1699.428) -- 0:00:38
      847500 -- (-1692.823) (-1695.765) [-1695.659] (-1697.911) * (-1697.641) [-1707.715] (-1700.140) (-1695.658) -- 0:00:38
      848000 -- (-1695.703) [-1697.085] (-1694.415) (-1703.226) * (-1693.823) [-1698.871] (-1695.087) (-1704.812) -- 0:00:38
      848500 -- (-1699.773) (-1693.754) [-1695.790] (-1693.428) * [-1700.329] (-1693.422) (-1701.837) (-1701.840) -- 0:00:38
      849000 -- (-1698.827) [-1693.818] (-1700.959) (-1694.625) * (-1696.052) [-1703.041] (-1693.392) (-1691.353) -- 0:00:38
      849500 -- (-1696.320) (-1695.277) (-1690.541) [-1691.893] * (-1697.812) [-1694.344] (-1696.520) (-1694.026) -- 0:00:38
      850000 -- [-1693.119] (-1700.764) (-1695.203) (-1698.639) * [-1694.926] (-1691.810) (-1694.584) (-1698.900) -- 0:00:37

      Average standard deviation of split frequencies: 0.015655

      850500 -- (-1700.281) (-1697.663) (-1695.027) [-1696.764] * (-1694.288) (-1693.567) [-1693.091] (-1694.674) -- 0:00:37
      851000 -- (-1695.345) (-1698.952) [-1698.822] (-1698.673) * (-1701.568) (-1697.986) (-1694.098) [-1697.929] -- 0:00:37
      851500 -- (-1698.525) (-1700.386) [-1699.852] (-1695.148) * (-1691.698) (-1703.139) [-1701.784] (-1699.919) -- 0:00:37
      852000 -- (-1704.586) (-1698.631) [-1697.136] (-1700.410) * (-1699.826) [-1699.387] (-1692.743) (-1700.119) -- 0:00:37
      852500 -- (-1698.961) (-1692.561) (-1696.434) [-1697.894] * [-1691.984] (-1698.628) (-1694.006) (-1699.292) -- 0:00:37
      853000 -- (-1710.225) (-1696.659) [-1695.286] (-1700.578) * (-1694.882) (-1700.033) (-1694.966) [-1697.674] -- 0:00:37
      853500 -- (-1703.051) (-1695.059) (-1690.863) [-1691.710] * (-1696.570) (-1696.983) (-1694.895) [-1697.000] -- 0:00:37
      854000 -- (-1698.288) (-1706.933) (-1695.068) [-1693.704] * (-1697.477) (-1694.035) [-1695.385] (-1699.324) -- 0:00:36
      854500 -- (-1698.517) [-1695.394] (-1699.443) (-1694.514) * (-1691.346) (-1697.773) [-1698.030] (-1695.924) -- 0:00:36
      855000 -- (-1693.666) (-1707.799) (-1707.006) [-1697.582] * (-1701.273) (-1695.199) [-1694.321] (-1694.873) -- 0:00:36

      Average standard deviation of split frequencies: 0.015144

      855500 -- (-1706.997) (-1703.956) (-1694.762) [-1691.701] * (-1696.312) (-1693.702) [-1693.813] (-1706.118) -- 0:00:36
      856000 -- (-1700.795) (-1700.682) [-1698.233] (-1697.998) * (-1700.840) (-1705.215) (-1693.127) [-1700.566] -- 0:00:36
      856500 -- (-1696.456) (-1699.187) [-1700.965] (-1698.193) * (-1701.955) [-1699.030] (-1698.319) (-1709.620) -- 0:00:36
      857000 -- [-1692.450] (-1701.378) (-1697.949) (-1695.436) * (-1707.708) (-1695.628) (-1694.333) [-1692.503] -- 0:00:36
      857500 -- (-1698.384) [-1694.515] (-1704.058) (-1691.106) * [-1696.362] (-1699.070) (-1700.601) (-1702.789) -- 0:00:36
      858000 -- (-1699.294) (-1701.573) [-1693.485] (-1702.191) * [-1701.984] (-1696.630) (-1698.303) (-1698.419) -- 0:00:36
      858500 -- (-1697.431) (-1704.999) [-1694.139] (-1700.491) * (-1693.255) [-1696.583] (-1698.509) (-1697.636) -- 0:00:35
      859000 -- (-1697.529) [-1694.122] (-1694.249) (-1695.717) * (-1701.403) (-1699.983) (-1700.825) [-1699.957] -- 0:00:35
      859500 -- [-1694.916] (-1700.518) (-1697.683) (-1694.802) * (-1697.352) [-1694.817] (-1692.590) (-1699.527) -- 0:00:35
      860000 -- (-1697.842) (-1700.167) (-1694.566) [-1694.218] * (-1696.215) [-1692.333] (-1707.633) (-1697.997) -- 0:00:35

      Average standard deviation of split frequencies: 0.015062

      860500 -- (-1699.528) [-1695.838] (-1700.853) (-1693.962) * [-1692.836] (-1693.749) (-1702.118) (-1697.513) -- 0:00:35
      861000 -- (-1696.347) (-1699.410) (-1699.875) [-1691.968] * [-1701.455] (-1701.710) (-1700.533) (-1693.816) -- 0:00:35
      861500 -- [-1695.919] (-1702.398) (-1695.530) (-1695.476) * [-1697.964] (-1704.141) (-1696.287) (-1694.793) -- 0:00:35
      862000 -- [-1694.192] (-1698.061) (-1693.333) (-1703.994) * (-1697.356) [-1692.731] (-1694.168) (-1696.889) -- 0:00:35
      862500 -- (-1695.812) [-1698.829] (-1700.429) (-1695.617) * [-1699.644] (-1701.001) (-1700.264) (-1692.130) -- 0:00:34
      863000 -- (-1699.842) (-1705.895) (-1694.876) [-1694.871] * (-1704.137) (-1698.500) (-1701.429) [-1693.448] -- 0:00:34
      863500 -- (-1698.854) (-1701.241) [-1692.922] (-1695.564) * (-1696.952) (-1697.153) (-1698.385) [-1692.584] -- 0:00:34
      864000 -- [-1694.102] (-1695.282) (-1698.116) (-1696.396) * (-1698.653) (-1697.980) [-1697.415] (-1694.334) -- 0:00:34
      864500 -- (-1693.785) (-1692.095) (-1695.189) [-1690.920] * (-1700.136) (-1695.984) [-1698.424] (-1696.812) -- 0:00:34
      865000 -- (-1701.338) (-1693.455) [-1694.003] (-1694.089) * (-1698.574) [-1697.571] (-1700.553) (-1695.226) -- 0:00:34

      Average standard deviation of split frequencies: 0.014561

      865500 -- (-1699.043) (-1699.991) (-1700.927) [-1696.699] * (-1694.941) [-1698.077] (-1695.691) (-1691.851) -- 0:00:34
      866000 -- (-1703.397) (-1696.469) (-1698.981) [-1699.398] * [-1696.540] (-1701.034) (-1692.953) (-1697.272) -- 0:00:34
      866500 -- (-1700.921) (-1704.983) [-1705.602] (-1695.364) * [-1699.695] (-1711.405) (-1695.722) (-1697.485) -- 0:00:33
      867000 -- [-1699.408] (-1709.097) (-1696.713) (-1694.800) * (-1699.844) (-1699.852) [-1696.113] (-1701.647) -- 0:00:33
      867500 -- (-1697.487) (-1700.319) (-1700.616) [-1695.489] * (-1702.823) [-1699.112] (-1695.241) (-1697.535) -- 0:00:33
      868000 -- (-1700.860) (-1698.561) (-1692.672) [-1695.348] * (-1698.632) (-1695.532) [-1695.189] (-1694.947) -- 0:00:33
      868500 -- (-1693.874) (-1694.901) [-1693.445] (-1699.291) * [-1694.365] (-1701.158) (-1701.522) (-1695.002) -- 0:00:33
      869000 -- [-1693.080] (-1705.907) (-1694.515) (-1700.544) * [-1691.601] (-1693.873) (-1696.048) (-1696.762) -- 0:00:33
      869500 -- (-1696.604) (-1697.193) [-1698.641] (-1691.902) * (-1699.942) (-1706.196) [-1699.409] (-1699.759) -- 0:00:33
      870000 -- (-1696.357) [-1698.655] (-1701.044) (-1698.943) * (-1696.872) (-1709.841) (-1693.091) [-1693.706] -- 0:00:33

      Average standard deviation of split frequencies: 0.015701

      870500 -- (-1691.913) [-1695.501] (-1694.932) (-1701.128) * (-1701.101) (-1706.400) (-1700.768) [-1696.748] -- 0:00:32
      871000 -- (-1693.221) (-1705.139) [-1696.004] (-1692.429) * (-1706.784) (-1695.281) (-1698.132) [-1697.322] -- 0:00:32
      871500 -- (-1700.122) [-1695.439] (-1695.452) (-1696.786) * (-1701.918) [-1701.117] (-1703.092) (-1698.152) -- 0:00:32
      872000 -- (-1697.085) [-1699.342] (-1705.486) (-1698.257) * (-1702.137) (-1701.242) (-1694.874) [-1696.963] -- 0:00:32
      872500 -- (-1696.189) (-1696.131) [-1694.566] (-1699.105) * (-1701.536) (-1691.917) [-1692.451] (-1694.615) -- 0:00:32
      873000 -- [-1693.386] (-1695.370) (-1704.998) (-1697.681) * (-1702.279) [-1693.239] (-1699.296) (-1699.493) -- 0:00:32
      873500 -- (-1709.997) (-1699.379) (-1705.320) [-1699.722] * [-1694.195] (-1706.573) (-1692.660) (-1695.335) -- 0:00:32
      874000 -- [-1698.190] (-1701.137) (-1698.304) (-1697.847) * (-1702.552) (-1704.595) (-1692.988) [-1695.141] -- 0:00:32
      874500 -- (-1699.244) (-1692.600) [-1698.681] (-1694.095) * (-1695.614) (-1695.133) [-1696.105] (-1699.417) -- 0:00:31
      875000 -- [-1695.196] (-1697.753) (-1696.445) (-1692.595) * (-1707.641) (-1696.302) (-1694.595) [-1696.432] -- 0:00:31

      Average standard deviation of split frequencies: 0.015740

      875500 -- [-1695.131] (-1701.163) (-1707.336) (-1694.781) * (-1702.009) (-1696.391) [-1695.870] (-1700.413) -- 0:00:31
      876000 -- (-1692.987) (-1695.245) [-1697.586] (-1695.207) * (-1697.438) [-1696.094] (-1696.225) (-1702.844) -- 0:00:31
      876500 -- [-1689.005] (-1693.860) (-1693.520) (-1694.700) * (-1694.936) [-1695.979] (-1699.269) (-1699.150) -- 0:00:31
      877000 -- (-1698.404) (-1698.079) [-1698.162] (-1692.228) * (-1697.928) (-1697.218) [-1701.376] (-1691.551) -- 0:00:31
      877500 -- [-1696.043] (-1695.525) (-1693.086) (-1698.242) * (-1704.146) (-1698.266) [-1691.863] (-1694.340) -- 0:00:31
      878000 -- (-1690.430) (-1702.498) [-1694.600] (-1702.793) * [-1703.077] (-1697.695) (-1693.988) (-1699.933) -- 0:00:30
      878500 -- (-1697.088) (-1697.316) (-1695.717) [-1695.291] * (-1695.281) (-1695.003) [-1693.478] (-1694.346) -- 0:00:30
      879000 -- [-1696.116] (-1694.941) (-1693.303) (-1696.037) * (-1700.569) (-1703.521) (-1693.028) [-1695.012] -- 0:00:30
      879500 -- (-1701.724) (-1697.614) (-1697.660) [-1698.258] * (-1697.538) (-1698.320) [-1694.631] (-1698.969) -- 0:00:30
      880000 -- (-1690.463) (-1706.567) (-1698.752) [-1693.669] * (-1704.083) (-1710.453) (-1693.770) [-1695.077] -- 0:00:30

      Average standard deviation of split frequencies: 0.016058

      880500 -- (-1694.544) (-1698.006) [-1701.117] (-1693.317) * (-1699.551) (-1706.118) (-1700.459) [-1695.188] -- 0:00:30
      881000 -- (-1700.634) (-1698.085) [-1696.725] (-1698.213) * (-1705.041) [-1695.260] (-1703.651) (-1695.055) -- 0:00:30
      881500 -- (-1697.944) (-1695.882) (-1699.038) [-1697.540] * (-1699.165) [-1693.055] (-1701.824) (-1699.452) -- 0:00:30
      882000 -- (-1701.609) (-1700.042) [-1699.429] (-1700.125) * (-1695.430) (-1695.483) [-1697.510] (-1695.035) -- 0:00:29
      882500 -- (-1697.418) (-1698.994) [-1694.135] (-1692.456) * (-1691.813) (-1698.662) [-1700.338] (-1696.726) -- 0:00:29
      883000 -- (-1696.625) [-1698.082] (-1697.794) (-1697.133) * (-1695.176) [-1695.518] (-1701.521) (-1698.383) -- 0:00:29
      883500 -- [-1691.505] (-1701.207) (-1698.736) (-1693.428) * (-1697.365) [-1695.621] (-1699.618) (-1694.361) -- 0:00:29
      884000 -- (-1701.027) (-1696.072) (-1696.813) [-1694.900] * [-1698.443] (-1698.079) (-1702.177) (-1702.521) -- 0:00:29
      884500 -- (-1703.781) (-1696.652) [-1692.250] (-1692.140) * (-1695.482) (-1700.937) [-1695.703] (-1696.236) -- 0:00:29
      885000 -- (-1696.120) [-1690.439] (-1695.801) (-1697.639) * (-1697.895) (-1699.583) [-1698.455] (-1697.419) -- 0:00:29

      Average standard deviation of split frequencies: 0.016893

      885500 -- (-1693.442) [-1693.405] (-1699.242) (-1701.212) * (-1698.721) (-1703.247) [-1693.927] (-1693.971) -- 0:00:29
      886000 -- (-1696.139) [-1696.706] (-1708.093) (-1698.259) * [-1706.844] (-1702.755) (-1697.784) (-1699.327) -- 0:00:28
      886500 -- [-1698.152] (-1694.952) (-1694.655) (-1700.986) * (-1701.967) (-1696.843) [-1694.656] (-1694.249) -- 0:00:28
      887000 -- (-1701.549) (-1694.748) (-1699.197) [-1697.549] * [-1696.538] (-1702.886) (-1696.280) (-1691.979) -- 0:00:28
      887500 -- [-1695.364] (-1703.853) (-1692.709) (-1695.370) * (-1702.409) (-1694.325) [-1693.798] (-1698.399) -- 0:00:28
      888000 -- (-1695.977) [-1698.456] (-1693.026) (-1694.931) * [-1698.880] (-1693.596) (-1695.213) (-1707.315) -- 0:00:28
      888500 -- (-1694.608) (-1696.620) [-1692.663] (-1711.282) * (-1693.277) [-1695.066] (-1696.767) (-1698.427) -- 0:00:28
      889000 -- (-1699.628) [-1692.726] (-1695.403) (-1697.892) * (-1695.741) (-1700.219) (-1697.762) [-1697.088] -- 0:00:28
      889500 -- (-1692.787) (-1695.161) (-1699.447) [-1697.248] * [-1696.627] (-1694.720) (-1697.669) (-1693.916) -- 0:00:28
      890000 -- (-1705.112) (-1693.132) (-1703.391) [-1698.910] * (-1696.425) [-1699.779] (-1698.429) (-1697.824) -- 0:00:27

      Average standard deviation of split frequencies: 0.015084

      890500 -- [-1704.338] (-1700.711) (-1697.044) (-1698.724) * (-1694.839) (-1695.685) (-1699.000) [-1691.611] -- 0:00:27
      891000 -- (-1696.015) (-1692.580) [-1701.635] (-1699.739) * [-1697.523] (-1694.273) (-1696.817) (-1700.474) -- 0:00:27
      891500 -- (-1702.100) (-1701.595) (-1700.312) [-1693.109] * (-1697.229) [-1696.136] (-1696.265) (-1692.896) -- 0:00:27
      892000 -- (-1703.592) (-1696.380) [-1702.560] (-1700.013) * [-1695.314] (-1694.324) (-1694.620) (-1695.933) -- 0:00:27
      892500 -- (-1696.573) [-1694.108] (-1697.706) (-1694.118) * [-1693.608] (-1696.724) (-1694.914) (-1696.129) -- 0:00:27
      893000 -- (-1694.796) [-1697.204] (-1699.167) (-1697.485) * (-1697.880) (-1695.227) [-1691.365] (-1697.569) -- 0:00:27
      893500 -- [-1699.990] (-1709.158) (-1695.504) (-1698.561) * (-1697.435) (-1693.646) [-1690.674] (-1692.975) -- 0:00:27
      894000 -- [-1694.983] (-1701.645) (-1697.394) (-1698.717) * (-1697.098) (-1702.868) (-1698.195) [-1693.560] -- 0:00:26
      894500 -- (-1694.503) [-1694.382] (-1706.044) (-1701.418) * (-1697.166) [-1693.040] (-1697.918) (-1700.616) -- 0:00:26
      895000 -- (-1697.582) [-1698.093] (-1694.297) (-1694.762) * (-1702.971) (-1694.357) (-1693.368) [-1697.808] -- 0:00:26

