--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:27:55 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0049/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -411.72 -417.54
2 -411.70 -415.79
--------------------------------------
TOTAL -411.71 -417.00
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.838811 0.083508 0.329240 1.409293 0.804947 1340.47 1420.74 1.000
r(A<->C){all} 0.105713 0.010935 0.000027 0.330031 0.073202 275.05 279.75 1.001
r(A<->G){all} 0.221933 0.024432 0.000287 0.522663 0.193656 360.31 372.17 1.000
r(A<->T){all} 0.127218 0.013256 0.000010 0.365199 0.093152 307.98 309.68 1.000
r(C<->G){all} 0.132990 0.014589 0.000035 0.376066 0.095357 334.91 343.21 1.000
r(C<->T){all} 0.226804 0.026222 0.000001 0.533311 0.194314 96.56 131.32 1.000
r(G<->T){all} 0.185342 0.025216 0.000131 0.510086 0.142326 148.73 237.22 1.002
pi(A){all} 0.280476 0.000695 0.230082 0.331382 0.279646 1192.50 1247.37 1.000
pi(C){all} 0.273819 0.000709 0.217919 0.322453 0.273286 1131.61 1234.99 1.000
pi(G){all} 0.268870 0.000668 0.219204 0.318395 0.268811 1407.31 1434.24 1.001
pi(T){all} 0.176835 0.000513 0.133223 0.220172 0.175524 1247.66 1363.54 1.000
alpha{1,2} 0.265678 0.056270 0.033468 0.707130 0.197346 1349.85 1385.22 1.000
alpha{3} 0.336165 0.182527 0.000106 1.172549 0.176505 1066.48 1210.65 1.000
pinvar{all} 0.978618 0.000196 0.952469 0.997675 0.981675 1218.03 1299.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -393.062599
Model 2: PositiveSelection -392.240556
Model 0: one-ratio -392.240556
Model 7: beta -393.062599
Model 8: beta&w>1 -392.240556
Model 0 vs 1 1.644085999999902
Model 2 vs 1 1.644085999999902
Model 8 vs 7 1.644085999999902
>C1
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C2
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG
>C3
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C4
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C5
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C6
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=95
C1 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C2 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C3 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C4 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C5 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C6 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
**************************************************
C1 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C2 SSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG
C3 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C4 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C5 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C6 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
****:********************************** *****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 95 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 95 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2850]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2850]--->[2850]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.437 Mb, Max= 30.603 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C2 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C3 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C4 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C5 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C6 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
**************************************************
C1 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C2 SSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG
C3 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C4 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C5 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C6 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
****:********************************** *****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 97.89 C1 C2 97.89
TOP 1 0 97.89 C2 C1 97.89
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 97.89 C2 C3 97.89
TOP 2 1 97.89 C3 C2 97.89
BOT 1 3 97.89 C2 C4 97.89
TOP 3 1 97.89 C4 C2 97.89
BOT 1 4 97.89 C2 C5 97.89
TOP 4 1 97.89 C5 C2 97.89
BOT 1 5 97.89 C2 C6 97.89
TOP 5 1 97.89 C6 C2 97.89
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.58
AVG 1 C2 * 97.89
AVG 2 C3 * 99.58
AVG 3 C4 * 99.58
AVG 4 C5 * 99.58
AVG 5 C6 * 99.58
TOT TOT * 99.30
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
C2 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
C3 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
C4 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
C5 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
C6 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
**************************************************
C1 GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
C2 GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
C3 GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
C4 GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
C5 GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
C6 GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
**************************************************
C1 CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
C2 CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
C3 CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
C4 CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
C5 CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
C6 CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
**************************************************
C1 TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
C2 TCGTCAGTCCAACGACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
C3 TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
C4 TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
C5 TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
C6 TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
*************.************************************
C1 ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
C2 ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
C3 ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
C4 ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
C5 ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
C6 ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
**************************************************
C1 AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
C2 AGACCGAGGCAGGCGTCATGAGTATGTTCACCGGG
C3 AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
C4 AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
C5 AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