      Average standard deviation of split frequencies: 0.013679

      895500 -- [-1693.971] (-1700.740) (-1699.364) (-1698.132) * (-1696.140) [-1697.170] (-1695.576) (-1696.534) -- 0:00:26
      896000 -- [-1699.616] (-1693.619) (-1695.001) (-1690.810) * (-1703.046) (-1697.680) (-1696.231) [-1693.369] -- 0:00:26
      896500 -- [-1696.516] (-1696.663) (-1695.212) (-1692.554) * (-1692.481) (-1691.516) [-1694.253] (-1698.570) -- 0:00:26
      897000 -- (-1695.552) (-1701.697) [-1692.723] (-1690.674) * (-1700.598) (-1698.274) (-1695.649) [-1697.856] -- 0:00:26
      897500 -- [-1693.066] (-1697.643) (-1699.938) (-1696.841) * (-1697.161) (-1701.409) (-1697.689) [-1694.956] -- 0:00:26
      898000 -- [-1693.652] (-1696.420) (-1695.063) (-1696.182) * [-1694.005] (-1696.335) (-1694.248) (-1699.852) -- 0:00:25
      898500 -- (-1695.347) (-1704.251) (-1695.429) [-1702.199] * (-1694.777) [-1695.220] (-1696.444) (-1695.128) -- 0:00:25
      899000 -- (-1695.575) (-1707.051) (-1701.787) [-1691.224] * (-1705.951) (-1696.989) [-1696.597] (-1696.250) -- 0:00:25
      899500 -- [-1695.420] (-1705.829) (-1694.991) (-1693.771) * (-1695.576) (-1697.723) (-1694.401) [-1694.687] -- 0:00:25
      900000 -- (-1691.546) (-1698.482) [-1693.636] (-1696.310) * (-1699.269) (-1699.640) [-1706.327] (-1697.239) -- 0:00:25

      Average standard deviation of split frequencies: 0.014263

      900500 -- (-1698.838) (-1706.432) [-1696.981] (-1695.304) * [-1693.262] (-1709.171) (-1697.994) (-1692.770) -- 0:00:25
      901000 -- (-1696.250) (-1705.808) [-1697.761] (-1695.614) * [-1692.464] (-1696.707) (-1699.048) (-1691.952) -- 0:00:25
      901500 -- [-1696.421] (-1696.529) (-1697.834) (-1700.795) * (-1692.766) (-1702.800) (-1700.812) [-1695.343] -- 0:00:25
      902000 -- [-1696.059] (-1698.249) (-1693.812) (-1693.311) * (-1698.885) (-1697.000) [-1694.951] (-1697.286) -- 0:00:24
      902500 -- (-1696.656) (-1694.617) [-1695.937] (-1698.754) * [-1692.558] (-1695.501) (-1694.454) (-1695.891) -- 0:00:24
      903000 -- (-1702.377) (-1696.080) (-1698.738) [-1698.172] * [-1701.461] (-1695.837) (-1694.373) (-1700.389) -- 0:00:24
      903500 -- (-1700.901) (-1702.429) [-1697.029] (-1702.066) * (-1696.500) (-1690.274) (-1699.614) [-1695.368] -- 0:00:24
      904000 -- (-1702.680) (-1708.231) (-1700.331) [-1696.251] * (-1695.812) (-1699.582) (-1697.248) [-1698.262] -- 0:00:24
      904500 -- (-1695.241) (-1701.359) [-1698.696] (-1708.520) * (-1702.599) (-1696.372) (-1696.528) [-1696.162] -- 0:00:24
      905000 -- (-1696.823) [-1694.263] (-1701.792) (-1699.353) * (-1690.725) (-1699.031) [-1692.846] (-1699.958) -- 0:00:24

      Average standard deviation of split frequencies: 0.015479

      905500 -- (-1694.035) [-1694.262] (-1696.825) (-1706.881) * (-1695.567) (-1699.074) (-1693.927) [-1699.302] -- 0:00:24
      906000 -- (-1692.198) [-1695.803] (-1696.398) (-1703.971) * (-1694.221) (-1695.069) [-1690.633] (-1700.021) -- 0:00:23
      906500 -- [-1693.056] (-1697.635) (-1696.431) (-1697.021) * (-1695.277) (-1703.194) [-1697.487] (-1710.605) -- 0:00:23
      907000 -- (-1700.597) [-1695.334] (-1703.273) (-1696.333) * (-1696.190) [-1698.956] (-1693.108) (-1709.256) -- 0:00:23
      907500 -- (-1699.530) (-1695.479) (-1698.696) [-1695.632] * (-1691.379) [-1703.138] (-1691.043) (-1701.769) -- 0:00:23
      908000 -- (-1699.261) [-1693.588] (-1696.716) (-1707.886) * (-1691.945) (-1696.689) [-1690.360] (-1695.224) -- 0:00:23
      908500 -- (-1699.269) (-1697.752) (-1701.904) [-1702.699] * [-1696.013] (-1708.370) (-1695.827) (-1696.249) -- 0:00:23
      909000 -- (-1701.045) (-1696.597) [-1698.144] (-1692.512) * (-1695.123) [-1696.296] (-1702.046) (-1699.633) -- 0:00:23
      909500 -- (-1706.324) [-1696.862] (-1703.736) (-1696.117) * (-1696.650) [-1700.712] (-1702.953) (-1706.557) -- 0:00:22
      910000 -- (-1694.132) (-1697.802) (-1695.801) [-1694.834] * [-1694.888] (-1698.042) (-1702.165) (-1698.487) -- 0:00:22

      Average standard deviation of split frequencies: 0.015012

      910500 -- (-1694.951) (-1696.968) [-1697.297] (-1698.688) * (-1702.752) (-1700.092) (-1697.569) [-1692.152] -- 0:00:22
      911000 -- (-1697.496) (-1702.179) [-1693.993] (-1699.861) * (-1694.276) (-1697.304) (-1698.757) [-1697.300] -- 0:00:22
      911500 -- (-1693.622) (-1702.888) (-1698.523) [-1690.918] * (-1697.032) [-1695.488] (-1696.776) (-1694.151) -- 0:00:22
      912000 -- [-1692.919] (-1698.591) (-1700.025) (-1695.228) * (-1696.609) [-1696.305] (-1696.234) (-1695.553) -- 0:00:22
      912500 -- (-1698.270) [-1691.014] (-1700.988) (-1696.965) * [-1696.497] (-1694.980) (-1701.024) (-1697.955) -- 0:00:22
      913000 -- [-1694.013] (-1695.606) (-1703.320) (-1696.552) * (-1692.595) [-1697.718] (-1696.805) (-1694.557) -- 0:00:22
      913500 -- (-1699.037) [-1694.301] (-1707.675) (-1701.679) * (-1708.742) (-1697.662) [-1693.290] (-1693.500) -- 0:00:21
      914000 -- (-1696.929) (-1706.169) (-1699.368) [-1698.761] * (-1706.199) (-1694.138) [-1702.288] (-1700.669) -- 0:00:21
      914500 -- (-1690.744) [-1696.231] (-1705.746) (-1696.341) * (-1698.116) [-1693.287] (-1695.700) (-1694.070) -- 0:00:21
      915000 -- (-1691.286) (-1693.867) (-1700.103) [-1698.998] * (-1698.013) [-1695.979] (-1696.963) (-1702.106) -- 0:00:21

      Average standard deviation of split frequencies: 0.015310

      915500 -- (-1700.542) [-1695.036] (-1695.665) (-1696.187) * (-1706.368) [-1698.979] (-1692.090) (-1690.940) -- 0:00:21
      916000 -- (-1704.970) (-1695.003) [-1700.953] (-1706.605) * (-1701.209) [-1694.149] (-1692.799) (-1693.448) -- 0:00:21
      916500 -- (-1702.565) [-1694.889] (-1703.987) (-1698.879) * (-1701.059) (-1695.722) [-1693.068] (-1705.812) -- 0:00:21
      917000 -- (-1701.569) (-1696.666) [-1696.996] (-1698.445) * (-1697.643) (-1705.585) [-1691.170] (-1696.343) -- 0:00:21
      917500 -- [-1699.758] (-1691.678) (-1695.976) (-1701.820) * (-1698.222) (-1703.111) (-1700.618) [-1693.168] -- 0:00:20
      918000 -- (-1704.259) (-1695.948) (-1700.166) [-1694.378] * (-1694.620) [-1700.100] (-1696.830) (-1699.249) -- 0:00:20
      918500 -- [-1699.704] (-1706.084) (-1701.214) (-1699.795) * (-1699.895) (-1693.664) (-1695.755) [-1700.091] -- 0:00:20
      919000 -- (-1696.977) (-1700.164) [-1694.738] (-1702.884) * (-1695.120) (-1696.143) [-1695.817] (-1694.338) -- 0:00:20
      919500 -- (-1692.452) [-1699.747] (-1698.331) (-1706.554) * [-1693.588] (-1694.304) (-1697.278) (-1693.040) -- 0:00:20
      920000 -- [-1694.519] (-1700.799) (-1702.395) (-1693.947) * [-1698.034] (-1696.920) (-1696.976) (-1695.764) -- 0:00:20

      Average standard deviation of split frequencies: 0.014977

      920500 -- [-1699.971] (-1696.712) (-1700.257) (-1692.887) * (-1703.799) (-1696.326) (-1698.480) [-1693.162] -- 0:00:20
      921000 -- (-1696.233) [-1698.371] (-1691.415) (-1701.670) * [-1694.761] (-1696.534) (-1700.560) (-1694.531) -- 0:00:20
      921500 -- (-1699.144) [-1701.432] (-1697.515) (-1705.199) * (-1697.977) [-1697.586] (-1701.240) (-1705.774) -- 0:00:19
      922000 -- (-1698.210) [-1693.527] (-1702.464) (-1701.039) * [-1692.599] (-1697.634) (-1696.503) (-1692.817) -- 0:00:19
      922500 -- (-1700.071) (-1696.771) (-1699.785) [-1697.042] * (-1693.437) [-1703.392] (-1697.977) (-1702.672) -- 0:00:19
      923000 -- (-1705.300) (-1696.774) (-1697.770) [-1693.736] * [-1692.287] (-1700.459) (-1692.551) (-1700.785) -- 0:00:19
      923500 -- (-1699.992) (-1695.856) [-1696.373] (-1696.184) * (-1697.890) (-1702.440) (-1699.510) [-1692.145] -- 0:00:19
      924000 -- [-1693.319] (-1692.619) (-1698.618) (-1693.378) * (-1700.917) [-1699.622] (-1705.153) (-1695.391) -- 0:00:19
      924500 -- [-1692.934] (-1694.899) (-1696.861) (-1697.457) * (-1693.568) (-1705.093) (-1707.230) [-1694.843] -- 0:00:19
      925000 -- (-1699.447) (-1697.805) (-1693.264) [-1697.338] * (-1696.346) (-1696.745) (-1703.717) [-1705.193] -- 0:00:19

      Average standard deviation of split frequencies: 0.014890

      925500 -- (-1703.133) (-1703.660) (-1699.975) [-1699.456] * (-1697.575) (-1698.781) (-1698.358) [-1694.095] -- 0:00:18
      926000 -- (-1697.215) (-1701.621) (-1703.667) [-1704.181] * (-1701.802) (-1695.528) (-1696.196) [-1693.466] -- 0:00:18
      926500 -- (-1699.979) (-1700.595) (-1696.491) [-1697.870] * (-1693.897) [-1695.281] (-1691.309) (-1703.595) -- 0:00:18
      927000 -- (-1701.016) (-1693.387) (-1694.277) [-1696.801] * (-1701.910) (-1700.369) (-1692.701) [-1695.637] -- 0:00:18
      927500 -- [-1692.531] (-1698.386) (-1706.293) (-1702.348) * (-1699.734) (-1700.359) [-1692.508] (-1694.115) -- 0:00:18
      928000 -- (-1694.894) [-1696.505] (-1696.637) (-1695.443) * [-1699.258] (-1701.269) (-1699.971) (-1693.504) -- 0:00:18
      928500 -- (-1706.996) (-1695.453) (-1699.367) [-1695.558] * (-1696.630) (-1693.667) [-1691.053] (-1698.848) -- 0:00:18
      929000 -- (-1698.725) (-1701.061) (-1698.365) [-1696.127] * (-1693.020) [-1701.931] (-1698.633) (-1697.789) -- 0:00:18
      929500 -- [-1710.527] (-1695.949) (-1694.994) (-1696.160) * (-1709.720) (-1696.037) (-1699.605) [-1697.935] -- 0:00:17
      930000 -- [-1697.167] (-1702.196) (-1702.151) (-1704.179) * (-1698.127) [-1693.287] (-1699.148) (-1699.291) -- 0:00:17

      Average standard deviation of split frequencies: 0.014942

      930500 -- (-1702.138) (-1694.971) [-1697.001] (-1696.419) * (-1699.709) (-1699.596) [-1702.206] (-1710.925) -- 0:00:17
      931000 -- [-1697.715] (-1695.132) (-1697.945) (-1697.134) * (-1698.676) (-1699.205) [-1697.797] (-1707.537) -- 0:00:17
      931500 -- (-1695.892) [-1694.073] (-1702.652) (-1692.979) * (-1693.092) (-1697.491) (-1697.042) [-1698.488] -- 0:00:17
      932000 -- (-1701.535) (-1698.443) (-1699.644) [-1692.763] * [-1695.622] (-1702.584) (-1699.225) (-1700.554) -- 0:00:17
      932500 -- (-1693.058) (-1699.497) [-1698.185] (-1693.226) * (-1707.416) (-1694.627) (-1698.466) [-1696.959] -- 0:00:17
      933000 -- (-1701.371) (-1694.443) [-1696.344] (-1697.287) * (-1702.117) (-1698.381) [-1694.086] (-1698.624) -- 0:00:17
      933500 -- (-1703.065) (-1696.526) [-1698.407] (-1696.696) * (-1692.331) (-1702.602) [-1694.256] (-1691.731) -- 0:00:16
      934000 -- [-1702.658] (-1694.220) (-1699.797) (-1702.417) * (-1699.548) [-1696.165] (-1698.796) (-1701.970) -- 0:00:16
      934500 -- [-1694.590] (-1696.989) (-1697.209) (-1700.156) * (-1702.335) (-1691.955) [-1694.148] (-1699.181) -- 0:00:16
      935000 -- (-1697.202) [-1692.654] (-1698.832) (-1706.240) * (-1706.340) [-1698.782] (-1693.642) (-1701.224) -- 0:00:16

      Average standard deviation of split frequencies: 0.014983

      935500 -- (-1702.292) (-1694.259) (-1698.292) [-1693.837] * [-1697.592] (-1700.502) (-1691.943) (-1703.744) -- 0:00:16
      936000 -- (-1701.712) (-1701.006) [-1691.860] (-1691.323) * (-1696.647) (-1699.725) (-1695.250) [-1700.187] -- 0:00:16
      936500 -- [-1694.486] (-1696.978) (-1698.926) (-1700.932) * [-1698.431] (-1694.738) (-1697.238) (-1691.791) -- 0:00:16
      937000 -- (-1696.222) (-1694.382) (-1698.393) [-1695.371] * [-1700.286] (-1700.112) (-1706.685) (-1697.418) -- 0:00:16
      937500 -- [-1695.639] (-1694.667) (-1696.438) (-1694.866) * (-1698.498) [-1696.595] (-1698.896) (-1697.281) -- 0:00:15
      938000 -- (-1695.023) (-1695.869) (-1702.014) [-1692.679] * [-1697.149] (-1695.588) (-1700.044) (-1696.996) -- 0:00:15
      938500 -- [-1694.797] (-1695.502) (-1698.477) (-1699.477) * (-1698.332) (-1696.071) [-1692.291] (-1695.617) -- 0:00:15
      939000 -- (-1707.800) (-1701.893) [-1696.850] (-1703.263) * [-1695.575] (-1694.927) (-1694.508) (-1694.700) -- 0:00:15
      939500 -- (-1700.696) [-1696.847] (-1693.684) (-1699.610) * (-1695.580) (-1701.166) [-1697.548] (-1694.928) -- 0:00:15
      940000 -- (-1696.488) [-1697.336] (-1690.264) (-1698.689) * (-1695.654) (-1698.892) (-1705.393) [-1698.733] -- 0:00:15

      Average standard deviation of split frequencies: 0.015285

      940500 -- (-1696.731) (-1695.165) [-1700.072] (-1696.539) * (-1702.192) (-1710.806) [-1696.419] (-1694.353) -- 0:00:15
      941000 -- (-1700.875) (-1696.707) (-1698.790) [-1699.978] * (-1698.003) (-1706.393) [-1699.228] (-1703.193) -- 0:00:14
      941500 -- (-1706.174) [-1696.186] (-1699.864) (-1695.670) * (-1700.181) (-1707.295) [-1698.643] (-1694.655) -- 0:00:14
      942000 -- (-1707.459) (-1701.072) (-1704.453) [-1692.702] * (-1690.461) [-1698.410] (-1702.344) (-1694.561) -- 0:00:14
      942500 -- [-1698.511] (-1702.765) (-1696.340) (-1691.695) * [-1692.643] (-1695.116) (-1695.408) (-1696.442) -- 0:00:14
      943000 -- (-1695.618) (-1701.081) [-1695.524] (-1694.313) * (-1696.663) (-1697.959) (-1695.491) [-1693.094] -- 0:00:14
      943500 -- [-1699.599] (-1692.933) (-1695.728) (-1693.503) * (-1695.647) (-1697.240) [-1695.684] (-1696.213) -- 0:00:14
      944000 -- (-1703.005) (-1699.194) [-1694.134] (-1695.923) * (-1700.077) [-1692.791] (-1697.233) (-1698.153) -- 0:00:14
      944500 -- (-1697.016) (-1706.034) (-1697.026) [-1700.692] * (-1696.916) (-1692.270) [-1691.680] (-1691.581) -- 0:00:14
      945000 -- [-1700.136] (-1702.083) (-1692.230) (-1703.249) * (-1692.177) [-1704.138] (-1707.902) (-1698.724) -- 0:00:13

      Average standard deviation of split frequencies: 0.015323

      945500 -- (-1699.858) (-1707.623) [-1693.364] (-1699.001) * [-1703.422] (-1694.189) (-1703.375) (-1699.291) -- 0:00:13
      946000 -- (-1697.465) (-1699.215) [-1695.560] (-1702.170) * [-1694.833] (-1693.191) (-1701.758) (-1705.663) -- 0:00:13
      946500 -- (-1692.049) (-1699.744) [-1697.895] (-1695.397) * [-1690.914] (-1699.894) (-1699.853) (-1702.776) -- 0:00:13
      947000 -- (-1696.548) (-1695.248) (-1696.520) [-1692.019] * (-1695.020) (-1700.462) (-1705.376) [-1694.192] -- 0:00:13
      947500 -- (-1692.241) (-1696.533) (-1698.768) [-1703.050] * (-1695.923) (-1702.584) (-1700.605) [-1700.802] -- 0:00:13
      948000 -- (-1695.616) (-1704.685) (-1695.163) [-1697.213] * (-1693.581) (-1707.443) [-1695.474] (-1700.013) -- 0:00:13
      948500 -- (-1697.476) (-1703.346) [-1696.699] (-1694.218) * [-1697.248] (-1701.671) (-1696.898) (-1700.298) -- 0:00:13
      949000 -- (-1696.089) (-1698.415) (-1704.238) [-1693.261] * (-1699.660) [-1704.273] (-1695.127) (-1694.451) -- 0:00:12
      949500 -- (-1699.246) (-1704.315) (-1694.310) [-1699.047] * (-1693.913) [-1694.919] (-1697.398) (-1700.760) -- 0:00:12
      950000 -- (-1701.034) (-1695.193) [-1692.559] (-1694.540) * (-1693.005) (-1702.622) [-1698.237] (-1701.887) -- 0:00:12

      Average standard deviation of split frequencies: 0.014752

      950500 -- (-1696.832) [-1691.179] (-1695.061) (-1693.603) * [-1691.889] (-1700.920) (-1709.227) (-1694.207) -- 0:00:12
      951000 -- (-1696.519) (-1692.806) [-1694.558] (-1698.005) * (-1695.687) (-1698.895) [-1703.423] (-1698.386) -- 0:00:12
      951500 -- [-1698.640] (-1693.865) (-1693.159) (-1699.922) * (-1697.146) (-1697.844) [-1700.695] (-1697.785) -- 0:00:12
      952000 -- (-1698.963) (-1697.040) (-1696.468) [-1701.544] * (-1697.315) (-1701.087) (-1699.847) [-1693.717] -- 0:00:12
      952500 -- (-1697.681) [-1691.355] (-1699.842) (-1700.763) * (-1696.822) (-1700.928) (-1696.594) [-1696.591] -- 0:00:12
      953000 -- (-1700.887) (-1701.949) [-1701.355] (-1697.627) * (-1699.499) (-1701.738) (-1692.606) [-1695.397] -- 0:00:11
      953500 -- [-1703.907] (-1701.130) (-1694.653) (-1700.190) * (-1695.136) (-1697.182) [-1693.430] (-1694.219) -- 0:00:11
      954000 -- (-1699.106) [-1694.534] (-1693.682) (-1694.640) * (-1701.181) (-1695.999) (-1691.776) [-1698.516] -- 0:00:11
      954500 -- (-1693.354) (-1691.732) [-1692.005] (-1703.655) * (-1701.593) (-1698.548) (-1695.295) [-1702.376] -- 0:00:11
      955000 -- (-1695.504) (-1692.721) (-1697.211) [-1699.603] * (-1702.397) (-1694.575) [-1693.399] (-1700.305) -- 0:00:11

      Average standard deviation of split frequencies: 0.015040

      955500 -- (-1696.217) (-1699.361) [-1698.355] (-1697.657) * (-1690.848) (-1697.262) (-1703.809) [-1697.395] -- 0:00:11
      956000 -- (-1697.795) [-1699.555] (-1692.424) (-1699.083) * [-1694.097] (-1700.922) (-1696.594) (-1700.772) -- 0:00:11
      956500 -- [-1702.097] (-1697.120) (-1698.790) (-1695.231) * (-1697.318) (-1698.160) (-1703.505) [-1696.995] -- 0:00:11
      957000 -- (-1705.408) (-1701.451) (-1698.351) [-1690.798] * (-1695.156) (-1695.435) (-1708.324) [-1695.253] -- 0:00:10
      957500 -- (-1693.618) [-1694.091] (-1695.428) (-1693.288) * (-1694.684) [-1690.773] (-1697.467) (-1694.772) -- 0:00:10
      958000 -- (-1705.474) (-1698.451) (-1692.913) [-1696.362] * (-1697.172) (-1696.201) [-1701.629] (-1694.241) -- 0:00:10
      958500 -- (-1702.472) [-1702.784] (-1695.857) (-1704.876) * (-1701.781) (-1704.635) [-1693.851] (-1690.631) -- 0:00:10
      959000 -- (-1703.853) [-1698.873] (-1693.095) (-1696.338) * (-1699.196) (-1697.126) [-1692.546] (-1695.385) -- 0:00:10
      959500 -- (-1707.758) [-1693.594] (-1704.187) (-1703.849) * (-1691.223) (-1701.484) [-1696.323] (-1698.694) -- 0:00:10
      960000 -- [-1698.634] (-1701.927) (-1694.013) (-1693.809) * (-1700.588) (-1698.007) (-1694.616) [-1703.907] -- 0:00:10

      Average standard deviation of split frequencies: 0.015335

      960500 -- [-1694.961] (-1701.800) (-1698.872) (-1702.073) * (-1698.841) (-1695.484) [-1700.054] (-1697.288) -- 0:00:10
      961000 -- [-1699.605] (-1696.880) (-1700.541) (-1696.738) * (-1694.148) (-1696.399) (-1700.698) [-1696.190] -- 0:00:09
      961500 -- (-1694.205) [-1694.335] (-1700.788) (-1698.551) * (-1700.437) (-1694.776) (-1696.478) [-1697.112] -- 0:00:09
      962000 -- (-1706.619) (-1697.652) (-1694.506) [-1698.015] * (-1697.427) [-1698.407] (-1695.552) (-1694.767) -- 0:00:09
      962500 -- (-1699.535) (-1694.280) [-1691.182] (-1694.384) * (-1699.280) (-1704.733) [-1692.197] (-1697.820) -- 0:00:09
      963000 -- [-1702.859] (-1693.273) (-1697.505) (-1694.145) * (-1694.114) [-1694.777] (-1696.320) (-1698.845) -- 0:00:09
      963500 -- [-1695.575] (-1702.876) (-1702.285) (-1695.718) * [-1692.667] (-1696.097) (-1694.908) (-1696.703) -- 0:00:09
      964000 -- [-1695.500] (-1706.853) (-1696.763) (-1697.106) * (-1697.084) (-1694.675) (-1698.662) [-1693.699] -- 0:00:09
      964500 -- (-1699.865) (-1698.733) [-1693.793] (-1698.505) * [-1692.991] (-1695.058) (-1699.672) (-1692.036) -- 0:00:09
      965000 -- (-1698.555) (-1702.540) [-1695.713] (-1705.151) * [-1697.906] (-1696.809) (-1696.730) (-1701.200) -- 0:00:08

      Average standard deviation of split frequencies: 0.014518

      965500 -- [-1693.274] (-1696.105) (-1697.657) (-1697.000) * [-1692.520] (-1702.359) (-1692.421) (-1691.411) -- 0:00:08
      966000 -- (-1695.978) (-1696.672) (-1694.802) [-1692.794] * (-1697.333) (-1701.695) (-1700.410) [-1696.960] -- 0:00:08
      966500 -- (-1701.603) (-1691.032) [-1695.774] (-1692.502) * [-1693.703] (-1694.224) (-1698.289) (-1696.481) -- 0:00:08
      967000 -- (-1697.849) (-1700.029) (-1697.906) [-1694.011] * [-1697.536] (-1695.217) (-1698.257) (-1710.426) -- 0:00:08
      967500 -- [-1696.655] (-1700.801) (-1698.141) (-1699.885) * [-1703.373] (-1694.871) (-1697.116) (-1701.398) -- 0:00:08
      968000 -- (-1704.543) (-1696.510) [-1695.315] (-1693.191) * (-1695.568) [-1692.418] (-1704.083) (-1698.067) -- 0:00:08
      968500 -- (-1698.360) [-1695.839] (-1698.510) (-1696.786) * (-1697.730) (-1698.616) [-1700.485] (-1694.656) -- 0:00:08
      969000 -- [-1693.087] (-1692.207) (-1706.313) (-1695.136) * [-1695.752] (-1704.487) (-1696.269) (-1701.945) -- 0:00:07
      969500 -- (-1692.541) (-1696.788) (-1695.642) [-1691.890] * (-1699.248) (-1700.440) (-1698.493) [-1701.589] -- 0:00:07
      970000 -- (-1698.302) [-1690.852] (-1691.969) (-1695.588) * (-1703.754) [-1692.129] (-1700.545) (-1695.121) -- 0:00:07

      Average standard deviation of split frequencies: 0.014084

      970500 -- (-1696.786) [-1696.175] (-1700.911) (-1700.791) * (-1697.121) (-1700.199) (-1691.871) [-1702.926] -- 0:00:07
      971000 -- (-1694.019) [-1693.169] (-1695.202) (-1697.788) * (-1693.649) (-1692.233) (-1693.886) [-1696.776] -- 0:00:07
      971500 -- (-1697.112) [-1692.686] (-1698.388) (-1694.375) * [-1697.559] (-1694.643) (-1697.263) (-1698.839) -- 0:00:07
      972000 -- (-1698.791) (-1694.874) (-1693.659) [-1697.754] * (-1695.732) [-1701.467] (-1699.137) (-1698.372) -- 0:00:07
      972500 -- (-1692.166) [-1697.701] (-1693.697) (-1698.650) * (-1698.839) (-1706.386) [-1696.610] (-1700.166) -- 0:00:06
      973000 -- [-1695.068] (-1698.041) (-1696.787) (-1708.759) * (-1692.726) (-1698.235) [-1693.953] (-1698.608) -- 0:00:06
      973500 -- (-1700.346) [-1696.634] (-1694.718) (-1695.185) * (-1700.944) [-1692.792] (-1697.094) (-1699.130) -- 0:00:06
      974000 -- (-1696.278) [-1694.257] (-1694.169) (-1708.979) * (-1700.838) [-1693.701] (-1699.150) (-1694.834) -- 0:00:06
      974500 -- [-1703.374] (-1697.259) (-1701.149) (-1699.052) * (-1698.775) [-1704.562] (-1699.542) (-1695.921) -- 0:00:06
      975000 -- (-1701.113) (-1700.297) (-1699.617) [-1693.270] * (-1702.223) [-1698.357] (-1695.737) (-1697.427) -- 0:00:06

      Average standard deviation of split frequencies: 0.014128

      975500 -- (-1700.335) [-1705.278] (-1699.198) (-1695.296) * [-1699.023] (-1703.065) (-1693.049) (-1694.122) -- 0:00:06
      976000 -- [-1695.773] (-1695.519) (-1698.442) (-1698.410) * [-1699.060] (-1690.226) (-1699.720) (-1694.426) -- 0:00:06
      976500 -- (-1701.719) (-1700.864) (-1690.959) [-1692.708] * (-1693.743) (-1691.719) (-1695.012) [-1697.778] -- 0:00:05
      977000 -- (-1697.905) (-1692.047) [-1698.594] (-1693.386) * (-1691.296) (-1691.683) [-1702.682] (-1692.228) -- 0:00:05
      977500 -- (-1695.992) (-1696.978) (-1696.490) [-1695.184] * (-1707.802) (-1694.063) (-1707.605) [-1696.666] -- 0:00:05
      978000 -- (-1696.646) (-1693.995) [-1697.241] (-1698.993) * (-1698.759) (-1705.410) (-1700.123) [-1694.028] -- 0:00:05
      978500 -- (-1695.500) (-1692.191) [-1695.183] (-1694.185) * (-1700.101) [-1701.030] (-1692.867) (-1701.369) -- 0:00:05
      979000 -- (-1699.743) (-1692.104) (-1692.811) [-1693.548] * (-1697.136) (-1696.849) [-1694.978] (-1694.292) -- 0:00:05
      979500 -- (-1694.720) (-1695.753) (-1696.155) [-1699.830] * [-1694.717] (-1697.257) (-1697.353) (-1699.094) -- 0:00:05
      980000 -- (-1697.935) [-1696.563] (-1694.305) (-1702.053) * (-1697.300) [-1694.340] (-1704.192) (-1696.002) -- 0:00:05

      Average standard deviation of split frequencies: 0.013940

      980500 -- (-1704.428) [-1699.656] (-1699.794) (-1698.781) * (-1696.253) (-1698.726) (-1699.336) [-1696.220] -- 0:00:04
      981000 -- (-1702.346) (-1701.989) [-1689.940] (-1701.898) * (-1698.626) (-1701.697) [-1695.015] (-1692.504) -- 0:00:04
      981500 -- (-1698.195) (-1699.909) [-1696.535] (-1697.737) * [-1699.607] (-1704.005) (-1708.082) (-1697.400) -- 0:00:04
      982000 -- (-1698.012) (-1695.909) [-1695.727] (-1698.348) * (-1696.354) [-1696.213] (-1707.626) (-1697.625) -- 0:00:04
      982500 -- (-1698.015) (-1695.091) [-1695.351] (-1693.997) * (-1698.921) (-1700.054) (-1708.331) [-1698.636] -- 0:00:04
      983000 -- (-1694.761) [-1697.924] (-1693.526) (-1698.363) * (-1699.129) (-1702.258) (-1698.812) [-1691.077] -- 0:00:04
      983500 -- (-1695.571) (-1695.140) (-1693.766) [-1696.742] * (-1704.807) (-1702.564) [-1692.569] (-1692.266) -- 0:00:04
      984000 -- (-1693.585) (-1703.107) [-1696.718] (-1695.415) * (-1702.069) [-1699.241] (-1703.536) (-1697.692) -- 0:00:04
      984500 -- (-1695.555) (-1689.638) [-1699.775] (-1699.535) * (-1698.055) [-1693.450] (-1695.991) (-1697.900) -- 0:00:03
      985000 -- [-1692.145] (-1696.007) (-1697.222) (-1699.884) * (-1702.811) [-1688.042] (-1694.930) (-1697.552) -- 0:00:03