C6 AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
****************** ****************
>C1
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
>C2
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACGACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCATGAGTATGTTCACCGGG
>C3
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
>C4
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
>C5
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
>C6
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
>C1
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C2
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG
>C3
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C4
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C5
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C6
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 285 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789581
Setting output file names to "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 328940857
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0237725634
Seed = 816195308
Swapseed = 1579789581
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -644.649390 -- -24.965149
Chain 2 -- -644.649390 -- -24.965149
Chain 3 -- -644.649354 -- -24.965149
Chain 4 -- -644.649390 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -644.649390 -- -24.965149
Chain 2 -- -644.649390 -- -24.965149
Chain 3 -- -644.649390 -- -24.965149
Chain 4 -- -644.646291 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-644.649] (-644.649) (-644.649) (-644.649) * [-644.649] (-644.649) (-644.649) (-644.646)
500 -- [-419.197] (-421.472) (-408.838) (-417.932) * (-414.834) [-413.616] (-419.467) (-417.417) -- 0:00:00
1000 -- [-418.222] (-411.712) (-422.122) (-416.651) * (-414.774) (-418.242) [-413.640] (-418.988) -- 0:00:00
1500 -- [-415.525] (-418.587) (-413.837) (-422.868) * (-415.402) (-413.897) (-420.007) [-414.286] -- 0:00:00
2000 -- [-417.673] (-410.633) (-410.940) (-419.978) * (-418.852) (-412.857) [-418.131] (-418.046) -- 0:00:00
2500 -- [-412.067] (-419.032) (-412.427) (-420.109) * (-414.825) (-415.056) [-419.471] (-415.738) -- 0:00:00
3000 -- (-414.669) [-415.358] (-425.439) (-418.891) * (-413.228) (-414.075) [-423.708] (-419.737) -- 0:00:00
3500 -- (-422.948) (-414.328) [-416.181] (-416.270) * [-413.158] (-416.995) (-419.375) (-417.267) -- 0:00:00
4000 -- [-415.562] (-414.868) (-418.484) (-419.369) * [-413.164] (-411.246) (-421.595) (-416.465) -- 0:00:00
4500 -- (-420.596) [-408.463] (-421.574) (-417.289) * (-413.436) (-420.050) (-419.792) [-416.893] -- 0:00:00
5000 -- (-419.109) (-412.455) (-414.059) [-413.019] * (-418.374) (-414.990) [-415.328] (-420.912) -- 0:00:00
Average standard deviation of split frequencies: 0.064282
5500 -- (-419.074) (-414.942) (-421.495) [-411.916] * (-426.403) [-409.326] (-415.652) (-418.958) -- 0:00:00
6000 -- (-420.991) (-420.906) [-417.739] (-414.048) * (-422.680) [-409.897] (-426.081) (-413.876) -- 0:00:00
6500 -- [-408.516] (-416.366) (-417.123) (-411.896) * (-412.491) [-414.172] (-421.707) (-417.099) -- 0:00:00
7000 -- (-411.259) (-423.515) [-411.285] (-416.441) * (-420.718) [-421.068] (-427.345) (-412.485) -- 0:00:00
7500 -- [-413.596] (-417.844) (-411.088) (-418.431) * (-412.731) (-422.137) (-424.445) [-413.647] -- 0:00:00
8000 -- [-414.494] (-418.935) (-420.116) (-416.855) * [-416.783] (-427.729) (-416.071) (-419.712) -- 0:00:00
8500 -- [-409.142] (-414.119) (-412.057) (-415.596) * [-414.528] (-413.649) (-417.827) (-415.810) -- 0:00:00
9000 -- (-414.583) (-414.248) (-413.481) [-413.771] * (-417.645) [-420.479] (-419.070) (-425.422) -- 0:00:00
9500 -- (-419.493) [-414.167] (-414.614) (-414.753) * (-414.956) (-418.126) (-417.789) [-412.764] -- 0:01:44
10000 -- [-413.117] (-418.096) (-413.796) (-413.131) * [-416.344] (-418.381) (-416.356) (-416.987) -- 0:01:39
Average standard deviation of split frequencies: 0.066291
10500 -- (-413.153) [-421.591] (-415.603) (-413.391) * (-416.002) [-416.552] (-419.927) (-419.070) -- 0:01:34
11000 -- [-413.077] (-424.378) (-421.502) (-411.636) * (-419.955) (-420.809) [-416.473] (-415.222) -- 0:01:29
11500 -- (-412.478) [-418.250] (-421.010) (-412.368) * (-419.232) [-414.203] (-417.271) (-419.633) -- 0:01:25
12000 -- [-412.724] (-420.824) (-422.302) (-414.717) * [-416.776] (-414.900) (-416.782) (-414.076) -- 0:01:22
12500 -- (-412.066) (-423.835) [-413.030] (-417.416) * [-411.449] (-426.661) (-415.577) (-415.396) -- 0:01:19
13000 -- [-414.230] (-412.823) (-414.659) (-414.372) * (-414.150) [-420.801] (-414.439) (-418.461) -- 0:01:15
13500 -- [-417.567] (-411.867) (-418.295) (-411.878) * [-414.419] (-415.265) (-412.285) (-423.725) -- 0:01:13
14000 -- (-414.713) [-415.618] (-413.794) (-413.103) * (-412.539) [-412.853] (-410.829) (-415.630) -- 0:01:10
14500 -- [-415.250] (-415.766) (-411.949) (-412.814) * [-416.067] (-411.790) (-416.733) (-414.539) -- 0:01:07
15000 -- (-417.865) (-418.133) (-426.630) [-416.400] * [-415.406] (-411.398) (-413.314) (-414.228) -- 0:01:05
Average standard deviation of split frequencies: 0.065128
15500 -- [-414.559] (-414.893) (-412.022) (-413.311) * (-427.521) [-413.048] (-414.462) (-429.778) -- 0:01:03
16000 -- [-417.499] (-410.530) (-414.324) (-410.916) * [-414.355] (-415.798) (-417.330) (-417.859) -- 0:01:01
16500 -- (-414.893) (-414.316) [-419.345] (-413.131) * [-409.235] (-416.304) (-415.893) (-417.549) -- 0:00:59
17000 -- [-417.495] (-415.711) (-416.281) (-412.095) * [-412.546] (-413.027) (-413.802) (-413.834) -- 0:00:57
17500 -- (-419.163) [-409.856] (-417.421) (-414.609) * (-410.717) [-412.207] (-415.257) (-416.461) -- 0:00:56
18000 -- [-413.221] (-416.620) (-412.761) (-414.200) * [-411.477] (-411.403) (-416.348) (-416.880) -- 0:00:54
18500 -- (-412.211) [-411.537] (-415.741) (-414.486) * [-422.245] (-413.213) (-414.750) (-419.466) -- 0:00:53
19000 -- (-416.903) (-415.774) [-414.030] (-413.297) * [-422.553] (-415.157) (-414.334) (-413.872) -- 0:00:51
19500 -- [-413.102] (-413.327) (-420.744) (-415.575) * [-414.871] (-414.152) (-414.389) (-414.265) -- 0:00:50
20000 -- [-416.106] (-417.009) (-417.760) (-409.656) * (-413.449) (-411.657) (-412.227) [-414.586] -- 0:00:49
Average standard deviation of split frequencies: 0.064628
20500 -- [-428.895] (-416.131) (-411.813) (-412.028) * [-420.665] (-413.046) (-415.548) (-421.441) -- 0:00:47
21000 -- [-424.676] (-412.872) (-418.974) (-412.131) * [-420.426] (-411.863) (-413.233) (-416.542) -- 0:00:46
21500 -- (-412.649) (-413.975) [-418.445] (-410.536) * [-414.714] (-412.182) (-415.993) (-417.348) -- 0:00:45
22000 -- (-411.541) (-410.149) (-416.329) [-412.621] * [-414.134] (-411.828) (-412.685) (-416.021) -- 0:00:44
22500 -- (-411.849) (-416.891) (-414.005) [-410.331] * [-414.025] (-415.848) (-411.910) (-417.459) -- 0:00:43
23000 -- [-409.996] (-419.049) (-425.891) (-411.695) * (-415.638) (-415.074) (-414.448) [-418.254] -- 0:00:42
23500 -- (-408.722) (-411.892) [-416.976] (-409.320) * (-425.383) (-416.250) [-417.412] (-418.808) -- 0:00:41
24000 -- [-413.172] (-416.768) (-415.787) (-410.665) * (-425.481) [-415.604] (-416.049) (-416.442) -- 0:00:40
24500 -- (-413.648) (-415.389) [-414.245] (-414.223) * (-423.270) [-413.407] (-415.566) (-415.692) -- 0:01:19
25000 -- (-411.529) (-415.801) (-416.920) [-413.882] * [-414.144] (-412.635) (-414.857) (-413.989) -- 0:01:18
Average standard deviation of split frequencies: 0.048667
25500 -- (-410.589) (-419.482) (-418.096) [-412.304] * (-421.741) [-413.943] (-415.112) (-415.395) -- 0:01:16
26000 -- (-411.048) (-419.846) (-417.652) [-411.081] * (-414.791) [-411.413] (-416.988) (-416.991) -- 0:01:14
26500 -- (-414.434) (-418.146) [-416.057] (-410.813) * (-424.789) [-412.567] (-416.280) (-416.453) -- 0:01:13
27000 -- [-410.727] (-421.053) (-419.650) (-408.929) * (-420.627) (-413.856) (-413.766) [-413.667] -- 0:01:12
27500 -- (-412.572) (-415.761) (-414.979) [-409.204] * [-427.964] (-414.208) (-418.896) (-414.051) -- 0:01:10
28000 -- (-412.955) (-414.929) [-425.104] (-410.036) * (-426.954) [-416.197] (-416.692) (-417.035) -- 0:01:09
28500 -- (-409.470) (-422.057) [-419.951] (-411.108) * (-417.527) (-413.916) (-415.794) [-412.314] -- 0:01:08
29000 -- [-408.912] (-418.967) (-423.060) (-412.165) * (-415.001) (-413.282) (-414.355) [-412.673] -- 0:01:06
29500 -- (-409.136) (-418.858) [-411.147] (-412.432) * (-414.216) (-412.163) (-414.608) [-410.864] -- 0:01:05
30000 -- (-414.394) (-411.157) [-411.976] (-411.728) * [-416.917] (-412.917) (-412.389) (-414.955) -- 0:01:04
Average standard deviation of split frequencies: 0.037576
30500 -- (-416.235) (-416.162) [-412.966] (-411.342) * (-417.535) (-412.106) [-410.476] (-417.609) -- 0:01:03
31000 -- (-412.619) (-413.969) [-412.035] (-411.543) * (-414.671) (-413.784) [-413.809] (-412.917) -- 0:01:02
31500 -- (-411.408) (-411.996) [-416.103] (-416.199) * (-415.146) [-414.307] (-416.601) (-412.908) -- 0:01:01
32000 -- (-411.662) (-413.844) [-417.021] (-412.152) * (-413.219) [-413.711] (-411.105) (-414.377) -- 0:01:00
32500 -- (-418.449) (-415.921) [-415.906] (-412.155) * (-416.680) (-411.713) (-411.342) [-410.924] -- 0:00:59
33000 -- (-414.704) (-412.249) [-422.384] (-410.257) * (-415.762) (-413.462) (-411.926) [-412.920] -- 0:00:58
33500 -- (-413.014) (-411.400) [-421.821] (-410.917) * [-414.389] (-417.287) (-413.132) (-416.999) -- 0:00:57
34000 -- [-411.890] (-409.845) (-420.609) (-411.529) * (-411.782) (-417.370) [-411.024] (-412.571) -- 0:00:56
34500 -- [-410.148] (-412.981) (-417.974) (-413.623) * [-412.222] (-413.492) (-414.221) (-414.319) -- 0:00:55
35000 -- (-409.971) [-412.954] (-412.933) (-412.968) * (-413.353) (-415.690) [-412.972] (-414.971) -- 0:00:55
Average standard deviation of split frequencies: 0.036665
35500 -- [-411.553] (-412.819) (-416.605) (-415.906) * (-414.335) (-411.816) (-412.853) [-412.909] -- 0:00:54
36000 -- [-411.336] (-412.283) (-414.229) (-411.995) * (-410.608) (-415.053) [-412.609] (-413.039) -- 0:00:53
36500 -- (-413.361) (-414.327) [-418.810] (-412.291) * (-412.842) [-413.287] (-411.374) (-412.308) -- 0:00:52
37000 -- (-411.524) (-413.250) [-416.074] (-416.775) * [-412.531] (-415.505) (-418.480) (-415.383) -- 0:00:52
37500 -- (-410.003) [-412.187] (-418.404) (-412.448) * (-415.866) [-413.527] (-422.209) (-413.082) -- 0:00:51
38000 -- (-414.547) (-411.384) (-418.167) [-412.096] * (-412.606) (-420.620) (-411.452) [-409.682] -- 0:00:50
38500 -- (-415.250) (-414.519) (-421.368) [-412.790] * (-411.541) [-412.723] (-411.930) (-410.270) -- 0:00:49
39000 -- (-415.560) (-416.927) [-416.026] (-412.604) * (-415.379) [-413.590] (-414.461) (-416.935) -- 0:00:49
39500 -- (-416.289) (-419.879) [-410.815] (-412.529) * (-415.509) [-412.982] (-413.779) (-412.624) -- 0:00:48
40000 -- (-410.107) (-418.067) (-412.280) [-416.670] * (-414.356) (-414.723) [-412.834] (-412.835) -- 0:01:12
Average standard deviation of split frequencies: 0.035996
40500 -- (-411.777) (-417.673) [-415.101] (-415.975) * (-411.382) (-414.988) [-412.086] (-415.054) -- 0:01:11
41000 -- (-410.815) (-417.103) (-413.896) [-414.524] * (-413.348) (-418.234) [-413.426] (-414.411) -- 0:01:10
41500 -- [-410.929] (-418.506) (-412.059) (-411.905) * [-412.573] (-411.636) (-417.498) (-416.368) -- 0:01:09
42000 -- (-413.558) (-418.782) [-413.910] (-413.649) * (-417.095) (-412.495) [-413.322] (-413.986) -- 0:01:08
42500 -- (-412.335) (-417.293) (-417.143) [-410.703] * [-415.232] (-415.263) (-413.114) (-414.480) -- 0:01:07
43000 -- [-410.378] (-417.416) (-415.320) (-415.405) * (-416.602) (-421.568) (-417.842) [-415.289] -- 0:01:06
43500 -- (-413.311) (-416.921) (-411.270) [-417.255] * (-415.219) (-414.254) (-417.642) [-413.707] -- 0:01:05
44000 -- (-409.104) (-424.100) (-408.756) [-411.207] * (-414.714) (-411.659) [-415.838] (-412.283) -- 0:01:05
44500 -- (-411.974) (-413.629) [-414.787] (-412.971) * (-413.942) [-417.002] (-416.944) (-413.187) -- 0:01:04
45000 -- (-415.367) (-414.183) [-412.600] (-413.994) * (-415.000) (-411.741) [-414.798] (-412.607) -- 0:01:03
Average standard deviation of split frequencies: 0.026132
45500 -- (-412.836) (-418.885) [-411.286] (-411.861) * [-411.405] (-411.706) (-416.655) (-412.949) -- 0:01:02
46000 -- (-410.971) [-417.652] (-427.494) (-414.227) * (-412.162) (-413.770) (-411.732) [-411.825] -- 0:01:02
46500 -- (-418.043) [-414.740] (-414.279) (-412.566) * (-413.628) [-412.098] (-415.810) (-417.136) -- 0:01:01
47000 -- (-420.218) (-419.451) [-411.739] (-411.672) * (-411.628) (-411.481) [-411.704] (-418.176) -- 0:01:00
47500 -- [-409.709] (-418.786) (-412.312) (-413.248) * (-412.890) (-414.788) (-413.272) [-413.130] -- 0:01:00
48000 -- (-415.194) (-415.832) [-415.696] (-412.189) * (-415.812) [-414.145] (-415.970) (-411.309) -- 0:00:59
48500 -- (-410.031) [-415.220] (-411.762) (-410.664) * (-413.505) (-415.029) [-416.963] (-413.087) -- 0:00:58
49000 -- (-412.300) (-412.523) [-413.928] (-415.512) * (-413.822) (-413.529) (-416.011) [-411.850] -- 0:00:58
49500 -- (-412.066) (-415.913) [-413.354] (-410.795) * (-414.851) (-412.815) (-413.533) [-412.253] -- 0:00:57
50000 -- (-414.026) (-411.964) [-416.871] (-413.619) * (-412.810) (-413.511) (-412.495) [-415.416] -- 0:00:57
Average standard deviation of split frequencies: 0.028891
50500 -- (-413.358) (-414.101) [-416.464] (-416.607) * [-413.130] (-414.944) (-418.022) (-415.996) -- 0:00:56