      Average standard deviation of split frequencies: 0.014821

      985500 -- (-1701.541) (-1699.887) [-1701.245] (-1700.227) * (-1703.916) (-1694.039) (-1694.281) [-1702.157] -- 0:00:03
      986000 -- (-1698.112) (-1699.663) (-1694.473) [-1697.302] * (-1700.280) (-1707.302) [-1692.413] (-1691.462) -- 0:00:03
      986500 -- (-1695.674) (-1694.224) [-1695.220] (-1696.206) * (-1697.914) [-1694.828] (-1699.397) (-1696.140) -- 0:00:03
      987000 -- (-1702.913) (-1701.384) [-1697.382] (-1697.146) * (-1705.491) (-1706.305) [-1693.840] (-1697.199) -- 0:00:03
      987500 -- (-1693.928) (-1695.985) (-1698.341) [-1689.534] * [-1700.410] (-1699.367) (-1692.627) (-1699.306) -- 0:00:03
      988000 -- (-1697.751) (-1697.683) [-1696.367] (-1704.455) * (-1693.464) (-1693.176) (-1693.426) [-1696.189] -- 0:00:03
      988500 -- (-1697.280) (-1699.790) [-1695.012] (-1695.538) * (-1701.804) [-1696.493] (-1695.585) (-1695.207) -- 0:00:02
      989000 -- (-1694.443) [-1700.279] (-1693.220) (-1699.651) * (-1697.025) (-1700.234) (-1701.695) [-1695.184] -- 0:00:02
      989500 -- (-1693.153) (-1702.763) [-1698.285] (-1696.776) * (-1692.894) [-1699.618] (-1702.142) (-1696.866) -- 0:00:02
      990000 -- (-1699.262) [-1700.077] (-1697.044) (-1695.872) * (-1699.332) (-1699.421) [-1703.072] (-1691.779) -- 0:00:02

      Average standard deviation of split frequencies: 0.015108

      990500 -- (-1695.435) (-1703.357) (-1693.199) [-1701.795] * [-1692.953] (-1695.308) (-1702.946) (-1695.469) -- 0:00:02
      991000 -- (-1695.112) [-1706.134] (-1691.312) (-1700.687) * (-1699.187) (-1694.495) (-1693.572) [-1693.268] -- 0:00:02
      991500 -- (-1701.151) (-1698.933) [-1696.220] (-1700.673) * (-1694.520) (-1695.398) [-1699.517] (-1701.235) -- 0:00:02
      992000 -- (-1699.365) [-1698.901] (-1692.285) (-1695.510) * (-1697.595) (-1704.314) [-1691.062] (-1697.250) -- 0:00:02
      992500 -- (-1696.930) (-1693.402) (-1692.742) [-1697.552] * (-1707.554) (-1699.309) (-1693.455) [-1695.147] -- 0:00:01
      993000 -- (-1699.869) (-1704.909) (-1701.760) [-1698.548] * (-1700.134) (-1704.357) (-1694.718) [-1699.343] -- 0:00:01
      993500 -- [-1697.949] (-1697.822) (-1698.291) (-1696.431) * [-1701.862] (-1702.020) (-1706.556) (-1691.962) -- 0:00:01
      994000 -- [-1695.886] (-1701.263) (-1692.798) (-1701.090) * (-1703.402) (-1705.087) (-1695.386) [-1693.890] -- 0:00:01
      994500 -- [-1695.500] (-1695.076) (-1696.383) (-1695.968) * (-1706.651) (-1699.330) [-1694.165] (-1701.170) -- 0:00:01
      995000 -- (-1694.087) (-1696.490) (-1703.674) [-1696.135] * (-1696.393) [-1693.806] (-1696.831) (-1694.175) -- 0:00:01

      Average standard deviation of split frequencies: 0.015855

      995500 -- [-1695.332] (-1702.312) (-1693.845) (-1695.761) * (-1696.361) (-1701.521) (-1699.593) [-1693.852] -- 0:00:01
      996000 -- (-1698.474) [-1697.944] (-1694.906) (-1696.101) * (-1703.488) [-1695.907] (-1695.609) (-1698.884) -- 0:00:01
      996500 -- (-1694.567) (-1695.371) [-1691.061] (-1695.419) * (-1691.742) [-1692.246] (-1694.839) (-1699.472) -- 0:00:00
      997000 -- (-1699.316) (-1695.476) (-1696.499) [-1697.308] * (-1697.333) (-1694.943) [-1693.346] (-1695.339) -- 0:00:00
      997500 -- (-1690.287) (-1698.801) [-1691.398] (-1699.653) * (-1696.295) [-1696.788] (-1696.342) (-1696.265) -- 0:00:00
      998000 -- (-1695.541) (-1699.750) [-1689.972] (-1707.751) * (-1700.391) [-1698.940] (-1695.511) (-1696.107) -- 0:00:00
      998500 -- (-1698.137) [-1700.442] (-1692.854) (-1699.943) * (-1696.161) (-1691.943) (-1700.481) [-1694.841] -- 0:00:00
      999000 -- (-1697.239) (-1703.618) [-1699.549] (-1699.108) * (-1703.282) (-1691.796) [-1696.527] (-1697.881) -- 0:00:00
      999500 -- [-1691.711] (-1697.561) (-1700.225) (-1699.477) * [-1695.962] (-1692.444) (-1701.554) (-1697.857) -- 0:00:00
      1000000 -- (-1693.335) (-1699.409) [-1698.931] (-1698.229) * [-1695.690] (-1694.507) (-1696.523) (-1695.037) -- 0:00:00

      Average standard deviation of split frequencies: 0.016017
      Final log likelihoods and log prior probs for run 1 (stored and calculated):
         Chain 1 -- -1693.335349 -- 12.759203
         Chain 1 -- -1693.335347 -- 12.759203
         Chain 2 -- -1699.408827 -- 15.822327
         Chain 2 -- -1699.408832 -- 15.822327
         Chain 3 -- -1698.931338 -- 17.726399
         Chain 3 -- -1698.931342 -- 17.726399
         Chain 4 -- -1698.229182 -- 18.101450
         Chain 4 -- -1698.229182 -- 18.101450
      Final log likelihoods and log prior probs for run 2 (stored and calculated):
         Chain 1 -- -1695.689757 -- 16.088910
         Chain 1 -- -1695.689754 -- 16.088910
         Chain 2 -- -1694.507307 -- 12.079658
         Chain 2 -- -1694.507306 -- 12.079658
         Chain 3 -- -1696.522572 -- 13.876031
         Chain 3 -- -1696.522571 -- 13.876031
         Chain 4 -- -1695.037104 -- 13.607579
         Chain 4 -- -1695.037107 -- 13.607579

      Analysis completed in 4 mins 14 seconds
      Analysis used 253.73 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -1687.11
      Likelihood of best state for "cold" chain of run 2 was -1687.31

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            57.0 %     ( 57 %)     Dirichlet(Revmat{all})
            71.2 %     ( 58 %)     Slider(Revmat{all})
            26.3 %     ( 26 %)     Dirichlet(Pi{all})
            28.1 %     ( 23 %)     Slider(Pi{all})
            51.3 %     ( 36 %)     Multiplier(Alpha{1,2})
            47.8 %     ( 32 %)     Multiplier(Alpha{3})
            62.3 %     ( 29 %)     Slider(Pinvar{all})
             5.7 %     (  5 %)     ExtSPR(Tau{all},V{all})
             2.7 %     (  2 %)     ExtTBR(Tau{all},V{all})
            11.0 %     (  7 %)     NNI(Tau{all},V{all})
            15.0 %     ( 17 %)     ParsSPR(Tau{all},V{all})
            26.3 %     ( 24 %)     Multiplier(V{all})
            37.5 %     ( 37 %)     Nodeslider(V{all})
            25.5 %     ( 26 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            56.7 %     ( 44 %)     Dirichlet(Revmat{all})
            71.4 %     ( 62 %)     Slider(Revmat{all})
            27.0 %     ( 27 %)     Dirichlet(Pi{all})
            28.5 %     ( 19 %)     Slider(Pi{all})
            50.8 %     ( 28 %)     Multiplier(Alpha{1,2})
            47.7 %     ( 18 %)     Multiplier(Alpha{3})
            61.7 %     ( 33 %)     Slider(Pinvar{all})
             5.9 %     (  4 %)     ExtSPR(Tau{all},V{all})
             2.8 %     (  1 %)     ExtTBR(Tau{all},V{all})
            10.9 %     ( 13 %)     NNI(Tau{all},V{all})
            14.9 %     (  9 %)     ParsSPR(Tau{all},V{all})
            26.2 %     ( 23 %)     Multiplier(V{all})
            37.6 %     ( 40 %)     Nodeslider(V{all})
            25.6 %     ( 33 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.82    0.66    0.53 
         2 |  166740            0.83    0.69 
         3 |  166591  166354            0.85 
         4 |  166433  167230  166652         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.82    0.67    0.53 
         2 |  166875            0.83    0.69 
         3 |  166923  166436            0.85 
         4 |  166966  166585  166215         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -1694.41
      |1                                                           |
      |           1                     2                          |
      |     1             1                2    *         2        |
      |   1  2  22  2       1     2       1            1        1  |
      |    2          1  2       112   1 1            1  1         |
      |  1  21 2    1  1    2        1   2  2    2   2     12      |
      |  2    1    *    2      11   1   1  11 2         2        22|
      |21 21  2      22 11 1 2   2  22       1 1    2   1  21   2  |
      |           2    2      2 2     *       1   **1  2 21   *  1 |
      | 2       1         2  1 2             2        2      * *  1|
      |        1     1     2  1    1   2       2     1             |
      |          1                                                 |
      |                                   2                        |
      |                                                            |
      |                                          1                 |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1698.42
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1      -1692.83         -1704.06
        2      -1692.97         -1702.35
      --------------------------------------
      TOTAL    -1692.90         -1703.53
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.509316    0.007044    0.359800    0.679892    0.500719   1202.45   1338.89    1.000
      r(A<->C){all}   0.170758    0.001571    0.095516    0.247501    0.168197   1006.81   1016.53    1.000
      r(A<->G){all}   0.197671    0.002124    0.113098    0.287850    0.194573    838.12    939.26    1.000
      r(A<->T){all}   0.125383    0.002457    0.037241    0.223956    0.121201    798.88    816.36    1.002
      r(C<->G){all}   0.091126    0.000620    0.046639    0.141531    0.089217    759.34    950.59    1.000
      r(C<->T){all}   0.290206    0.002857    0.188865    0.395164    0.287919    776.53    813.18    1.000
      r(G<->T){all}   0.124855    0.001628    0.052527    0.204650    0.122711    802.35    861.93    1.000
      pi(A){all}      0.211329    0.000222    0.181623    0.240371    0.210996   1152.34   1181.95    1.000
      pi(C){all}      0.343335    0.000302    0.307559    0.375774    0.343214    721.27   1069.15    1.001
      pi(G){all}      0.279740    0.000281    0.247211    0.312450    0.279161   1062.70   1170.61    1.000
      pi(T){all}      0.165596    0.000186    0.137426    0.191083    0.165414    749.18    996.92    1.001
      alpha{1,2}      0.098621    0.003076    0.000341    0.187798    0.100953   1085.13   1155.32    1.000
      alpha{3}        1.959812    0.576557    0.739869    3.481837    1.832250   1391.28   1446.14    1.000
      pinvar{all}     0.308807    0.012414    0.080070    0.496071    0.315026    880.50    900.15    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4
      5 -- C5
      6 -- C6

   Key to taxon bipartitions (saved to file "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ------------
    1 -- .*****
    2 -- .*....
    3 -- ..*...
    4 -- ...*..
    5 -- ....*.
    6 -- .....*
    7 -- .**...
    8 -- ...***
    9 -- ...**.
   10 -- ....**
   ------------

   Summary statistics for informative taxon bipartitions
      (saved to file "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    7  3002    1.000000    0.000000    1.000000    1.000000    2
    8  2952    0.983344    0.004711    0.980013    0.986676    2
    9  1869    0.622585    0.030621    0.600933    0.644237    2
   10   979    0.326116    0.028737    0.305796    0.346436    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                                95% HPD Interval
                                              --------------------
   Parameter           Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   -------------------------------------------------------------------------------------------
   length{all}[1]     0.021782    0.000078    0.006644    0.039891    0.020892    1.000    2
   length{all}[2]     0.021846    0.000061    0.008798    0.038263    0.020996    1.000    2
   length{all}[3]     0.018102    0.000052    0.005227    0.031727    0.017251    1.000    2
   length{all}[4]     0.061476    0.000270    0.030419    0.092866    0.059934    1.000    2
   length{all}[5]     0.045120    0.000220    0.018149    0.075792    0.044197    1.000    2
   length{all}[6]     0.261207    0.004222    0.145908    0.386597    0.252653    1.000    2
   length{all}[7]     0.020933    0.000072    0.006642    0.037958    0.020042    1.000    2
   length{all}[8]     0.039564    0.000293    0.009311    0.073947    0.038236    1.002    2
   length{all}[9]     0.022277    0.000189    0.000003    0.047665    0.020141    1.004    2
   length{all}[10]    0.016358    0.000133    0.000051    0.037398    0.014125    0.999    2
   -------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.016017
       Maximum standard deviation of split frequencies = 0.030621
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.004


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |                                               /------------------------ C2 (2)
   |----------------------100----------------------+                               
   |                                               \------------------------ C3 (3)
   +                                                                               
   |                                               /------------------------ C4 (4)
   |                       /-----------62----------+                               
   |                       |                       \------------------------ C5 (5)
   \-----------98----------+                                                       
                           \------------------------------------------------ C6 (6)
                                                                                   

   Phylogram (based on average branch lengths):

   /----- C1 (1)
   |                                                                               
   |    /----- C2 (2)
   |----+                                                                          
   |    \---- C3 (3)
   +                                                                               
   |             /--------------- C4 (4)
   |        /----+                                                                 
   |        |    \----------- C5 (5)
   \--------+                                                                      
            \--------------------------------------------------------------- C6 (6)
                                                                                   
   |-----------| 0.050 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (5 trees sampled):
      90 % credible set contains 2 trees
      95 % credible set contains 3 trees
      99 % credible set contains 4 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.8, March 2014

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  3  7  8

seq file is not paml/phylip format.  Trying nexus format.
ns = 6  	ls = 696
Reading sequences, sequential format..
Reading seq # 1: C1     
Reading seq # 2: C2     
Reading seq # 3: C3     
Reading seq # 4: C4     
Reading seq # 5: C5     
Reading seq # 6: C6     
Sites with gaps or missing data are removed.

    51 ambiguity characters in seq. 1
    51 ambiguity characters in seq. 2
    51 ambiguity characters in seq. 3
    48 ambiguity characters in seq. 4
    63 ambiguity characters in seq. 5
    36 ambiguity characters in seq. 6
23 sites are removed.   8  9 10 11 185 186 187 204 205 206 215 216 217 218 224 225 226 227 228 229 230 231 232
Sequences read..
Counting site patterns..  0:00

         133 patterns at      209 /      209 sites (100.0%),  0:00
Counting codons..