51000 -- (-414.115) (-418.229) [-415.930] (-413.716) * (-411.346) (-412.872) [-414.443] (-414.818) -- 0:00:55
51500 -- (-415.354) (-417.899) [-413.156] (-411.272) * [-412.862] (-410.862) (-418.654) (-414.302) -- 0:00:55
52000 -- (-414.017) (-418.124) [-420.329] (-413.879) * [-412.659] (-412.566) (-411.245) (-413.425) -- 0:00:54
52500 -- (-408.772) (-415.996) [-414.391] (-410.046) * (-415.258) [-411.515] (-412.189) (-414.825) -- 0:00:54
53000 -- (-412.377) (-417.434) [-416.301] (-411.512) * (-415.317) [-410.307] (-419.749) (-414.580) -- 0:00:53
53500 -- (-413.358) (-414.458) [-415.583] (-409.372) * (-413.065) [-412.923] (-414.630) (-412.686) -- 0:00:53
54000 -- (-415.164) (-415.185) [-420.671] (-409.974) * [-412.132] (-417.642) (-411.818) (-412.305) -- 0:00:52
54500 -- (-411.807) [-416.675] (-410.773) (-410.994) * (-414.527) (-416.213) (-415.069) [-414.126] -- 0:00:52
55000 -- (-411.987) [-414.891] (-419.261) (-410.467) * (-417.513) (-414.973) (-412.519) [-414.806] -- 0:00:51
Average standard deviation of split frequencies: 0.024811
55500 -- (-413.271) (-414.578) (-417.502) [-410.215] * [-413.261] (-413.259) (-417.649) (-413.495) -- 0:00:51
56000 -- (-412.165) (-414.287) [-410.646] (-412.160) * (-414.637) (-414.561) [-415.931] (-415.264) -- 0:01:07
56500 -- (-411.184) (-418.657) [-414.587] (-413.044) * (-415.390) (-413.156) [-415.000] (-414.890) -- 0:01:06
57000 -- (-409.532) (-415.204) [-412.592] (-412.312) * (-413.411) (-416.055) (-412.756) [-412.441] -- 0:01:06
57500 -- (-411.735) (-417.287) (-412.989) [-410.849] * (-414.372) [-418.993] (-416.139) (-414.830) -- 0:01:05
58000 -- (-415.893) (-415.727) [-410.256] (-411.791) * [-411.948] (-415.992) (-414.961) (-419.662) -- 0:01:04
58500 -- (-414.863) [-413.073] (-410.085) (-416.274) * (-411.446) (-413.708) [-414.065] (-414.183) -- 0:01:04
59000 -- (-410.987) (-416.209) [-413.825] (-411.991) * (-411.391) [-413.476] (-416.141) (-413.028) -- 0:01:03
59500 -- (-414.353) (-419.823) [-412.058] (-414.656) * (-415.094) [-413.524] (-412.756) (-415.069) -- 0:01:03
60000 -- (-413.691) (-414.879) [-408.838] (-413.132) * (-412.704) (-417.347) [-415.121] (-415.044) -- 0:01:02
Average standard deviation of split frequencies: 0.023700
60500 -- (-412.666) (-415.487) [-412.966] (-412.826) * (-414.678) [-413.934] (-411.394) (-414.611) -- 0:01:02
61000 -- (-410.183) (-421.157) (-411.787) [-414.335] * [-413.488] (-413.541) (-417.913) (-413.661) -- 0:01:01
61500 -- (-414.383) (-412.223) [-409.892] (-417.772) * (-415.304) (-420.368) [-412.325] (-413.071) -- 0:01:01
62000 -- (-408.391) [-418.953] (-414.247) (-415.887) * (-416.449) (-414.480) [-415.879] (-414.212) -- 0:01:00
62500 -- [-410.338] (-416.822) (-414.328) (-415.020) * (-416.831) (-413.130) [-413.176] (-413.388) -- 0:01:00
63000 -- (-413.160) (-418.328) (-411.938) [-411.906] * (-415.043) (-413.831) (-415.614) [-413.113] -- 0:00:59
63500 -- (-414.331) (-418.297) (-413.931) [-410.512] * [-413.031] (-413.346) (-416.166) (-422.832) -- 0:00:58
64000 -- (-410.738) (-414.084) (-417.201) [-419.360] * [-411.791] (-414.824) (-418.154) (-415.606) -- 0:00:58
64500 -- (-410.373) (-418.038) (-414.586) [-410.140] * (-412.479) (-412.368) [-412.126] (-418.385) -- 0:00:58
65000 -- (-412.545) [-415.248] (-412.962) (-411.100) * (-413.017) (-415.509) (-417.504) [-411.811] -- 0:00:57
Average standard deviation of split frequencies: 0.021070
65500 -- (-413.465) [-417.543] (-415.097) (-416.116) * (-414.764) (-415.192) [-414.327] (-411.911) -- 0:00:57
66000 -- [-411.245] (-413.647) (-412.956) (-414.465) * (-411.145) (-414.801) (-417.222) [-413.768] -- 0:00:56
66500 -- (-410.075) [-411.652] (-412.799) (-413.505) * (-410.968) (-413.209) (-415.134) [-413.071] -- 0:00:56
67000 -- (-411.623) [-416.167] (-413.921) (-411.822) * (-412.722) [-416.882] (-411.725) (-413.974) -- 0:00:55
67500 -- (-415.226) [-414.087] (-413.541) (-416.352) * (-411.669) [-413.486] (-414.609) (-411.758) -- 0:00:55
68000 -- [-416.619] (-416.711) (-411.557) (-413.793) * [-414.707] (-413.859) (-413.328) (-413.094) -- 0:00:54
68500 -- (-410.231) (-413.458) (-412.525) [-413.114] * (-414.601) (-416.236) [-413.574] (-410.554) -- 0:00:54
69000 -- [-411.662] (-415.421) (-418.700) (-413.873) * (-413.763) (-417.346) [-413.248] (-413.344) -- 0:00:53
69500 -- (-412.095) (-415.616) [-412.949] (-413.500) * [-411.942] (-414.319) (-416.495) (-418.907) -- 0:00:53
70000 -- [-412.478] (-417.116) (-412.752) (-416.098) * (-417.228) (-415.482) [-413.282] (-415.268) -- 0:00:53
Average standard deviation of split frequencies: 0.022821
70500 -- (-412.220) [-416.147] (-412.486) (-414.094) * [-411.500] (-416.367) (-418.099) (-414.835) -- 0:00:52
71000 -- [-414.588] (-417.288) (-412.884) (-411.573) * (-413.409) [-414.730] (-413.566) (-414.441) -- 0:00:52
71500 -- (-410.830) [-415.002] (-416.536) (-414.636) * (-413.687) [-412.119] (-413.482) (-419.089) -- 0:01:04
72000 -- (-414.053) (-414.872) (-412.746) [-414.891] * (-418.473) [-413.724] (-410.276) (-417.412) -- 0:01:04
72500 -- (-412.647) [-413.269] (-415.327) (-415.814) * (-411.545) [-415.228] (-415.482) (-412.872) -- 0:01:03
73000 -- (-413.582) (-417.741) (-415.527) [-413.156] * (-411.367) [-412.762] (-415.165) (-411.088) -- 0:01:03
73500 -- (-412.055) (-418.031) (-410.030) [-412.839] * (-413.879) (-412.248) (-416.673) [-410.587] -- 0:01:03
74000 -- (-410.835) [-415.286] (-413.197) (-412.103) * (-412.051) (-417.044) [-417.690] (-412.475) -- 0:01:02
74500 -- [-414.985] (-414.479) (-414.334) (-415.662) * (-414.079) (-416.695) [-415.948] (-415.910) -- 0:01:02
75000 -- (-411.167) (-413.368) [-415.204] (-414.331) * [-412.282] (-420.897) (-416.091) (-411.464) -- 0:01:01
Average standard deviation of split frequencies: 0.022872
75500 -- [-414.566] (-414.315) (-410.727) (-414.813) * (-410.590) (-419.124) [-417.536] (-413.284) -- 0:01:01
76000 -- (-412.593) [-411.144] (-412.783) (-414.753) * (-410.732) [-414.329] (-418.129) (-413.124) -- 0:01:00
76500 -- (-411.706) [-413.885] (-417.282) (-412.390) * (-411.514) [-414.652] (-416.017) (-410.665) -- 0:01:00
77000 -- [-412.824] (-415.802) (-411.110) (-411.553) * (-412.205) (-418.804) (-414.107) [-411.153] -- 0:00:59
77500 -- (-412.770) [-411.682] (-412.234) (-410.507) * (-412.500) (-418.620) (-414.370) [-410.759] -- 0:00:59
78000 -- [-412.449] (-412.251) (-412.938) (-422.378) * [-412.399] (-417.062) (-414.335) (-412.333) -- 0:00:59
78500 -- (-416.548) (-414.796) (-414.249) [-417.685] * (-412.818) (-415.722) [-410.304] (-413.982) -- 0:00:58
79000 -- (-411.169) [-412.510] (-416.139) (-415.907) * (-409.866) [-411.657] (-412.811) (-414.113) -- 0:00:58