      120 bytes for distance
   129808 bytes for conP
    18088 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, (2, 3), ((4, 5), 6));   MP score: 136
   259616 bytes for conP, adjusted

    0.045058    0.036093    0.031665    0.048232    0.062031    0.015183    0.107982    0.089003    0.364256    0.300000    1.300000

ntime & nrate & np:     9     2    11

Bounds (np=11):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =    11
lnL0 = -1701.244166

Iterating by ming2
Initial: fx=  1701.244166
x=  0.04506  0.03609  0.03166  0.04823  0.06203  0.01518  0.10798  0.08900  0.36426  0.30000  1.30000

  1 h-m-p  0.0000 0.0013 250.9609 ++YCYCCC  1695.545094  5 0.0003    26 | 0/11
  2 h-m-p  0.0004 0.0025 186.0440 +CYYCCC  1667.919119  5 0.0020    50 | 0/11
  3 h-m-p  0.0001 0.0006 1871.1879 +CCCC  1629.347905  3 0.0005    71 | 0/11
  4 h-m-p  0.0000 0.0002 447.0167 ++     1624.462174  m 0.0002    85 | 0/11
  5 h-m-p  0.0000 0.0000 736.6107 
h-m-p:      1.29698676e-20      6.48493382e-20      7.36610698e+02  1624.462174
..  | 0/11
  6 h-m-p  0.0000 0.0008 885.8978 +YYCCCC  1616.470130  5 0.0001   119 | 0/11
  7 h-m-p  0.0002 0.0008 188.3827 +YYCYCC  1604.561630  5 0.0006   141 | 0/11
  8 h-m-p  0.0001 0.0004 429.6016 +YYCCCC  1595.820122  5 0.0002   164 | 0/11
  9 h-m-p  0.0003 0.0014 385.7335 +YYYYYCYCYC  1552.715530 10 0.0012   191 | 0/11
 10 h-m-p  0.0003 0.0014  81.3529 YYCC   1552.172365  3 0.0002   209 | 0/11
 11 h-m-p  0.0018 0.0479   9.2290 CYC    1552.148856  2 0.0005   226 | 0/11
 12 h-m-p  0.0009 0.0416   5.1217 CC     1552.127878  1 0.0013   242 | 0/11
 13 h-m-p  0.0009 0.1938   7.6649 ++CYC  1551.798218  2 0.0141   261 | 0/11
 14 h-m-p  0.0005 0.0063 215.9426 YCCC   1550.944279  3 0.0012   280 | 0/11
 15 h-m-p  0.0033 0.0167  48.4040 YCC    1550.857182  2 0.0006   297 | 0/11
 16 h-m-p  0.0058 0.0291   2.2935 CCC    1550.834089  2 0.0018   315 | 0/11
 17 h-m-p  0.0012 0.1465   3.3338 ++YCCCC  1548.235345  4 0.0439   338 | 0/11
 18 h-m-p  1.6000 8.0000   0.0442 CCC    1547.669066  2 1.5698   356 | 0/11
 19 h-m-p  1.6000 8.0000   0.0224 YCC    1547.604635  2 1.1675   384 | 0/11
 20 h-m-p  1.6000 8.0000   0.0073 CCC    1547.577889  2 1.8643   413 | 0/11
 21 h-m-p  1.6000 8.0000   0.0082 CC     1547.556794  1 2.4082   440 | 0/11
 22 h-m-p  1.6000 8.0000   0.0047 CC     1547.550372  1 1.3286   467 | 0/11
 23 h-m-p  1.6000 8.0000   0.0030 YC     1547.550036  1 0.9754   493 | 0/11
 24 h-m-p  1.6000 8.0000   0.0004 Y      1547.550019  0 0.9472   518 | 0/11
 25 h-m-p  1.6000 8.0000   0.0001 Y      1547.550018  0 1.0114   543 | 0/11
 26 h-m-p  1.6000 8.0000   0.0000 Y      1547.550018  0 1.0263   568 | 0/11
 27 h-m-p  1.6000 8.0000   0.0000 C      1547.550018  0 1.6000   593 | 0/11
 28 h-m-p  1.6000 8.0000   0.0000 -------------C  1547.550018  0 0.0000   631
Out..
lnL  = -1547.550018
632 lfun, 632 eigenQcodon, 5688 P(t)

Time used:  0:03


Model 1: NearlyNeutral

TREE #  1
(1, (2, 3), ((4, 5), 6));   MP score: 136
    0.045058    0.036093    0.031665    0.048232    0.062031    0.015183    0.107982    0.089003    0.364256    1.213294    0.747245    0.296991

ntime & nrate & np:     9     2    12

Bounds (np=12):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 9.295841

np =    12
lnL0 = -1585.726019

Iterating by ming2
Initial: fx=  1585.726019
x=  0.04506  0.03609  0.03166  0.04823  0.06203  0.01518  0.10798  0.08900  0.36426  1.21329  0.74724  0.29699

  1 h-m-p  0.0000 0.0021 225.1811 +++YCYCYCC  1570.666900  6 0.0015    30 | 0/12
  2 h-m-p  0.0000 0.0002 663.5666 +YCYCCC  1561.131216  5 0.0001    54 | 0/12
  3 h-m-p  0.0001 0.0005 124.0132 CCCCC  1560.318322  4 0.0001    77 | 0/12
  4 h-m-p  0.0003 0.0036  53.9673 +YYYC  1558.980247  3 0.0011    96 | 0/12
  5 h-m-p  0.0007 0.0033  50.2226 CCCCC  1558.343843  4 0.0008   119 | 0/12
  6 h-m-p  0.0013 0.0066  20.6280 YCC    1558.228222  2 0.0007   137 | 0/12
  7 h-m-p  0.0021 0.0463   6.8964 CCC    1558.140405  2 0.0033   156 | 0/12
  8 h-m-p  0.0026 0.0318   8.7835 CCC    1558.073801  2 0.0021   175 | 0/12
  9 h-m-p  0.0041 0.1925   4.5212 +CCC   1557.806880  2 0.0135   195 | 0/12
 10 h-m-p  0.0027 0.0544  22.3297 +CCCCC  1555.700007  4 0.0178   219 | 0/12
 11 h-m-p  0.0017 0.0083 166.1426 CYC    1554.383390  2 0.0015   237 | 0/12
 12 h-m-p  0.0068 0.0341   5.2082 YCC    1554.268509  2 0.0027   255 | 0/12
 13 h-m-p  0.0030 0.0927   4.7000 ++CYCCC  1544.344492  4 0.0690   280 | 0/12
 14 h-m-p  0.0168 0.0839   1.3097 +YYCCC  1539.940992  4 0.0632   302 | 0/12
 15 h-m-p  0.1048 1.3625   0.7902 +YCCCCC  1535.886152  5 0.4774   327 | 0/12
 16 h-m-p  0.7484 3.7418   0.0596 CCC    1534.274947  2 0.9648   358 | 0/12
 17 h-m-p  0.3661 2.0784   0.1571 YCCC   1533.566303  3 0.6371   390 | 0/12
 18 h-m-p  1.4882 8.0000   0.0672 YCCC   1533.232911  3 0.8716   422 | 0/12
 19 h-m-p  1.6000 8.0000   0.0307 YCC    1533.006079  2 1.1547   452 | 0/12
 20 h-m-p  0.7533 8.0000   0.0470 CC     1532.896288  1 1.1017   481 | 0/12
 21 h-m-p  1.4951 8.0000   0.0346 YC     1532.875607  1 0.7290   509 | 0/12
 22 h-m-p  1.6000 8.0000   0.0044 YC     1532.873077  1 0.7081   537 | 0/12
 23 h-m-p  1.2666 8.0000   0.0024 YC     1532.872745  1 0.6946   565 | 0/12
 24 h-m-p  1.6000 8.0000   0.0007 Y      1532.872712  0 0.6770   592 | 0/12
 25 h-m-p  1.6000 8.0000   0.0003 Y      1532.872708  0 0.7482   619 | 0/12
 26 h-m-p  1.6000 8.0000   0.0000 Y      1532.872708  0 0.7988   646 | 0/12
 27 h-m-p  1.6000 8.0000   0.0000 C      1532.872708  0 0.5992   673 | 0/12
 28 h-m-p  1.6000 8.0000   0.0000 Y      1532.872708  0 0.9384   700 | 0/12
 29 h-m-p  1.6000 8.0000   0.0000 Y      1532.872708  0 0.4000   727 | 0/12
 30 h-m-p  0.5285 8.0000   0.0000 -Y     1532.872708  0 0.0330   755
Out..
lnL  = -1532.872708
756 lfun, 2268 eigenQcodon, 13608 P(t)

Time used:  0:08


Model 2: PositiveSelection

TREE #  1
(1, (2, 3), ((4, 5), 6));   MP score: 136
initial w for M2:NSpselection reset.

    0.045058    0.036093    0.031665    0.048232    0.062031    0.015183    0.107982    0.089003    0.364256    1.244185    0.896732    0.199894    0.157918    2.073080

ntime & nrate & np:     9     3    14

Bounds (np=14):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 6.411603

np =    14
lnL0 = -1604.579304

Iterating by ming2
Initial: fx=  1604.579304
x=  0.04506  0.03609  0.03166  0.04823  0.06203  0.01518  0.10798  0.08900  0.36426  1.24418  0.89673  0.19989  0.15792  2.07308

  1 h-m-p  0.0000 0.0020 262.3365 +++CYCCC  1596.810885  4 0.0004    30 | 0/14
  2 h-m-p  0.0002 0.0010 145.5940 ++     1580.592249  m 0.0010    47 | 1/14
  3 h-m-p  0.0006 0.0093 152.8807 +CCCC  1571.220142  3 0.0026    71 | 0/14
  4 h-m-p  0.0006 0.0073 660.2489 CCC    1568.645276  2 0.0002    92 | 0/14
  5 h-m-p  0.0008 0.0040 151.4025 YCC    1564.598350  2 0.0015   112 | 0/14
  6 h-m-p  0.0008 0.0038  94.4425 YCYCCC  1561.133017  5 0.0019   137 | 0/14
  7 h-m-p  0.0006 0.0031  81.5634 +YCYCC  1558.917782  4 0.0018   161 | 0/14
  8 h-m-p  0.0021 0.0142  72.1726 YCCC   1555.645287  3 0.0041   183 | 0/14
  9 h-m-p  0.0034 0.0169  54.8948 CYC    1555.128467  2 0.0010   203 | 0/14
 10 h-m-p  0.0027 0.0137  17.3677 CCCC   1554.460019  3 0.0038   226 | 0/14
 11 h-m-p  0.0025 0.0128  26.5916 CCCCC  1553.167187  4 0.0039   251 | 0/14
 12 h-m-p  0.0040 0.0198  23.2260 +CYCCC  1543.307333  4 0.0174   277 | 0/14
 13 h-m-p  0.1766 0.8828   2.1938 CCCCC  1540.564029  4 0.2358   302 | 0/14
 14 h-m-p  0.1181 0.5904   3.9249 CCCCC  1537.174816  4 0.1622   327 | 0/14
 15 h-m-p  0.0947 0.4737   3.6088 YCCC   1536.499574  3 0.0679   349 | 0/14
 16 h-m-p  0.3985 3.2144   0.6149 YCY    1534.653012  2 0.6656   369 | 0/14
 17 h-m-p  0.4124 2.0622   0.3494 CCCCC  1533.804053  4 0.4843   408 | 0/14
 18 h-m-p  0.7495 3.7475   0.1960 CCC    1533.194900  2 1.1055   443 | 0/14
 19 h-m-p  0.7592 8.0000   0.2854 YCCC   1533.002728  3 0.4822   479 | 0/14
 20 h-m-p  0.5836 4.7384   0.2358 YCC    1532.922538  2 0.4256   513 | 0/14
 21 h-m-p  0.8868 8.0000   0.1132 CC     1532.883934  1 0.9922   546 | 0/14
 22 h-m-p  1.2516 8.0000   0.0897 YC     1532.869142  1 0.6191   578 | 0/14
 23 h-m-p  0.4620 8.0000   0.1202 +CC    1532.816737  1 2.7456   612 | 0/14
 24 h-m-p  1.2118 7.2864   0.2724 YC     1532.789101  1 0.6717   644 | 0/14
 25 h-m-p  0.8526 8.0000   0.2146 CCC    1532.766819  2 0.9809   679 | 0/14
 26 h-m-p  1.6000 8.0000   0.0411 YC     1532.764267  1 0.8724   711 | 0/14
 27 h-m-p  0.8942 8.0000   0.0401 CC     1532.762762  1 1.4325   744 | 0/14
 28 h-m-p  1.6000 8.0000   0.0299 YC     1532.761568  1 2.7931   776 | 0/14
 29 h-m-p  0.9339 8.0000   0.0893 +CC    1532.757867  1 3.7882   810 | 0/14
 30 h-m-p  1.0880 8.0000   0.3109 YY     1532.754552  1 0.9484   842 | 0/14
 31 h-m-p  1.6000 8.0000   0.0818 YC     1532.752720  1 1.1375   874 | 0/14
 32 h-m-p  0.7686 8.0000   0.1210 YC     1532.751882  1 1.7547   906 | 0/14
 33 h-m-p  1.6000 8.0000   0.0459 YC     1532.751386  1 1.0236   938 | 0/14
 34 h-m-p  0.4625 8.0000   0.1015 +YC    1532.751204  1 1.2214   971 | 0/14
 35 h-m-p  1.6000 8.0000   0.0276 C      1532.751166  0 1.5934  1002 | 0/14
 36 h-m-p  1.6000 8.0000   0.0208 C      1532.751161  0 0.5716  1033 | 0/14
 37 h-m-p  1.6000 8.0000   0.0068 Y      1532.751160  0 0.8149  1064 | 0/14
 38 h-m-p  1.6000 8.0000   0.0007 Y      1532.751160  0 1.0307  1095 | 0/14
 39 h-m-p  1.0858 8.0000   0.0007 Y      1532.751160  0 0.7976  1126 | 0/14
 40 h-m-p  1.6000 8.0000   0.0001 Y      1532.751160  0 1.6000  1157 | 0/14
 41 h-m-p  1.6000 8.0000   0.0000 C      1532.751160  0 1.6000  1188 | 0/14
 42 h-m-p  1.6000 8.0000   0.0000 -Y     1532.751160  0 0.1000  1220 | 0/14
 43 h-m-p  0.0160 8.0000   0.0500 -----Y  1532.751160  0 0.0000  1256 | 0/14
 44 h-m-p  0.0160 8.0000   0.0000 -------------..  | 0/14
 45 h-m-p  0.0160 8.0000   0.0002 ------------- | 0/14
 46 h-m-p  0.0160 8.0000   0.0002 -------------
Out..
lnL  = -1532.751160
1383 lfun, 5532 eigenQcodon, 37341 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1541.340018  S = -1465.761437   -67.151413
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 133 patterns   0:21
	did  20 / 133 patterns   0:21
	did  30 / 133 patterns   0:21
	did  40 / 133 patterns   0:22
	did  50 / 133 patterns   0:22
	did  60 / 133 patterns   0:22
	did  70 / 133 patterns   0:22
	did  80 / 133 patterns   0:22
	did  90 / 133 patterns   0:22
	did 100 / 133 patterns   0:22
	did 110 / 133 patterns   0:22
	did 120 / 133 patterns   0:22
	did 130 / 133 patterns   0:22
	did 133 / 133 patterns   0:22
Time used:  0:22


Model 3: discrete

TREE #  1
(1, (2, 3), ((4, 5), 6));   MP score: 136
    0.045058    0.036093    0.031665    0.048232    0.062031    0.015183    0.107982    0.089003    0.364256    1.252662    0.215184    0.509770    0.046108    0.115497    0.167375

ntime & nrate & np:     9     4    15

Bounds (np=15):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   0.000001   0.000001
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 18.831934

np =    15
lnL0 = -1546.539286

Iterating by ming2
Initial: fx=  1546.539286
x=  0.04506  0.03609  0.03166  0.04823  0.06203  0.01518  0.10798  0.08900  0.36426  1.25266  0.21518  0.50977  0.04611  0.11550  0.16737

  1 h-m-p  0.0000 0.0008 133.6324 ++YCCC  1544.029889  3 0.0003    42 | 0/15
  2 h-m-p  0.0001 0.0003 107.1170 ++     1541.908769  m 0.0003    75 | 1/15
  3 h-m-p  0.0000 0.0002 888.8191 ++     1539.215777  m 0.0002   108 | 2/15
  4 h-m-p  0.0010 0.0050  39.7031 YCC    1538.931639  2 0.0006   143 | 1/15
  5 h-m-p  0.0001 0.0004 504.6372 YC     1538.865158  1 0.0000   175 | 1/15
  6 h-m-p  0.0003 0.0090  43.4051 +CCC   1538.431638  2 0.0009   212 | 0/15
  7 h-m-p  0.0007 0.0035  48.1583 YCCC   1537.922868  3 0.0005   249 | 0/15
  8 h-m-p  0.0008 0.0039  24.1319 YCC    1537.811851  2 0.0004   285 | 0/15
  9 h-m-p  0.0006 0.0057  16.4178 YC     1537.692172  1 0.0012   319 | 0/15
 10 h-m-p  0.0024 0.0316   8.6503 CC     1537.588766  1 0.0029   354 | 0/15
 11 h-m-p  0.0011 0.0117  23.9591 CCC    1537.492423  2 0.0011   391 | 0/15
 12 h-m-p  0.0020 0.0373  12.8336 YCCC   1537.300630  3 0.0044   429 | 0/15
 13 h-m-p  0.0014 0.0338  40.9965 +CCCCC  1535.959998  4 0.0092   471 | 0/15
 14 h-m-p  0.0007 0.0035  63.0633 YCCC   1535.864806  3 0.0005   509 | 0/15
 15 h-m-p  0.0341 0.1707   0.6685 YCCCC  1535.067644  4 0.0793   549 | 0/15
 16 h-m-p  0.1110 6.2973   0.4775 +YCC   1534.939684  2 0.3563   586 | 0/15
 17 h-m-p  0.0895 1.4582   1.9001 YCCC   1534.640081  3 0.1822   624 | 0/15
 18 h-m-p  1.6000 8.0000   0.1818 CCC    1534.174137  2 2.1176   661 | 0/15
 19 h-m-p  0.6466 8.0000   0.5952 CCCC   1533.898948  3 0.9741   700 | 0/15
 20 h-m-p  0.9526 8.0000   0.6086 CC     1533.528754  1 0.8020   735 | 0/15
 21 h-m-p  1.6000 8.0000   0.0785 CCC    1533.228666  2 2.0843   772 | 0/15
 22 h-m-p  1.6000 8.0000   0.0331 CC     1533.115923  1 1.6118   807 | 0/15
 23 h-m-p  0.4076 8.0000   0.1310 +CC    1533.046737  1 1.6732   843 | 0/15
 24 h-m-p  1.6000 8.0000   0.0881 CCCC   1532.891730  3 2.5394   882 | 0/15
 25 h-m-p  1.6000 8.0000   0.1287 CCC    1532.766409  2 1.8890   919 | 0/15
 26 h-m-p  1.6000 8.0000   0.0365 YC     1532.753156  1 1.0611   953 | 0/15
 27 h-m-p  0.8223 8.0000   0.0471 CC     1532.751137  1 0.9132   988 | 0/15
 28 h-m-p  1.6000 8.0000   0.0093 CC     1532.750199  1 1.8392  1023 | 0/15
 29 h-m-p  1.6000 8.0000   0.0030 ++     1532.747354  m 8.0000  1056 | 0/15
 30 h-m-p  1.6000 8.0000   0.0122 +YCC   1532.733212  2 5.4279  1093 | 0/15
 31 h-m-p  1.3825 7.3793   0.0477 CCCCC  1532.704785  4 1.7887  1134 | 0/15
 32 h-m-p  0.3097 2.7832   0.2756 CYCCC  1532.670249  4 0.4912  1174 | 0/15
 33 h-m-p  0.5503 8.0000   0.2460 YC     1532.615303  1 0.9545  1208 | 0/15
 34 h-m-p  1.3051 8.0000   0.1799 YYC    1532.590142  2 1.1008  1243 | 0/15
 35 h-m-p  1.6000 8.0000   0.0286 YC     1532.587654  1 0.6683  1277 | 0/15
 36 h-m-p  1.6000 8.0000   0.0115 C      1532.586721  0 1.6594  1310 | 0/15
 37 h-m-p  1.6000 8.0000   0.0063 C      1532.586462  0 1.5759  1343 | 0/15
 38 h-m-p  1.6000 8.0000   0.0008 Y      1532.586433  0 2.6849  1376 | 0/15
 39 h-m-p  1.2077 8.0000   0.0018 ++     1532.586146  m 8.0000  1409 | 0/15
 40 h-m-p  0.1002 8.0000   0.1454 ++YYY  1532.583430  2 1.4517  1446 | 0/15
 41 h-m-p  1.6000 8.0000   0.0979 YYC    1532.580454  2 1.6000  1481 | 0/15
 42 h-m-p  0.5884 2.9420   0.2224 CYC    1532.575848  2 0.8794  1517 | 0/15
 43 h-m-p  1.6000 8.0000   0.0564 CC     1532.574465  1 0.3612  1552 | 0/15
 44 h-m-p  0.1847 3.9043   0.1103 +YCYC  1532.571637  3 1.9090  1590 | 0/15
 45 h-m-p  0.4312 2.1562   0.0963 YC     1532.570343  1 0.7395  1624 | 0/15
 46 h-m-p  0.1179 0.5894   0.1945 ++     1532.567631  m 0.5894  1657 | 1/15
 47 h-m-p  1.6000 8.0000   0.0612 -C     1532.567542  0 0.1415  1691 | 1/15
 48 h-m-p  0.5770 8.0000   0.0150 C      1532.567402  0 0.7510  1723 | 1/15
 49 h-m-p  1.6000 8.0000   0.0070 Y      1532.567388  0 0.2930  1755 | 1/15
 50 h-m-p  1.4007 8.0000   0.0015 C      1532.567386  0 1.3960  1787 | 1/15
 51 h-m-p  1.6000 8.0000   0.0004 Y      1532.567386  0 1.1821  1819 | 1/15
 52 h-m-p  1.6000 8.0000   0.0000 Y      1532.567386  0 0.9803  1851 | 1/15
 53 h-m-p  1.6000 8.0000   0.0000 C      1532.567386  0 1.6000  1883 | 1/15
 54 h-m-p  1.6000 8.0000   0.0000 ----------------..  | 1/15
 55 h-m-p  0.0160 8.0000   0.0001 ------C  1532.567386  0 0.0000  1967
Out..
lnL  = -1532.567386
1968 lfun, 7872 eigenQcodon, 53136 P(t)

Time used:  0:41


Model 7: beta

TREE #  1
(1, (2, 3), ((4, 5), 6));   MP score: 136
    0.045058    0.036093    0.031665    0.048232    0.062031    0.015183    0.107982    0.089003    0.364256    1.245177    0.603915    1.022819

ntime & nrate & np:     9     1    12

Bounds (np=12):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 10.767160

np =    12
lnL0 = -1569.779052

Iterating by ming2
Initial: fx=  1569.779052
x=  0.04506  0.03609  0.03166  0.04823  0.06203  0.01518  0.10798  0.08900  0.36426  1.24518  0.60392  1.02282

  1 h-m-p  0.0000 0.0027 185.9657 ++YYCCC  1566.419298  4 0.0003    37 | 0/12
  2 h-m-p  0.0006 0.0077  87.4737 +CYYCCC  1547.520625  5 0.0048    74 | 0/12
  3 h-m-p  0.0001 0.0003 1009.2147 CCCCC  1544.958902  4 0.0001   109 | 0/12
  4 h-m-p  0.0003 0.0015 100.4927 CCCCC  1543.936880  4 0.0004   144 | 0/12
  5 h-m-p  0.0008 0.0042  30.3290 CCCC   1543.569139  3 0.0010   177 | 0/12
  6 h-m-p  0.0006 0.0067  45.0587 +YYCCC  1542.522825  4 0.0022   211 | 0/12
  7 h-m-p  0.0004 0.0035 227.6126 +YCCCC  1539.801877  4 0.0012   246 | 0/12
  8 h-m-p  0.0006 0.0030 364.4521 YCCC   1538.378198  3 0.0005   278 | 0/12
  9 h-m-p  0.0004 0.0018 205.7149 CYCCC  1537.359426  4 0.0005   312 | 0/12
 10 h-m-p  0.0057 0.0286   8.3297 CYC    1537.317892  2 0.0013   342 | 0/12
 11 h-m-p  0.0013 0.0540   8.5859 YCC    1537.262169  2 0.0023   372 | 0/12
 12 h-m-p  0.0103 0.6879   1.9484 ++YCCC  1536.774769  3 0.1058   406 | 0/12
 13 h-m-p  0.2656 1.3279   0.4219 YCCC   1534.974166  3 0.4262   438 | 0/12
 14 h-m-p  1.4891 7.4457   0.0507 YCC    1534.729435  2 1.1305   468 | 0/12
 15 h-m-p  0.7368 8.0000   0.0778 YC     1534.652442  1 1.5112   496 | 0/12
 16 h-m-p  1.1271 8.0000   0.1043 +YYC   1534.444198  2 4.0917   526 | 0/12
 17 h-m-p  1.5597 7.7985   0.1690 YYC    1534.347974  2 1.1403   555 | 0/12
 18 h-m-p  1.6000 8.0000   0.0829 YC     1534.326131  1 0.7834   583 | 0/12
 19 h-m-p  1.6000 8.0000   0.0328 YC     1534.322808  1 1.0042   611 | 0/12
 20 h-m-p  1.6000 8.0000   0.0026 YC     1534.322661  1 1.0472   639 | 0/12
 21 h-m-p  1.6000 8.0000   0.0002 C      1534.322650  0 1.2850   666 | 0/12
 22 h-m-p  1.6000 8.0000   0.0001 Y      1534.322648  0 1.2480   693 | 0/12
 23 h-m-p  1.6000 8.0000   0.0001 Y      1534.322648  0 0.9629   720 | 0/12
 24 h-m-p  1.6000 8.0000   0.0000 Y      1534.322648  0 0.9784   747 | 0/12
 25 h-m-p  1.6000 8.0000   0.0000 C      1534.322648  0 2.4602   774 | 0/12
 26 h-m-p  1.6000 8.0000   0.0000 ---C   1534.322648  0 0.0099   804
Out..
lnL  = -1534.322648
805 lfun, 8855 eigenQcodon, 72450 P(t)

Time used:  1:07


Model 8: beta&w>1

TREE #  1
(1, (2, 3), ((4, 5), 6));   MP score: 136
initial w for M8:NSbetaw>1 reset.

    0.045058    0.036093    0.031665    0.048232    0.062031    0.015183    0.107982    0.089003    0.364256    1.230057    0.900000    0.523761    1.873198    2.941449

ntime & nrate & np:     9     2    14

Bounds (np=14):
   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 9.074973

np =    14
lnL0 = -1567.192223

Iterating by ming2
Initial: fx=  1567.192223
x=  0.04506  0.03609  0.03166  0.04823  0.06203  0.01518  0.10798  0.08900  0.36426  1.23006  0.90000  0.52376  1.87320  2.94145

  1 h-m-p  0.0000 0.0004 353.0643 +++    1551.347991  m 0.0004    34 | 0/14
  2 h-m-p  0.0005 0.0024  62.9754 YCYCCC  1548.994857  5 0.0011    73 | 0/14
  3 h-m-p  0.0004 0.0028 184.4516 +YYCCC  1543.364889  4 0.0012   111 | 0/14
  4 h-m-p  0.0002 0.0011 275.0161 CYCCC  1541.229061  4 0.0003   149 | 0/14
  5 h-m-p  0.0006 0.0029  55.8293 CYC    1540.756940  2 0.0005   183 | 0/14
  6 h-m-p  0.0020 0.0101  14.6292 YCCC   1540.633032  3 0.0013   219 | 0/14
  7 h-m-p  0.0007 0.0351  25.9140 YCCC   1540.421978  3 0.0016   255 | 0/14
  8 h-m-p  0.0013 0.0080  31.3248 YCC    1540.306406  2 0.0008   289 | 0/14
  9 h-m-p  0.0029 0.0574   8.6554 CYC    1540.210339  2 0.0035   323 | 0/14
 10 h-m-p  0.0028 0.0197  10.9981 YCC    1540.154634  2 0.0018   357 | 0/14
 11 h-m-p  0.0013 0.0595  15.3138 ++YYC  1539.380857  2 0.0170   392 | 0/14
 12 h-m-p  0.0021 0.0106 126.4576 YCCCCC  1537.618056  5 0.0046   432 | 0/14
 13 h-m-p  0.0990 0.4949   3.2336 CCCCC  1536.577563  4 0.1264   471 | 0/14
 14 h-m-p  0.0900 0.4502   0.8862 +YYCCC  1534.110170  4 0.3056   509 | 0/14
 15 h-m-p  0.6509 5.7942   0.4161 CCC    1533.228095  2 0.6306   544 | 0/14
 16 h-m-p  0.4811 3.3681   0.5453 CCCC   1532.941225  3 0.5159   581 | 0/14
 17 h-m-p  1.6000 8.0000   0.1198 YC     1532.889248  1 0.7830   613 | 0/14
 18 h-m-p  0.8009 8.0000   0.1171 YC     1532.860529  1 1.3731   645 | 0/14
 19 h-m-p  0.9893 8.0000   0.1626 YCC    1532.821330  2 1.8630   679 | 0/14
 20 h-m-p  1.6000 8.0000   0.1666 CCC    1532.776747  2 2.3594   714 | 0/14
 21 h-m-p  1.4208 8.0000   0.2767 CC     1532.732798  1 1.8374   747 | 0/14
 22 h-m-p  1.5215 8.0000   0.3342 CCC    1532.694111  2 1.9533   782 | 0/14
 23 h-m-p  1.4423 8.0000   0.4526 CCC    1532.650049  2 1.8761   817 | 0/14
 24 h-m-p  1.6000 8.0000   0.4675 CY     1532.617078  1 1.6326   850 | 0/14
 25 h-m-p  1.5496 8.0000   0.4925 CC     1532.604579  1 1.8755   883 | 0/14
 26 h-m-p  1.5137 8.0000   0.6103 CC     1532.597349  1 1.1748   916 | 0/14
 27 h-m-p  1.3153 8.0000   0.5451 CC     1532.591304  1 1.4573   949 | 0/14
 28 h-m-p  1.6000 8.0000   0.4123 C      1532.586901  0 1.7887   980 | 0/14
 29 h-m-p  1.6000 8.0000   0.2656 CC     1532.584076  1 2.0280  1013 | 0/14
 30 h-m-p  1.6000 8.0000   0.0327 C      1532.583157  0 1.5163  1044 | 0/14
 31 h-m-p  1.1787 8.0000   0.0420 C      1532.582954  0 1.2462  1075 | 0/14
 32 h-m-p  0.6919 8.0000   0.0757 +Y     1532.582917  0 1.7697  1107 | 0/14
 33 h-m-p  1.6000 8.0000   0.0349 Y      1532.582914  0 1.0219  1138 | 0/14
 34 h-m-p  1.6000 8.0000   0.0041 Y      1532.582913  0 0.8056  1169 | 0/14
 35 h-m-p  1.6000 8.0000   0.0002 Y      1532.582913  0 0.9517  1200 | 0/14
 36 h-m-p  1.6000 8.0000   0.0001 -C     1532.582913  0 0.1000  1232 | 0/14
 37 h-m-p  0.1999 8.0000   0.0000 ---C   1532.582913  0 0.0008  1266
Out..
lnL  = -1532.582913
1267 lfun, 15204 eigenQcodon, 125433 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
	log(fX) = -1542.186956  S = -1465.769142   -68.701930
Calculating f(w|X), posterior probabilities of site classes.

	did  10 / 133 patterns   1:53
	did  20 / 133 patterns   1:53
	did  30 / 133 patterns   1:53
	did  40 / 133 patterns   1:54
	did  50 / 133 patterns   1:54
	did  60 / 133 patterns   1:54
	did  70 / 133 patterns   1:54
	did  80 / 133 patterns   1:54
	did  90 / 133 patterns   1:55
	did 100 / 133 patterns   1:55
	did 110 / 133 patterns   1:55
	did 120 / 133 patterns   1:55
	did 130 / 133 patterns   1:55
	did 133 / 133 patterns   1:56
Time used:  1:56
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=232 

D_melanogaster_PGRP-LB-PA   MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
D_sechellia_PGRP-LB-PA      MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
D_simulans_PGRP-LB-PA       MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
D_yakuba_PGRP-LB-PA         MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
D_erecta_PGRP-LB-PA         MQQANLG----TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
D_elegans_PGRP-LB-PA        MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
                            **:****    ******************:**:**************.**

D_melanogaster_PGRP-LB-PA   YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
D_sechellia_PGRP-LB-PA      YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
D_simulans_PGRP-LB-PA       YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
D_yakuba_PGRP-LB-PA         YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
D_erecta_PGRP-LB-PA         YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH
D_elegans_PGRP-LB-PA        YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
                            *:**:**********************************:******:***

D_melanogaster_PGRP-LB-PA   APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
D_sechellia_PGRP-LB-PA      APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
D_simulans_PGRP-LB-PA       APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
D_yakuba_PGRP-LB-PA         APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
D_erecta_PGRP-LB-PA         APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL
D_elegans_PGRP-LB-PA        APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
                            ******:***********************::**:***************

D_melanogaster_PGRP-LB-PA   GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQA
D_sechellia_PGRP-LB-PA      GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQA
D_simulans_PGRP-LB-PA       GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQA
D_yakuba_PGRP-LB-PA         GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
D_erecta_PGRP-LB-PA         GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQA
D_elegans_PGRP-LB-PA        GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQA
                            ********************.******:. ::*    * .*: **.*.:*

D_melanogaster_PGRP-LB-PA   AAP---QKPHQSPP----AAPKVooooo----
D_sechellia_PGRP-LB-PA      AAP---QTPHQSPP----AAPKVooooo----
D_simulans_PGRP-LB-PA       AAP---QTPHQSPP----AAPKVooooo----
D_yakuba_PGRP-LB-PA         ATQ---TPLAQSPP----AAPKVoooo-----
D_erecta_PGRP-LB-PA         ATQ---QTPPKSPP----AAPKVooooooooo
D_elegans_PGRP-LB-PA        ASQTPPQSPPQSPPHAPAAAPKV---------
                            *:        :***    *****         