79500 -- (-409.771) (-414.046) [-416.260] (-414.464) * (-413.560) (-412.841) (-414.264) [-411.323] -- 0:00:57
80000 -- (-407.604) [-413.454] (-416.862) (-413.138) * (-412.145) [-411.362] (-412.715) (-409.861) -- 0:00:57
Average standard deviation of split frequencies: 0.020625
80500 -- [-411.215] (-412.614) (-417.037) (-413.883) * (-413.133) [-415.064] (-413.586) (-410.074) -- 0:00:57
81000 -- [-410.682] (-411.996) (-413.254) (-413.265) * (-412.997) [-410.282] (-422.448) (-412.093) -- 0:00:56
81500 -- (-414.601) (-411.347) (-420.104) [-411.686] * [-410.345] (-413.306) (-414.831) (-412.789) -- 0:00:56
82000 -- [-414.786] (-414.285) (-415.923) (-411.148) * (-411.259) (-413.509) [-412.133] (-411.397) -- 0:00:55
82500 -- (-412.019) (-413.492) [-415.141] (-410.837) * (-408.956) (-411.048) (-413.251) [-410.425] -- 0:00:55
83000 -- (-417.005) [-416.588] (-410.986) (-411.326) * (-408.520) [-415.809] (-412.505) (-409.638) -- 0:00:55
83500 -- (-414.603) (-411.016) (-414.763) [-414.410] * (-409.917) (-415.746) [-413.725] (-410.744) -- 0:00:54
84000 -- (-411.929) (-412.252) (-416.293) [-413.754] * (-412.698) (-413.349) (-412.835) [-410.838] -- 0:00:54
84500 -- [-411.272] (-420.093) (-412.370) (-415.840) * (-414.246) (-415.201) [-412.224] (-411.791) -- 0:00:54
85000 -- (-411.909) [-415.824] (-413.273) (-413.678) * (-415.202) (-412.839) (-414.998) [-412.240] -- 0:00:53
Average standard deviation of split frequencies: 0.020708
85500 -- (-410.270) [-412.212] (-414.486) (-418.344) * (-411.851) (-415.468) (-415.634) [-412.607] -- 0:00:53
86000 -- [-412.289] (-411.507) (-412.152) (-413.732) * [-410.520] (-413.558) (-412.525) (-409.631) -- 0:00:53
86500 -- (-412.686) [-410.385] (-412.464) (-419.108) * [-417.239] (-413.893) (-414.933) (-411.134) -- 0:00:52
87000 -- (-413.485) [-411.943] (-411.413) (-415.081) * [-411.101] (-417.244) (-418.303) (-412.195) -- 0:00:52
87500 -- (-411.932) [-417.265] (-417.416) (-416.464) * (-411.715) [-414.779] (-411.188) (-412.330) -- 0:01:02
88000 -- (-410.030) (-411.550) (-413.673) [-410.580] * (-412.178) (-416.877) (-413.434) [-414.503] -- 0:01:02
88500 -- (-411.446) (-414.409) (-414.673) [-412.925] * (-411.250) (-417.840) [-412.374] (-416.138) -- 0:01:01
89000 -- (-413.650) (-415.368) [-410.895] (-416.621) * (-414.659) [-416.843] (-414.682) (-416.667) -- 0:01:01
89500 -- (-411.355) [-410.026] (-410.913) (-412.984) * (-414.084) (-410.452) (-416.000) [-418.555] -- 0:01:01
90000 -- [-410.492] (-415.210) (-416.608) (-412.192) * [-410.949] (-413.738) (-411.459) (-416.536) -- 0:01:00
Average standard deviation of split frequencies: 0.022530
90500 -- (-413.430) (-413.407) [-411.954] (-411.803) * (-413.240) [-415.663] (-414.882) (-412.777) -- 0:01:00
91000 -- (-412.462) (-411.253) [-411.768] (-414.040) * (-417.613) (-410.596) [-412.659] (-414.962) -- 0:00:59
91500 -- [-409.179] (-415.712) (-413.261) (-411.364) * [-413.245] (-410.735) (-412.697) (-414.701) -- 0:00:59
92000 -- (-410.950) (-412.447) (-409.591) [-414.233] * (-413.913) (-417.402) [-411.345] (-412.869) -- 0:00:59
92500 -- [-411.040] (-412.756) (-412.889) (-414.034) * (-412.435) [-416.782] (-411.436) (-410.941) -- 0:00:58
93000 -- (-414.187) (-412.570) (-418.538) [-413.744] * (-415.040) (-411.783) [-413.430] (-412.068) -- 0:00:58
93500 -- (-409.791) (-412.629) (-413.166) [-414.647] * (-414.300) [-412.329] (-410.275) (-414.639) -- 0:00:58
94000 -- (-413.958) (-411.743) [-418.998] (-414.722) * (-414.706) [-410.915] (-414.892) (-419.305) -- 0:00:57
94500 -- [-410.557] (-412.470) (-418.847) (-412.944) * (-413.065) (-414.779) [-414.020] (-415.481) -- 0:00:57
95000 -- (-412.091) (-414.413) (-413.710) [-414.208] * (-412.012) [-412.617] (-413.242) (-413.093) -- 0:00:57
Average standard deviation of split frequencies: 0.023686
95500 -- (-410.306) (-411.613) [-415.680] (-418.717) * (-412.048) (-413.074) [-413.022] (-412.365) -- 0:00:56
96000 -- [-411.343] (-411.417) (-410.538) (-415.466) * (-416.411) (-415.250) (-411.253) [-411.653] -- 0:00:56
96500 -- [-411.420] (-413.885) (-411.805) (-411.271) * (-414.956) (-419.523) [-410.402] (-413.141) -- 0:00:56
97000 -- [-413.081] (-411.532) (-409.967) (-416.667) * (-412.700) (-413.232) (-411.804) [-413.205] -- 0:00:55
97500 -- [-411.646] (-414.346) (-411.048) (-416.066) * (-412.952) (-412.976) (-412.959) [-410.794] -- 0:00:55
98000 -- (-412.676) (-413.417) (-415.661) [-414.198] * [-410.814] (-411.298) (-412.338) (-410.480) -- 0:00:55
98500 -- (-409.835) [-416.341] (-412.514) (-416.319) * (-411.860) [-413.297] (-411.682) (-414.677) -- 0:00:54
99000 -- [-410.332] (-416.354) (-415.939) (-415.718) * (-413.901) (-412.930) (-414.161) [-409.686] -- 0:00:54
99500 -- [-409.680] (-412.703) (-415.865) (-411.993) * (-417.320) (-414.368) (-417.160) [-410.552] -- 0:00:54
100000 -- (-411.741) [-412.746] (-413.728) (-411.341) * (-416.398) (-411.914) [-414.196] (-410.377) -- 0:00:54
Average standard deviation of split frequencies: 0.021486
100500 -- (-410.225) [-413.626] (-413.886) (-418.903) * (-413.544) (-416.783) [-415.372] (-416.166) -- 0:00:53
101000 -- (-410.876) (-417.323) [-413.812] (-414.721) * (-416.102) (-412.074) (-411.470) [-409.838] -- 0:00:53
101500 -- (-411.490) (-415.888) (-415.862) [-417.546] * [-412.049] (-416.105) (-414.251) (-413.773) -- 0:00:53
102000 -- [-413.590] (-416.171) (-414.373) (-414.465) * [-412.010] (-415.797) (-411.595) (-412.479) -- 0:00:52
102500 -- [-411.992] (-416.983) (-415.443) (-418.638) * [-410.552] (-412.396) (-412.118) (-414.080) -- 0:00:52
103000 -- (-415.480) (-416.275) [-414.367] (-412.424) * (-411.529) [-414.230] (-416.091) (-413.281) -- 0:01:00
103500 -- (-413.654) [-414.629] (-414.747) (-411.851) * (-412.676) (-412.061) (-409.177) [-411.661] -- 0:01:00
104000 -- (-413.913) (-416.080) (-412.488) [-411.548] * (-414.331) (-416.056) [-411.595] (-414.725) -- 0:01:00
104500 -- (-414.326) [-414.726] (-411.773) (-412.461) * (-416.089) (-414.680) (-414.763) [-412.770] -- 0:00:59
105000 -- (-414.211) (-416.273) (-415.251) [-416.305] * (-412.518) (-416.838) [-410.460] (-412.341) -- 0:00:59
Average standard deviation of split frequencies: 0.020754
105500 -- [-413.522] (-416.193) (-415.060) (-415.240) * (-418.181) (-416.154) [-409.980] (-415.962) -- 0:00:59
106000 -- (-416.625) (-420.179) (-414.791) [-414.145] * (-412.256) (-416.825) (-415.207) [-412.248] -- 0:00:59
106500 -- (-413.126) (-418.702) [-412.243] (-415.008) * (-408.982) (-419.366) (-413.400) [-411.951] -- 0:00:58
107000 -- (-414.569) (-420.139) (-413.572) [-412.758] * (-413.835) (-415.968) (-413.792) [-411.439] -- 0:00:58
107500 -- (-415.829) (-417.954) (-413.585) [-411.847] * [-412.672] (-416.780) (-410.452) (-413.208) -- 0:00:58
108000 -- (-414.473) (-418.137) [-414.619] (-415.283) * (-411.054) (-418.110) [-411.579] (-415.070) -- 0:00:57
108500 -- (-410.870) (-419.149) (-412.970) [-411.825] * (-413.766) (-413.229) (-415.652) [-418.103] -- 0:00:57
109000 -- (-412.207) (-422.319) [-412.438] (-413.733) * [-411.016] (-416.996) (-415.740) (-415.869) -- 0:00:57
109500 -- (-417.028) (-417.382) (-422.827) [-411.720] * (-415.309) [-416.955] (-417.993) (-417.065) -- 0:00:56
110000 -- (-414.530) (-416.485) [-412.776] (-414.929) * (-414.610) [-415.747] (-413.322) (-412.353) -- 0:00:56
Average standard deviation of split frequencies: 0.016802
110500 -- (-415.773) (-414.417) [-412.464] (-415.993) * (-415.358) [-416.840] (-414.527) (-412.556) -- 0:00:56
111000 -- (-413.163) (-412.520) [-413.648] (-412.984) * (-411.323) (-414.177) (-414.136) [-410.141] -- 0:00:56
111500 -- (-415.521) (-417.116) [-415.703] (-416.594) * [-414.482] (-413.221) (-415.699) (-416.404) -- 0:00:55
112000 -- [-414.633] (-412.998) (-416.054) (-417.370) * (-411.794) (-412.431) [-413.713] (-417.870) -- 0:00:55
112500 -- (-412.708) [-415.730] (-418.016) (-418.411) * (-412.584) [-415.416] (-412.013) (-414.933) -- 0:00:55
113000 -- (-411.296) [-413.418] (-411.329) (-418.239) * (-412.477) (-412.102) (-411.989) [-415.472] -- 0:00:54
113500 -- (-413.672) (-419.983) [-413.616] (-421.820) * (-412.839) (-416.950) [-412.138] (-415.137) -- 0:00:54
114000 -- (-410.661) [-415.023] (-412.328) (-417.817) * (-413.414) [-411.683] (-414.557) (-413.593) -- 0:00:54
114500 -- (-411.776) [-411.632] (-415.980) (-418.662) * [-410.334] (-413.451) (-415.514) (-415.686) -- 0:00:54
115000 -- (-411.891) (-412.904) [-412.807] (-424.029) * (-409.251) (-411.356) (-413.590) [-414.315] -- 0:00:53
Average standard deviation of split frequencies: 0.018965
115500 -- [-410.610] (-414.111) (-412.401) (-413.558) * (-415.104) (-413.245) [-412.802] (-413.774) -- 0:00:53
116000 -- (-414.464) [-412.309] (-413.694) (-413.672) * (-412.834) (-417.541) [-412.076] (-417.754) -- 0:00:53
116500 -- [-410.975] (-416.862) (-412.614) (-417.583) * (-412.109) [-412.773] (-413.435) (-414.883) -- 0:00:53
117000 -- (-412.459) [-413.955] (-417.424) (-415.972) * (-411.613) (-412.127) (-412.568) [-418.632] -- 0:00:52
117500 -- [-414.481] (-418.024) (-415.600) (-415.251) * (-414.455) (-412.954) (-412.449) [-415.510] -- 0:00:52
118000 -- (-412.225) (-419.029) (-414.402) [-417.680] * (-413.501) (-413.974) (-417.977) [-412.493] -- 0:00:52
118500 -- (-414.115) [-417.088] (-416.535) (-421.925) * (-415.362) (-419.079) [-411.977] (-412.812) -- 0:00:52
119000 -- [-412.760] (-416.420) (-413.603) (-416.607) * [-410.931] (-409.946) (-411.234) (-417.382) -- 0:00:59
119500 -- (-414.074) (-414.972) [-412.584] (-416.374) * (-409.305) (-412.838) (-416.013) [-413.495] -- 0:00:58
120000 -- [-412.287] (-414.061) (-415.044) (-415.692) * (-413.955) (-413.881) [-410.197] (-413.561) -- 0:00:58
Average standard deviation of split frequencies: 0.025784
120500 -- (-412.492) (-417.630) (-413.581) [-414.619] * [-412.709] (-416.576) (-412.938) (-415.670) -- 0:00:58
121000 -- (-410.406) (-413.987) (-415.926) [-414.599] * (-410.817) [-416.100] (-413.721) (-416.661) -- 0:00:58
121500 -- [-409.982] (-412.443) (-413.360) (-418.326) * (-417.414) (-416.661) [-414.210] (-410.737) -- 0:00:57
122000 -- (-417.807) (-417.925) (-410.989) [-414.250] * (-411.570) (-417.099) (-414.989) [-414.339] -- 0:00:57
122500 -- (-411.843) [-413.053] (-413.483) (-413.070) * [-412.460] (-416.480) (-412.350) (-420.435) -- 0:00:57
123000 -- (-413.176) (-411.488) (-418.585) [-416.042] * (-409.858) (-418.453) (-414.827) [-416.513] -- 0:00:57
123500 -- (-411.204) (-421.498) [-414.097] (-414.696) * (-415.575) (-418.872) (-411.100) [-413.891] -- 0:00:56
124000 -- [-412.651] (-411.993) (-420.116) (-415.131) * (-411.071) [-417.546] (-411.803) (-413.128) -- 0:00:56
124500 -- [-415.021] (-411.714) (-415.076) (-417.727) * (-411.451) (-416.524) (-411.310) [-412.601] -- 0:00:56
125000 -- [-412.910] (-417.573) (-416.793) (-417.624) * [-411.415] (-420.422) (-414.784) (-415.696) -- 0:00:56
Average standard deviation of split frequencies: 0.022074
125500 -- (-416.686) (-414.962) (-412.983) [-416.096] * [-413.826] (-417.810) (-418.190) (-413.300) -- 0:00:55
126000 -- [-411.436] (-413.159) (-414.043) (-416.240) * (-413.388) [-411.994] (-416.356) (-413.387) -- 0:00:55
126500 -- [-411.497] (-411.313) (-413.265) (-417.312) * (-412.963) (-414.689) (-418.554) [-412.386] -- 0:00:55
127000 -- [-409.782] (-415.337) (-416.276) (-414.696) * [-410.047] (-413.801) (-412.860) (-414.870) -- 0:00:54
127500 -- (-415.741) [-411.666] (-413.097) (-414.974) * (-415.277) (-419.078) [-411.050] (-416.172) -- 0:00:54
128000 -- [-414.689] (-414.308) (-414.620) (-418.449) * (-415.790) (-412.472) [-411.043] (-416.220) -- 0:00:54
128500 -- [-415.005] (-416.816) (-414.885) (-419.348) * (-412.611) (-413.088) (-411.888) [-412.201] -- 0:00:54
129000 -- (-417.026) (-416.212) [-417.735] (-413.088) * [-417.164] (-413.403) (-416.025) (-414.855) -- 0:00:54
129500 -- (-412.333) (-414.628) (-414.054) [-414.747] * [-413.662] (-412.506) (-414.577) (-412.432) -- 0:00:53
130000 -- (-414.996) (-413.611) [-414.074] (-413.403) * (-410.742) (-417.994) [-410.740] (-418.896) -- 0:00:53
Average standard deviation of split frequencies: 0.024172
130500 -- [-415.939] (-413.415) (-415.388) (-414.280) * (-412.103) [-409.375] (-412.060) (-416.981) -- 0:00:53
131000 -- [-413.120] (-414.403) (-416.584) (-414.688) * (-409.905) (-415.146) (-410.480) [-418.116] -- 0:00:53
131500 -- [-409.069] (-414.662) (-416.139) (-419.765) * [-412.301] (-413.691) (-411.822) (-412.744) -- 0:00:52
132000 -- (-410.467) (-411.629) (-414.709) [-412.256] * (-412.787) [-412.246] (-411.056) (-417.908) -- 0:00:52
132500 -- [-410.509] (-411.460) (-416.259) (-409.843) * (-411.301) (-409.518) [-413.530] (-410.611) -- 0:00:52
133000 -- (-412.046) (-412.810) (-413.808) [-409.651] * (-416.648) (-411.127) (-409.179) [-412.394] -- 0:00:52
133500 -- (-415.319) (-413.310) [-412.965] (-413.080) * (-415.004) (-409.498) (-412.753) [-410.124] -- 0:00:51
134000 -- [-413.187] (-414.432) (-414.972) (-411.427) * (-418.549) [-411.516] (-412.867) (-416.262) -- 0:00:51
134500 -- (-410.921) (-414.227) (-416.613) [-413.005] * (-418.069) (-410.550) [-417.102] (-416.755) -- 0:00:57
135000 -- (-410.459) [-413.910] (-418.281) (-414.362) * (-414.412) (-414.195) [-412.029] (-419.061) -- 0:00:57
Average standard deviation of split frequencies: 0.016236
135500 -- (-415.143) [-411.173] (-412.249) (-414.038) * (-412.515) (-411.323) [-411.831] (-412.296) -- 0:00:57
136000 -- [-414.568] (-420.040) (-412.839) (-413.227) * (-414.037) (-412.744) [-411.785] (-412.946) -- 0:00:57