>D_melanogaster_PGRP-LB-PA
ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTGTC
CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGAGCACTTCCAGG
GTCCCGCGCCCTACGTCATCATCCATCACTCGTACATGCCGGCCGTGTGC
TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
GCGATGGCATGATTTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCACCCAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG
GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
TCGCCTTTGGCGTTTTCAAGGGCTACATTGACCCTGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTGTTCGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG
TC---AGCAGCACCACGGCGCCCGTCGTGCCCCACGTCCATCCACAGGCG
GCAGCACCA---------CAAAAGCCGCACCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>D_sechellia_PGRP-LB-PA
ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC
CCGATCCGACTGGGGTGCCCGGCTGCCCAAGTCTGTGGACCACTTCCAGG
GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCGGCCGTGTGC
TACTCCACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
TCGCCTTCGGAGTTTTCAAGGGCTACATTGACCCCGCCTACAAACTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTCTTCGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCAGCGACGGCG
AG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG
GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>D_simulans_PGRP-LB-PA
ATGCAGCAGGCGAATCTGGGCGACGGTGTGGCCACCGCCCGCCTGCTTTC
CCGATCCGACTGGGGTGCACGGCTGCCCAAGTCCGTGGAGCACTTCCAGG
GACCAGCGCCTTACGTCATCATCCACCACTCGTATATGCCGGCCGTGTGC
TACTCAACTCCGGAATGCATGAAGAGCATGCGGGACATGCAGGACTTTCA
TCAGCTGGAGCGCGGATGGAACGATATTGGTTATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCACCGAAGTACAATGACAAGAGCGTGGGCATTGTGCTGATCGGAGATTG
GAGAACCGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAAGAACCTGA
TCGCCTTCGGCGTTTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGCGGCCGCCTCTTCGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCG
TG---AGCAGCACTGCGGCGCCCGTCGTGCCCCATGTCCATGCACAGGCG
GCAGCACCA---------CAAACGCCGCACCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>D_yakuba_PGRP-LB-PA
ATGCAGCAGGCAAATCTGGGCGATGGTGTGGCCACCGCCCGACTGCTGTC
CAGATCCGACTGGGGTGCCCGGCTGCCCAAGTCCGTGGACCACTTTCAGG
GACCCGCGCCCTACGTCATCATCCACCACTCGTACATGCCAGGCGTGTGC
TACTCCACTCCGGAGTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
CCAGCTGGAGCGCGGATGGAACGATATCGGATATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACACCGGCAGGGGATTCAATGTCGTCGGAGCTCAT
GCGCCGAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACTGAACTGCCGCCCAAGCAGATGCTGGATGCGGCCAGGAACCTGA
TCTCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGAGGCCGCCTGTTTGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACCTAAGCGAAACCGAAGGCG
TAGTTAGCAGCACTGCTGCGCCCGTCGAGCCCCACGTCCATCCAAAGGCG
GCAACACAA---------ACGCCACTCGCCCAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>D_erecta_PGRP-LB-PA
ATGCAGCAGGCGAATCTGGGC------------ACCGCCCGGCTTCTGTC
CCGATCCGACTGGGGTGCCCGCCTGCCCAAGTCCGTGGAGCACTTTCAAG
GACCCGCGCCCTACGTGATCATCCACCACTCGTACATGCCAGCCGTGTGC
TACTCCACTCCGGACTGCATGAAGAGCATGCGGGACATGCAGGACTTCCA
CCAGCTGGAGCGCGGTTGGAACGATATCGGATATAGCTTTGGCATCGGCG
GCGATGGCATGATCTACGCAGGCAGGGGATTCAATGTCATCGGAGCTCAT
GCGCCGAAGTACAATGACAGGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACTGAACTTCCGCCCAAGCAGATGCTGGATGCGGCCAAGGACCTGA
TCGCCTTCGGGGTGTTCAAGGGCTACATTGACCCCGCCTACAAGCTGCTG
GGCCACCGACAGGTGCGGGATACCGAGTGTCCTGGGGGCCGCCTGTTTGC
CGAGATCTCCAGCTGGCCGCACTTTACCCACATAAACGACACCGAAGGCG
TT---AGCAGTACGAAGGCGCCGGTCGAGCCCCACGTCCATCCACAGGCG
GCAACACAA---------CAAACGCCGCCCAAATCCCCGCCA--------
----GCTGCGCCCAAGGTC---------------------------
>D_elegans_PGRP-LB-PA
ATGCAGCATGCGAATTTGGGCGATGGAGCGGCCACCGCTCGACTTCTGTC
CCGCTCCGACTGGGGCGCCCGTCTGCCCAAGTCCGTGGAGCACTTCGAGG
GTCCCGCCCCCTACGTGATCATCCACCACTCTTACATGCCGGCGGTGTGC
TATACCACTCCCGACTGCATGAAGAGCATGCGCGACATGCAGGACTTCCA
CCAGCTGGAGCGCGGTTGGAACGACATCGGCTATAGCTTCGGCATCGGCG
GCGATGGCATGATCTACACCGGAAGGGGATTCAACGTTATCGGAGCTCAT
GCACCCAAGTACAATGACAAGAGCGTGGGCATCGTGCTGATCGGAGATTG
GAGAACTGAACTGCCGCCCAAACAGATGCTGGACGCGGCCAAAAACCTGA
TCGCCTTCGGCGTGTTCAAGGGCTACATTGACCCCGCATACAAGCTGCTG
GGCCACCGACAGGTTCGTGACACCGAGTGTCCCGGAGGCAGGCTGTTCGC
GGAGATCTCCGGCTGGCCGCACTTTACCCACCTAAACGCCACCGAAGGCA
GC---------ACCCCCGTCCCCATTGAACCGCACGCACATCCCCAGGCG
GCGTCCCAAACGCCACCCCAATCACCACCCCAATCGCCACCCCATGCCCC
GGCAGCTGCGCCCAAGGTC---------------------------
>D_melanogaster_PGRP-LB-PA
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTTAPVVPHVHPQA
AAP---QKPHQSPP----AAPKV
>D_sechellia_PGRP-LB-PA
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNASDGE-SSTAAPVVPHVHAQA
AAP---QTPHQSPP----AAPKV
>D_simulans_PGRP-LB-PA
MQQANLGDGVATARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLNATEGV-SSTAAPVVPHVHAQA
AAP---QTPHQSPP----AAPKV
>D_yakuba_PGRP-LB-PA
MQQANLGDGVATARLLSRSDWGARLPKSVDHFQGPAPYVIIHHSYMPGVC
YSTPECMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVVGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAARNLISFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHLSETEGVVSSTAAPVEPHVHPKA
ATQ---TPLAQSPP----AAPKV
>D_erecta_PGRP-LB-PA
MQQANLG----TARLLSRSDWGARLPKSVEHFQGPAPYVIIHHSYMPAVC
YSTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYAGRGFNVIGAH
APKYNDRSVGIVLIGDWRTELPPKQMLDAAKDLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISSWPHFTHINDTEGV-SSTKAPVEPHVHPQA
ATQ---QTPPKSPP----AAPKV
>D_elegans_PGRP-LB-PA
MQHANLGDGAATARLLSRSDWGARLPKSVEHFEGPAPYVIIHHSYMPAVC
YTTPDCMKSMRDMQDFHQLERGWNDIGYSFGIGGDGMIYTGRGFNVIGAH
APKYNDKSVGIVLIGDWRTELPPKQMLDAAKNLIAFGVFKGYIDPAYKLL
GHRQVRDTECPGGRLFAEISGWPHFTHLNATEGS---TPVPIEPHAHPQA
ASQTPPQSPPQSPPHAPAAAPKV
#NEXUS

[ID: 6645016897]
begin taxa;
	dimensions ntax=6;
	taxlabels
		D_melanogaster_PGRP-LB-PA
		D_sechellia_PGRP-LB-PA
		D_simulans_PGRP-LB-PA
		D_yakuba_PGRP-LB-PA
		D_erecta_PGRP-LB-PA
		D_elegans_PGRP-LB-PA
		;
end;
begin trees;
	translate
		1	D_melanogaster_PGRP-LB-PA,
		2	D_sechellia_PGRP-LB-PA,
		3	D_simulans_PGRP-LB-PA,
		4	D_yakuba_PGRP-LB-PA,
		5	D_erecta_PGRP-LB-PA,
		6	D_elegans_PGRP-LB-PA
		;
   [Note: This tree contains information on the topology, 
          branch lengths (if present), and the probability
          of the partition indicated by the branch.]
   tree con_50_majrule = (1:0.02089233,(2:0.02099633,3:0.01725137)1.000:0.02004242,((4:0.0599343,5:0.04419744)0.623:0.02014145,6:0.2526535)0.983:0.03823603);

   [Note: This tree contains information only on the topology
          and branch lengths (median of the posterior probability density).]
   tree con_50_majrule = (1:0.02089233,(2:0.02099633,3:0.01725137):0.02004242,((4:0.0599343,5:0.04419744):0.02014145,6:0.2526535):0.03823603);
end;
      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1692.83         -1704.06
2      -1692.97         -1702.35
--------------------------------------
TOTAL    -1692.90         -1703.53
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.509316    0.007044    0.359800    0.679892    0.500719   1202.45   1338.89    1.000
r(A<->C){all}   0.170758    0.001571    0.095516    0.247501    0.168197   1006.81   1016.53    1.000
r(A<->G){all}   0.197671    0.002124    0.113098    0.287850    0.194573    838.12    939.26    1.000
r(A<->T){all}   0.125383    0.002457    0.037241    0.223956    0.121201    798.88    816.36    1.002
r(C<->G){all}   0.091126    0.000620    0.046639    0.141531    0.089217    759.34    950.59    1.000
r(C<->T){all}   0.290206    0.002857    0.188865    0.395164    0.287919    776.53    813.18    1.000
r(G<->T){all}   0.124855    0.001628    0.052527    0.204650    0.122711    802.35    861.93    1.000
pi(A){all}      0.211329    0.000222    0.181623    0.240371    0.210996   1152.34   1181.95    1.000
pi(C){all}      0.343335    0.000302    0.307559    0.375774    0.343214    721.27   1069.15    1.001
pi(G){all}      0.279740    0.000281    0.247211    0.312450    0.279161   1062.70   1170.61    1.000
pi(T){all}      0.165596    0.000186    0.137426    0.191083    0.165414    749.18    996.92    1.001
alpha{1,2}      0.098621    0.003076    0.000341    0.187798    0.100953   1085.13   1155.32    1.000
alpha{3}        1.959812    0.576557    0.739869    3.481837    1.832250   1391.28   1446.14    1.000
pinvar{all}     0.308807    0.012414    0.080070    0.496071    0.315026    880.50    900.15    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014)  /opt/ADOPS/346/PGRP-LB-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches, 
Codon frequency model: F3x4
Site-class models: 
ns =   6  ls = 209

Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT   3   2   3   4   4   1 | Ser TCT   0   1   0   0   0   1 | Tyr TAT   1   1   2   1   1   2 | Cys TGT   1   1   1   1   1   1
    TTC   5   6   5   4   4   7 |     TCC   6   5   5   7   6   5 |     TAC   7   7   6   7   7   6 |     TGC   2   2   2   2   2   2
Leu TTA   0   0   0   0   0   0 |     TCA   0   0   1   0   0   1 | *** TAA   0   0   0   0   0   0 | *** TGA   0   0   0   0   0   0
    TTG   0   0   0   0   0   1 |     TCG   1   1   1   1   1   1 |     TAG   0   0   0   0   0   0 | Trp TGG   4   4   4   4   4   4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT   0   1   1   0   2   1 | Pro CCT   2   1   2   1   1   0 | His CAT   4   4   4   2   2   3 | Arg CGT   0   0   0   0   0   2
    CTC   0   1   1   1   0   0 |     CCC   8   9   6   8   8  14 |     CAC   7   7   7   8   8   8 |     CGC   3   3   3   2   3   3
    CTA   0   1   1   1   0   1 |     CCA   3   2   3   4   3   2 | Gln CAA   2   2   2   2   3   3 |     CGA   2   2   2   2   2   2
    CTG  12  10  10  12  10  10 |     CCG   6   6   7   5   7   4 |     CAG   8   8   8   7   7   6 |     CGG   3   3   3   3   3   0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT   4   2   3   1   1   2 | Thr ACT   1   2   2   3   2   2 | Asn AAT   3   3   3   3   3   2 | Ser AGT   0   0   0   0   0   0
    ATC   7   9   8   9  10  10 |     ACC   7   5   6   5   4   7 |     AAC   3   3   3   2   2   4 |     AGC   4   5   4   5   4   4
    ATA   1   0   0   0   1   0 |     ACA   0   0   0   1   1   0 | Lys AAA   0   1   0   0   1   2 | Arg AGA   1   1   1   2   1   1
Met ATG   7   7   7   7   7   7 |     ACG   1   1   1   1   2   0 |     AAG  10   8   9   9   9   7 |     AGG   1   1   1   2   2   2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT   1   1   1   0   1   2 | Ala GCT   2   2   2   3   2   3 | Asp GAT   5   5   5   5   5   2 | Gly GGT   3   2   2   1   2   2
    GTC   6   5   5   6   4   2 |     GCC   7   8   7   6   7   5 |     GAC   7   7   5   6   8   9 |     GGC  13  11  13  12  11  14
    GTA   0   0   0   1   0   0 |     GCA   3   4   5   2   2   3 | Glu GAA   2   2   3   3   2   3 |     GGA   4   7   5   7   5   5
    GTG   6   6   7   6   7   6 |     GCG   6   7   7   6   7   7 |     GAG   4   4   4   5   5   5 |     GGG   0   0   0   1   2   0
--------------------------------------------------------------------------------------------------------------------------------------

Codon position x base (3x4) table for each sequence.

#1: D_melanogaster_PGRP-LB-PA             
position  1:    T:0.14354    C:0.28708    A:0.23923    G:0.33014
position  2:    T:0.24880    C:0.25359    A:0.30144    G:0.19617
position  3:    T:0.14354    C:0.44019    A:0.08612    G:0.33014
Average         T:0.17863    C:0.32695    A:0.20893    G:0.28549

#2: D_sechellia_PGRP-LB-PA             
position  1:    T:0.14354    C:0.28708    A:0.22967    G:0.33971
position  2:    T:0.24402    C:0.25837    A:0.29665    G:0.20096
position  3:    T:0.13397    C:0.44498    A:0.10526    G:0.31579
Average         T:0.17384    C:0.33014    A:0.21053    G:0.28549

#3: D_simulans_PGRP-LB-PA             
position  1:    T:0.14354    C:0.28708    A:0.22967    G:0.33971
position  2:    T:0.24880    C:0.26316    A:0.29187    G:0.19617
position  3:    T:0.14833    C:0.41148    A:0.11005    G:0.33014
Average         T:0.18022    C:0.32057    A:0.21053    G:0.28868

#4: D_yakuba_PGRP-LB-PA             
position  1:    T:0.14833    C:0.27751    A:0.23923    G:0.33493
position  2:    T:0.24880    C:0.25359    A:0.28708    G:0.21053
position  3:    T:0.11962    C:0.43062    A:0.11962    G:0.33014
Average         T:0.17225    C:0.32057    A:0.21531    G:0.29187

#5: D_erecta_PGRP-LB-PA             
position  1:    T:0.14354    C:0.28230    A:0.23923    G:0.33493
position  2:    T:0.24402    C:0.25359    A:0.30144    G:0.20096
position  3:    T:0.12919    C:0.42105    A:0.10048    G:0.34928
Average         T:0.17225    C:0.31898    A:0.21372    G:0.29506

#6: D_elegans_PGRP-LB-PA             
position  1:    T:0.15311    C:0.28230    A:0.23923    G:0.32536
position  2:    T:0.23923    C:0.26316    A:0.29665    G:0.20096
position  3:    T:0.12440    C:0.47847    A:0.11005    G:0.28708
Average         T:0.17225    C:0.34131    A:0.21531    G:0.27113

Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT      17 | Ser S TCT       2 | Tyr Y TAT       8 | Cys C TGT       6
      TTC      31 |       TCC      34 |       TAC      40 |       TGC      12
Leu L TTA       0 |       TCA       2 | *** * TAA       0 | *** * TGA       0
      TTG       1 |       TCG       6 |       TAG       0 | Trp W TGG      24
------------------------------------------------------------------------------
Leu L CTT       5 | Pro P CCT       7 | His H CAT      19 | Arg R CGT       2
      CTC       3 |       CCC      53 |       CAC      45 |       CGC      17
      CTA       4 |       CCA      17 | Gln Q CAA      14 |       CGA      12
      CTG      64 |       CCG      35 |       CAG      44 |       CGG      15
------------------------------------------------------------------------------
Ile I ATT      13 | Thr T ACT      12 | Asn N AAT      17 | Ser S AGT       0
      ATC      53 |       ACC      34 |       AAC      17 |       AGC      26
      ATA       2 |       ACA       2 | Lys K AAA       4 | Arg R AGA       7
Met M ATG      42 |       ACG       6 |       AAG      52 |       AGG       9
------------------------------------------------------------------------------
Val V GTT       6 | Ala A GCT      14 | Asp D GAT      27 | Gly G GGT      12
      GTC      28 |       GCC      40 |       GAC      42 |       GGC      74
      GTA       1 |       GCA      19 | Glu E GAA      15 |       GGA      33
      GTG      38 |       GCG      40 |       GAG      27 |       GGG       3
------------------------------------------------------------------------------


Codon position x base (3x4) table, overall

position  1:    T:0.14593    C:0.28389    A:0.23604    G:0.33413
position  2:    T:0.24561    C:0.25758    A:0.29585    G:0.20096
position  3:    T:0.13317    C:0.43780    A:0.10526    G:0.32376
Average         T:0.17491    C:0.32642    A:0.21239    G:0.28628


Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)