136500 -- [-413.918] (-417.702) (-412.488) (-413.093) * [-412.268] (-417.361) (-416.359) (-414.704) -- 0:00:56
137000 -- [-410.688] (-414.843) (-410.919) (-413.091) * (-414.685) (-411.538) [-410.793] (-410.828) -- 0:00:56
137500 -- (-415.164) [-414.771] (-413.670) (-412.219) * (-415.340) (-414.138) (-412.822) [-410.773] -- 0:00:56
138000 -- [-412.251] (-418.326) (-413.220) (-412.824) * [-415.922] (-417.172) (-413.192) (-414.059) -- 0:00:56
138500 -- (-416.197) [-412.851] (-413.671) (-417.411) * (-414.153) (-413.927) (-415.179) [-410.381] -- 0:00:55
139000 -- (-413.552) [-412.494] (-411.511) (-412.311) * (-410.653) [-409.798] (-413.162) (-411.941) -- 0:00:55
139500 -- (-416.549) [-409.936] (-418.942) (-412.845) * (-412.322) (-410.298) (-416.273) [-414.659] -- 0:00:55
140000 -- (-416.108) [-415.324] (-412.222) (-413.948) * (-416.593) (-414.583) (-415.805) [-418.128] -- 0:00:55
Average standard deviation of split frequencies: 0.017285
140500 -- (-417.211) (-414.400) (-410.984) [-414.468] * (-414.851) (-412.490) [-411.008] (-423.771) -- 0:00:55
141000 -- (-412.525) [-411.938] (-413.931) (-413.894) * [-415.022] (-413.249) (-413.145) (-418.486) -- 0:00:54
141500 -- (-414.731) (-411.338) [-411.422] (-416.869) * (-414.658) [-412.959] (-412.247) (-414.145) -- 0:00:54
142000 -- (-412.036) [-410.861] (-416.500) (-412.930) * [-415.891] (-412.366) (-411.291) (-412.602) -- 0:00:54
142500 -- (-412.684) (-415.779) (-415.396) [-416.361] * [-415.749] (-420.185) (-412.860) (-413.073) -- 0:00:54
143000 -- (-412.442) (-412.744) [-410.885] (-415.400) * (-416.143) (-416.025) (-413.582) [-417.466] -- 0:00:53
143500 -- [-416.607] (-417.936) (-412.907) (-416.666) * (-414.247) (-416.692) (-411.661) [-413.161] -- 0:00:53
144000 -- [-417.234] (-413.164) (-413.145) (-419.651) * (-411.758) (-413.051) [-411.241] (-411.277) -- 0:00:53
144500 -- [-413.809] (-414.073) (-412.600) (-415.272) * [-413.507] (-412.437) (-411.681) (-412.766) -- 0:00:53
145000 -- (-411.684) (-414.595) (-411.408) [-414.261] * (-413.764) (-411.753) [-410.976] (-411.940) -- 0:00:53
Average standard deviation of split frequencies: 0.016605
145500 -- (-414.529) (-414.553) [-418.330] (-413.813) * [-411.705] (-412.224) (-412.261) (-408.461) -- 0:00:52
146000 -- (-412.137) [-414.449] (-413.072) (-413.850) * (-412.929) (-412.905) (-410.895) [-410.500] -- 0:00:52
146500 -- (-415.713) [-412.394] (-417.681) (-412.986) * (-414.555) [-414.625] (-414.242) (-411.798) -- 0:00:52
147000 -- (-409.905) [-410.734] (-415.138) (-412.091) * (-420.770) (-413.796) (-415.566) [-409.653] -- 0:00:52
147500 -- (-413.865) (-411.717) (-419.685) [-414.512] * (-418.176) [-412.034] (-410.234) (-409.199) -- 0:00:52
148000 -- [-413.649] (-412.994) (-413.308) (-413.535) * [-417.424] (-411.713) (-411.981) (-412.327) -- 0:00:51
148500 -- (-412.259) (-413.848) (-413.427) [-412.389] * (-414.529) [-411.148] (-415.535) (-410.709) -- 0:00:51
149000 -- (-415.219) (-415.731) (-416.402) [-411.715] * (-409.825) [-412.223] (-414.927) (-414.468) -- 0:00:51
149500 -- (-415.523) (-416.218) [-415.554] (-414.883) * (-411.048) [-414.448] (-415.079) (-415.560) -- 0:00:56
150000 -- (-418.037) (-412.971) [-412.822] (-412.683) * (-414.759) [-416.473] (-412.860) (-416.240) -- 0:00:56
Average standard deviation of split frequencies: 0.017052
150500 -- (-414.304) (-410.708) [-413.425] (-419.002) * (-417.621) (-410.678) (-414.011) [-412.527] -- 0:00:56
151000 -- [-413.660] (-412.620) (-413.208) (-416.125) * (-416.326) [-412.564] (-414.439) (-413.786) -- 0:00:56
151500 -- (-411.604) (-410.485) (-415.707) [-414.510] * (-413.305) [-410.773] (-413.634) (-413.900) -- 0:00:56
152000 -- (-418.106) (-411.497) (-413.179) [-416.229] * [-411.945] (-412.588) (-410.259) (-419.378) -- 0:00:55
152500 -- (-415.471) (-414.945) [-413.984] (-416.824) * (-414.681) [-417.945] (-411.360) (-419.213) -- 0:00:55
153000 -- [-414.003] (-417.683) (-415.513) (-415.445) * (-416.381) [-413.252] (-413.500) (-415.748) -- 0:00:55
153500 -- [-412.794] (-415.724) (-413.889) (-415.762) * [-410.514] (-413.996) (-414.695) (-411.979) -- 0:00:55
154000 -- (-415.548) [-412.641] (-410.416) (-420.358) * [-412.924] (-411.369) (-415.530) (-409.805) -- 0:00:54
154500 -- (-415.533) [-410.947] (-412.454) (-418.429) * (-414.857) (-414.202) (-410.875) [-412.449] -- 0:00:54
155000 -- (-415.708) (-412.688) (-413.988) [-410.957] * (-416.922) (-414.454) (-410.358) [-410.880] -- 0:00:54
Average standard deviation of split frequencies: 0.016771
155500 -- (-412.099) [-412.787] (-411.734) (-416.782) * (-414.474) [-411.364] (-410.864) (-413.411) -- 0:00:54
156000 -- [-418.180] (-413.105) (-414.981) (-414.154) * (-413.471) (-412.048) [-411.721] (-414.012) -- 0:00:54
156500 -- (-415.429) [-409.648] (-415.680) (-414.744) * (-412.497) (-413.470) [-411.479] (-414.653) -- 0:00:53
157000 -- (-422.992) (-418.719) [-412.725] (-416.111) * (-413.341) (-412.522) [-412.683] (-413.146) -- 0:00:53
157500 -- (-416.474) [-414.264] (-413.576) (-412.280) * [-411.833] (-410.555) (-413.369) (-415.990) -- 0:00:53
158000 -- (-419.846) [-410.430] (-417.011) (-412.685) * (-412.145) (-416.584) [-413.616] (-416.350) -- 0:00:53
158500 -- (-424.437) [-415.574] (-414.249) (-413.612) * (-412.355) [-411.937] (-414.020) (-416.538) -- 0:00:53
159000 -- (-418.510) (-413.874) (-411.995) [-411.178] * (-410.259) [-414.355] (-413.251) (-414.480) -- 0:00:52
159500 -- [-410.669] (-414.824) (-412.582) (-414.494) * [-412.935] (-412.955) (-413.070) (-416.703) -- 0:00:52
160000 -- (-415.028) (-414.231) [-412.139] (-414.451) * (-417.941) [-413.107] (-413.607) (-418.289) -- 0:00:52
Average standard deviation of split frequencies: 0.015906
160500 -- (-417.367) (-413.435) [-411.576] (-414.338) * (-411.624) (-415.456) (-413.522) [-411.953] -- 0:00:52
161000 -- (-417.044) [-415.744] (-412.875) (-413.030) * (-411.293) (-414.304) (-412.191) [-412.527] -- 0:00:52
161500 -- (-412.040) (-417.639) [-411.441] (-412.409) * [-411.321] (-415.567) (-415.597) (-415.256) -- 0:00:51
162000 -- [-414.267] (-413.333) (-414.212) (-412.874) * (-413.921) (-416.600) [-413.847] (-412.610) -- 0:00:51
162500 -- (-413.590) [-416.297] (-414.611) (-413.296) * [-413.026] (-419.448) (-409.545) (-412.011) -- 0:00:51
163000 -- (-416.228) (-418.114) (-412.352) [-414.570] * (-414.336) (-411.752) [-411.961] (-414.238) -- 0:00:51
163500 -- [-411.831] (-411.916) (-411.637) (-412.174) * [-416.899] (-416.492) (-414.166) (-414.820) -- 0:00:51
164000 -- (-413.203) (-413.608) [-408.995] (-413.026) * (-412.484) (-411.467) [-411.600] (-418.078) -- 0:00:50
164500 -- (-417.648) (-412.008) [-410.840] (-411.604) * (-414.078) (-413.121) [-413.904] (-414.180) -- 0:00:50