D_melanogaster_PGRP-LB-PA                  
D_sechellia_PGRP-LB-PA                   0.2199 (0.0224 0.1020)
D_simulans_PGRP-LB-PA                   0.1059 (0.0128 0.1205) 0.1023 (0.0085 0.0829)
D_yakuba_PGRP-LB-PA                   0.2269 (0.0457 0.2013) 0.2364 (0.0445 0.1884) 0.1743 (0.0401 0.2304)
D_erecta_PGRP-LB-PA                   0.0965 (0.0213 0.2210) 0.1924 (0.0400 0.2077) 0.1221 (0.0301 0.2465) 0.3753 (0.0467 0.1245)
D_elegans_PGRP-LB-PA                   0.0826 (0.0411 0.4968) 0.0903 (0.0474 0.5246) 0.0657 (0.0400 0.6093) 0.1268 (0.0611 0.4815) 0.0878 (0.0444 0.5052)


Model 0: one-ratio


TREE #  1:  (1, (2, 3), ((4, 5), 6));   MP score: 136
lnL(ntime:  9  np: 11):  -1547.550018      +0.000000
   7..1     7..8     8..2     8..3     7..9     9..10   10..4    10..5     9..6  
 0.050970 0.037015 0.042771 0.037376 0.065407 0.029097 0.119880 0.094743 0.370545 1.213294 0.092216

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.84780

(1: 0.050970, (2: 0.042771, 3: 0.037376): 0.037015, ((4: 0.119880, 5: 0.094743): 0.029097, 6: 0.370545): 0.065407);

(D_melanogaster_PGRP-LB-PA: 0.050970, (D_sechellia_PGRP-LB-PA: 0.042771, D_simulans_PGRP-LB-PA: 0.037376): 0.037015, ((D_yakuba_PGRP-LB-PA: 0.119880, D_erecta_PGRP-LB-PA: 0.094743): 0.029097, D_elegans_PGRP-LB-PA: 0.370545): 0.065407);

Detailed output identifying parameters

kappa (ts/tv) =  1.21329

omega (dN/dS) =  0.09222

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1      0.051   504.6   122.4  0.0922  0.0058  0.0630   2.9   7.7
   7..8      0.037   504.6   122.4  0.0922  0.0042  0.0458   2.1   5.6
   8..2      0.043   504.6   122.4  0.0922  0.0049  0.0529   2.5   6.5
   8..3      0.037   504.6   122.4  0.0922  0.0043  0.0462   2.2   5.7
   7..9      0.065   504.6   122.4  0.0922  0.0075  0.0809   3.8   9.9
   9..10     0.029   504.6   122.4  0.0922  0.0033  0.0360   1.7   4.4
  10..4      0.120   504.6   122.4  0.0922  0.0137  0.1483   6.9  18.2
  10..5      0.095   504.6   122.4  0.0922  0.0108  0.1172   5.5  14.3
   9..6      0.371   504.6   122.4  0.0922  0.0423  0.4583  21.3  56.1

tree length for dN:       0.0967
tree length for dS:       1.0487


Time used:  0:03


Model 1: NearlyNeutral (2 categories)


TREE #  1:  (1, (2, 3), ((4, 5), 6));   MP score: 136
lnL(ntime:  9  np: 12):  -1532.872708      +0.000000
   7..1     7..8     8..2     8..3     7..9     9..10   10..4    10..5     9..6  
 0.053439 0.036516 0.043805 0.038888 0.068310 0.031735 0.124857 0.099024 0.402381 1.244185 0.933497 0.044034

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.89895

(1: 0.053439, (2: 0.043805, 3: 0.038888): 0.036516, ((4: 0.124857, 5: 0.099024): 0.031735, 6: 0.402381): 0.068310);

(D_melanogaster_PGRP-LB-PA: 0.053439, (D_sechellia_PGRP-LB-PA: 0.043805, D_simulans_PGRP-LB-PA: 0.038888): 0.036516, ((D_yakuba_PGRP-LB-PA: 0.124857, D_erecta_PGRP-LB-PA: 0.099024): 0.031735, D_elegans_PGRP-LB-PA: 0.402381): 0.068310);

Detailed output identifying parameters

kappa (ts/tv) =  1.24418


dN/dS (w) for site classes (K=2)

p:   0.93350  0.06650
w:   0.04403  1.00000

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.053    504.3    122.7   0.1076   0.0068   0.0631    3.4    7.7
   7..8       0.037    504.3    122.7   0.1076   0.0046   0.0431    2.3    5.3
   8..2       0.044    504.3    122.7   0.1076   0.0056   0.0517    2.8    6.3
   8..3       0.039    504.3    122.7   0.1076   0.0049   0.0459    2.5    5.6
   7..9       0.068    504.3    122.7   0.1076   0.0087   0.0807    4.4    9.9
   9..10      0.032    504.3    122.7   0.1076   0.0040   0.0375    2.0    4.6
  10..4       0.125    504.3    122.7   0.1076   0.0159   0.1474    8.0   18.1
  10..5       0.099    504.3    122.7   0.1076   0.0126   0.1169    6.3   14.4
   9..6       0.402    504.3    122.7   0.1076   0.0511   0.4752   25.8   58.3


Time used:  0:08


Model 2: PositiveSelection (3 categories)


TREE #  1:  (1, (2, 3), ((4, 5), 6));   MP score: 136
check convergence..
lnL(ntime:  9  np: 14):  -1532.751160      +0.000000
   7..1     7..8     8..2     8..3     7..9     9..10   10..4    10..5     9..6  
 0.053972 0.036631 0.044112 0.039282 0.069813 0.032234 0.126585 0.100145 0.409680 1.252662 0.943120 0.031510 0.047671 1.581351

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.91245

(1: 0.053972, (2: 0.044112, 3: 0.039282): 0.036631, ((4: 0.126585, 5: 0.100145): 0.032234, 6: 0.409680): 0.069813);

(D_melanogaster_PGRP-LB-PA: 0.053972, (D_sechellia_PGRP-LB-PA: 0.044112, D_simulans_PGRP-LB-PA: 0.039282): 0.036631, ((D_yakuba_PGRP-LB-PA: 0.126585, D_erecta_PGRP-LB-PA: 0.100145): 0.032234, D_elegans_PGRP-LB-PA: 0.409680): 0.069813);

Detailed output identifying parameters

kappa (ts/tv) =  1.25266


dN/dS (w) for site classes (K=3)

p:   0.94312  0.03151  0.02537
w:   0.04767  1.00000  1.58135

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.054    504.2    122.8   0.1166   0.0072   0.0621    3.7    7.6
   7..8       0.037    504.2    122.8   0.1166   0.0049   0.0422    2.5    5.2
   8..2       0.044    504.2    122.8   0.1166   0.0059   0.0508    3.0    6.2
   8..3       0.039    504.2    122.8   0.1166   0.0053   0.0452    2.7    5.6
   7..9       0.070    504.2    122.8   0.1166   0.0094   0.0804    4.7    9.9
   9..10      0.032    504.2    122.8   0.1166   0.0043   0.0371    2.2    4.6
  10..4       0.127    504.2    122.8   0.1166   0.0170   0.1457    8.6   17.9
  10..5       0.100    504.2    122.8   0.1166   0.0134   0.1153    6.8   14.2
   9..6       0.410    504.2    122.8   0.1166   0.0550   0.4716   27.7   57.9


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PA)

            Pr(w>1)     post mean +- SE for w

   174 I      0.558         1.279
   180 V      0.539         1.305
   182 T      0.657         1.382
   198 K      0.598         1.343


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PA)

            Pr(w>1)     post mean +- SE for w

   174 I      0.642         1.999 +- 1.416
   180 V      0.559         1.795 +- 1.214
   182 T      0.766         2.313 +- 1.543
   195 A      0.553         1.791 +- 1.358
   198 K      0.652         1.985 +- 1.296



The grid (see ternary graph for p0-p1)

w0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
w2:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

w0:   1.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
w2:   0.463  0.274  0.129  0.062  0.031  0.017  0.010  0.006  0.004  0.003

Posterior for p0-p1 (see the ternary graph)

 0.000
 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.007 0.991

sum of density on p0-p1 =   1.000000

Time used:  0:22


Model 3: discrete (3 categories)


TREE #  1:  (1, (2, 3), ((4, 5), 6));   MP score: 136
lnL(ntime:  9  np: 15):  -1532.567386      +0.000000
   7..1     7..8     8..2     8..3     7..9     9..10   10..4    10..5     9..6  
 0.053897 0.037192 0.044344 0.039429 0.071336 0.032021 0.128222 0.100513 0.413380 1.245177 0.465067 0.495575 0.000001 0.110996 1.640550

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.92033

(1: 0.053897, (2: 0.044344, 3: 0.039429): 0.037192, ((4: 0.128222, 5: 0.100513): 0.032021, 6: 0.413380): 0.071336);

(D_melanogaster_PGRP-LB-PA: 0.053897, (D_sechellia_PGRP-LB-PA: 0.044344, D_simulans_PGRP-LB-PA: 0.039429): 0.037192, ((D_yakuba_PGRP-LB-PA: 0.128222, D_erecta_PGRP-LB-PA: 0.100513): 0.032021, D_elegans_PGRP-LB-PA: 0.413380): 0.071336);

Detailed output identifying parameters

kappa (ts/tv) =  1.24518


dN/dS (w) for site classes (K=3)

p:   0.46507  0.49557  0.03936
w:   0.00000  0.11100  1.64055

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.054    504.3    122.7   0.1196   0.0074   0.0615    3.7    7.6
   7..8       0.037    504.3    122.7   0.1196   0.0051   0.0425    2.6    5.2
   8..2       0.044    504.3    122.7   0.1196   0.0061   0.0506    3.1    6.2
   8..3       0.039    504.3    122.7   0.1196   0.0054   0.0450    2.7    5.5
   7..9       0.071    504.3    122.7   0.1196   0.0097   0.0815    4.9   10.0
   9..10      0.032    504.3    122.7   0.1196   0.0044   0.0366    2.2    4.5
  10..4       0.128    504.3    122.7   0.1196   0.0175   0.1464    8.8   18.0
  10..5       0.101    504.3    122.7   0.1196   0.0137   0.1148    6.9   14.1
   9..6       0.413    504.3    122.7   0.1196   0.0564   0.4721   28.5   57.9


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PA)

            Pr(w>1)     post mean +- SE for w

   174 I      0.873         1.447
   176 D      0.809         1.348
   180 V      0.941         1.551
   182 T      0.996**       1.634
   195 A      0.791         1.321
   197 Q      0.671         1.138
   198 K      0.971*        1.596


Time used:  0:41


Model 7: beta (10 categories)


TREE #  1:  (1, (2, 3), ((4, 5), 6));   MP score: 136
lnL(ntime:  9  np: 12):  -1534.322648      +0.000000
   7..1     7..8     8..2     8..3     7..9     9..10   10..4    10..5     9..6  
 0.052362 0.037032 0.043431 0.038436 0.066633 0.031330 0.123424 0.097432 0.392629 1.230057 0.140161 1.159329

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.88271

(1: 0.052362, (2: 0.043431, 3: 0.038436): 0.037032, ((4: 0.123424, 5: 0.097432): 0.031330, 6: 0.392629): 0.066633);

(D_melanogaster_PGRP-LB-PA: 0.052362, (D_sechellia_PGRP-LB-PA: 0.043431, D_simulans_PGRP-LB-PA: 0.038436): 0.037032, ((D_yakuba_PGRP-LB-PA: 0.123424, D_erecta_PGRP-LB-PA: 0.097432): 0.031330, D_elegans_PGRP-LB-PA: 0.392629): 0.066633);

Detailed output identifying parameters

kappa (ts/tv) =  1.23006

Parameters in M7 (beta):
 p =   0.14016  q =   1.15933


dN/dS (w) for site classes (K=10)

p:   0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000  0.10000
w:   0.00000  0.00000  0.00004  0.00045  0.00271  0.01134  0.03749  0.10508  0.26294  0.62055

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.052    504.4    122.6   0.1041   0.0065   0.0625    3.3    7.7
   7..8       0.037    504.4    122.6   0.1041   0.0046   0.0442    2.3    5.4
   8..2       0.043    504.4    122.6   0.1041   0.0054   0.0518    2.7    6.4
   8..3       0.038    504.4    122.6   0.1041   0.0048   0.0459    2.4    5.6
   7..9       0.067    504.4    122.6   0.1041   0.0083   0.0795    4.2    9.8
   9..10      0.031    504.4    122.6   0.1041   0.0039   0.0374    2.0    4.6
  10..4       0.123    504.4    122.6   0.1041   0.0153   0.1473    7.7   18.1
  10..5       0.097    504.4    122.6   0.1041   0.0121   0.1163    6.1   14.3
   9..6       0.393    504.4    122.6   0.1041   0.0488   0.4687   24.6   57.5


Time used:  1:07


Model 8: beta&w>1 (11 categories)


TREE #  1:  (1, (2, 3), ((4, 5), 6));   MP score: 136
lnL(ntime:  9  np: 14):  -1532.582913      +0.000000
   7..1     7..8     8..2     8..3     7..9     9..10   10..4    10..5     9..6  
 0.053890 0.037204 0.044335 0.039432 0.071265 0.032069 0.128163 0.100504 0.413138 1.245552 0.961742 0.640040 9.924726 1.656963

Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).

tree length =   0.92000

(1: 0.053890, (2: 0.044335, 3: 0.039432): 0.037204, ((4: 0.128163, 5: 0.100504): 0.032069, 6: 0.413138): 0.071265);

(D_melanogaster_PGRP-LB-PA: 0.053890, (D_sechellia_PGRP-LB-PA: 0.044335, D_simulans_PGRP-LB-PA: 0.039432): 0.037204, ((D_yakuba_PGRP-LB-PA: 0.128163, D_erecta_PGRP-LB-PA: 0.100504): 0.032069, D_elegans_PGRP-LB-PA: 0.413138): 0.071265);

Detailed output identifying parameters

kappa (ts/tv) =  1.24555

Parameters in M8 (beta&w>1):
  p0 =   0.96174  p =   0.64004 q =   9.92473
 (p1 =   0.03826) w =   1.65696


dN/dS (w) for site classes (K=11)

p:   0.09617  0.09617  0.09617  0.09617  0.09617  0.09617  0.09617  0.09617  0.09617  0.09617  0.03826
w:   0.00081  0.00459  0.01054  0.01861  0.02912  0.04273  0.06072  0.08569  0.12429  0.20607  1.65696

dN & dS for each branch

 branch          t       N       S   dN/dS      dN      dS  N*dN  S*dS

   7..1       0.054    504.3    122.7   0.1195   0.0074   0.0616    3.7    7.6
   7..8       0.037    504.3    122.7   0.1195   0.0051   0.0425    2.6    5.2
   8..2       0.044    504.3    122.7   0.1195   0.0061   0.0506    3.1    6.2
   8..3       0.039    504.3    122.7   0.1195   0.0054   0.0450    2.7    5.5
   7..9       0.071    504.3    122.7   0.1195   0.0097   0.0814    4.9   10.0
   9..10      0.032    504.3    122.7   0.1195   0.0044   0.0366    2.2    4.5
  10..4       0.128    504.3    122.7   0.1195   0.0175   0.1464    8.8   18.0
  10..5       0.101    504.3    122.7   0.1195   0.0137   0.1148    6.9   14.1
   9..6       0.413    504.3    122.7   0.1195   0.0564   0.4719   28.4   57.9


Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PA)

            Pr(w>1)     post mean +- SE for w

   174 I      0.860         1.447
   176 D      0.754         1.292
   180 V      0.916         1.532
   182 T      0.990**       1.642
   195 A      0.774         1.319
   197 Q      0.652         1.135
   198 K      0.956*        1.592


Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_PGRP-LB-PA)

            Pr(w>1)     post mean +- SE for w

   174 I      0.761         1.923 +- 1.316
   180 V      0.728         1.813 +- 1.222
   182 T      0.913         2.235 +- 1.277
   195 A      0.654         1.687 +- 1.306
   198 K      0.826         2.028 +- 1.237



The grid 

p0:   0.050  0.150  0.250  0.350  0.450  0.550  0.650  0.750  0.850  0.950
p :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
q :   0.100  0.300  0.500  0.700  0.900  1.100  1.300  1.500  1.700  1.900
ws:   1.500  2.500  3.500  4.500  5.500  6.500  7.500  8.500  9.500 10.500


Posterior on the grid

p0:   0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  1.000
p :   1.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000  0.000
q :   0.000  0.000  0.000  0.000  0.006  0.028  0.083  0.172  0.289  0.423
ws:   0.513  0.284  0.116  0.047  0.020  0.009  0.005  0.003  0.002  0.001

Time used:  1:56
Model 1: NearlyNeutral	-1532.872708
Model 2: PositiveSelection	-1532.75116
Model 0: one-ratio	-1547.550018
Model 3: discrete	-1532.567386
Model 7: beta	-1534.322648
Model 8: beta&w>1	-1532.582913


Model 0 vs 1	29.354619999999613

Model 2 vs 1	0.24309600000015053

Model 8 vs 7	3.4794700000002194