165000 -- (-411.757) (-417.219) [-415.736] (-411.651) * (-411.783) (-411.973) [-412.603] (-413.466) -- 0:00:55
Average standard deviation of split frequencies: 0.016471
165500 -- (-413.231) (-413.068) [-411.168] (-412.162) * (-414.526) (-416.482) [-415.279] (-415.967) -- 0:00:55
166000 -- (-415.006) (-415.276) [-415.736] (-411.956) * [-415.121] (-414.602) (-412.178) (-414.597) -- 0:00:55
166500 -- (-413.343) (-414.688) [-412.645] (-412.468) * (-413.740) (-415.072) [-413.416] (-417.579) -- 0:00:55
167000 -- (-415.162) (-417.763) [-411.605] (-411.749) * [-411.463] (-413.920) (-410.894) (-411.454) -- 0:00:54
167500 -- (-412.053) (-417.100) (-413.513) [-412.771] * (-415.056) [-416.120] (-414.119) (-414.552) -- 0:00:54
168000 -- (-417.051) [-412.191] (-413.061) (-414.839) * (-413.148) [-415.503] (-410.718) (-418.420) -- 0:00:54
168500 -- [-414.319] (-418.230) (-413.561) (-414.667) * (-411.669) (-414.825) (-412.650) [-413.788] -- 0:00:54
169000 -- [-411.669] (-414.042) (-417.698) (-411.081) * (-415.384) (-411.023) [-417.208] (-418.655) -- 0:00:54
169500 -- (-413.444) (-418.125) [-419.031] (-413.048) * (-412.137) (-414.754) [-414.070] (-413.218) -- 0:00:53
170000 -- (-411.703) (-411.296) [-412.794] (-414.343) * (-410.707) (-415.873) [-411.615] (-414.048) -- 0:00:53
Average standard deviation of split frequencies: 0.015264
170500 -- (-412.690) (-416.483) (-409.298) [-409.751] * (-410.122) (-417.795) (-409.504) [-415.007] -- 0:00:53
171000 -- (-417.197) (-413.096) (-412.630) [-411.002] * (-413.626) (-412.060) [-412.171] (-415.271) -- 0:00:53
171500 -- [-413.098] (-414.320) (-413.846) (-412.667) * (-416.208) [-418.379] (-414.636) (-417.464) -- 0:00:53
172000 -- (-414.736) (-412.189) [-416.248] (-415.194) * (-410.687) (-413.174) [-412.481] (-413.616) -- 0:00:52
172500 -- [-412.471] (-413.534) (-416.737) (-413.372) * [-411.945] (-410.906) (-419.726) (-417.645) -- 0:00:52
173000 -- (-414.690) [-414.666] (-417.317) (-416.182) * [-411.555] (-416.098) (-414.341) (-415.609) -- 0:00:52
173500 -- (-416.839) (-412.600) [-411.462] (-414.767) * (-414.009) [-412.677] (-413.549) (-416.442) -- 0:00:52
174000 -- (-414.784) (-410.536) [-414.974] (-414.365) * [-414.762] (-411.663) (-414.377) (-418.045) -- 0:00:52
174500 -- (-413.818) (-415.526) (-409.009) [-413.019] * (-415.995) [-413.166] (-412.137) (-413.054) -- 0:00:52
175000 -- (-411.840) (-416.583) [-411.502] (-412.368) * (-412.142) [-413.071] (-413.685) (-412.980) -- 0:00:51
Average standard deviation of split frequencies: 0.015922
175500 -- [-413.873] (-413.247) (-416.203) (-412.114) * (-413.084) (-417.642) [-412.250] (-414.150) -- 0:00:51
176000 -- (-412.139) (-413.688) (-416.489) [-410.199] * (-413.756) [-413.947] (-412.246) (-411.426) -- 0:00:51
176500 -- (-419.102) (-416.135) (-412.093) [-412.814] * (-421.408) (-415.034) (-410.224) [-415.536] -- 0:00:51
177000 -- [-411.668] (-412.634) (-410.888) (-412.766) * (-416.550) (-415.028) [-410.851] (-410.897) -- 0:00:51
177500 -- [-414.033] (-414.899) (-413.833) (-415.812) * [-414.960] (-418.280) (-410.800) (-411.734) -- 0:00:50
178000 -- (-413.687) (-415.606) [-411.535] (-414.009) * (-413.313) (-417.694) (-412.382) [-413.816] -- 0:00:50
178500 -- [-413.652] (-413.761) (-412.653) (-412.978) * (-415.440) (-416.064) (-412.537) [-412.650] -- 0:00:50
179000 -- (-413.560) (-416.069) (-413.037) [-411.827] * [-413.139] (-417.666) (-411.367) (-414.106) -- 0:00:50
179500 -- (-416.956) [-416.467] (-412.327) (-412.720) * [-412.046] (-415.298) (-412.164) (-410.860) -- 0:00:50
180000 -- (-411.152) (-419.245) (-412.796) [-416.137] * [-412.508] (-414.876) (-412.527) (-413.678) -- 0:00:50
Average standard deviation of split frequencies: 0.018555
180500 -- (-416.285) (-415.123) (-411.851) [-412.910] * [-419.209] (-412.786) (-415.180) (-411.955) -- 0:00:54
181000 -- (-415.572) (-417.474) [-412.477] (-413.934) * (-416.190) (-413.008) [-411.251] (-412.951) -- 0:00:54
181500 -- [-411.402] (-420.688) (-413.384) (-413.211) * [-416.677] (-414.715) (-411.289) (-410.416) -- 0:00:54
182000 -- [-415.895] (-414.085) (-413.111) (-414.275) * (-413.978) (-417.161) (-415.199) [-411.540] -- 0:00:53
182500 -- [-413.958] (-413.163) (-413.620) (-409.337) * (-409.748) (-414.749) (-417.451) [-410.232] -- 0:00:53
183000 -- (-415.110) (-414.535) (-416.616) [-411.312] * (-412.800) (-414.410) (-416.214) [-410.678] -- 0:00:53
183500 -- (-411.351) (-414.670) (-415.507) [-412.856] * (-412.945) (-412.593) [-411.760] (-413.402) -- 0:00:53
184000 -- (-414.146) (-417.453) (-413.153) [-410.551] * (-413.835) (-411.489) (-412.137) [-413.776] -- 0:00:53
184500 -- (-416.103) (-412.755) (-416.595) [-410.338] * (-420.705) (-414.964) (-412.338) [-410.407] -- 0:00:53
185000 -- (-412.607) [-417.453] (-411.720) (-410.155) * (-421.497) (-414.459) [-412.966] (-413.185) -- 0:00:52
Average standard deviation of split frequencies: 0.020009
185500 -- (-413.526) [-418.305] (-414.504) (-414.101) * (-427.602) (-412.122) [-412.103] (-409.934) -- 0:00:52
186000 -- [-411.813] (-417.439) (-415.035) (-413.268) * (-412.963) (-417.003) [-414.222] (-412.794) -- 0:00:52
186500 -- (-414.049) (-416.833) (-415.598) [-413.179] * (-418.604) (-415.449) (-416.930) [-410.817] -- 0:00:52
187000 -- (-416.672) (-416.996) [-416.563] (-413.956) * (-413.361) (-414.998) [-413.453] (-411.493) -- 0:00:52
187500 -- [-412.793] (-419.756) (-414.022) (-411.269) * [-409.948] (-417.102) (-413.403) (-413.399) -- 0:00:52
188000 -- (-416.490) (-415.354) (-412.688) [-411.971] * (-414.213) (-413.968) [-410.805] (-412.718) -- 0:00:51
188500 -- (-416.309) (-415.461) (-415.298) [-411.094] * (-411.273) (-414.153) [-410.704] (-412.225) -- 0:00:51
189000 -- (-413.736) [-415.134] (-421.471) (-411.356) * (-413.833) (-416.606) (-412.924) [-414.114] -- 0:00:51
189500 -- (-414.648) (-414.257) [-419.970] (-411.938) * (-411.438) (-411.794) [-413.855] (-413.143) -- 0:00:51
190000 -- (-412.669) [-415.388] (-420.499) (-412.858) * [-411.761] (-419.307) (-414.554) (-410.448) -- 0:00:51
Average standard deviation of split frequencies: 0.020603
190500 -- [-411.344] (-412.422) (-413.308) (-413.607) * (-413.783) (-414.297) (-412.033) [-410.471] -- 0:00:50
191000 -- [-412.385] (-414.237) (-415.409) (-411.461) * (-418.533) (-412.947) (-412.592) [-408.289] -- 0:00:50
191500 -- (-416.498) (-415.358) (-415.020) [-408.951] * (-412.785) [-414.435] (-413.085) (-410.454) -- 0:00:50
192000 -- (-412.923) (-413.216) [-410.339] (-415.471) * (-415.582) (-419.427) [-413.962] (-410.324) -- 0:00:50
192500 -- (-413.983) (-411.281) (-414.335) [-411.145] * (-414.212) (-421.627) (-417.933) [-411.718] -- 0:00:50
193000 -- (-417.442) (-413.273) [-417.256] (-410.251) * (-415.374) (-411.311) (-410.358) [-411.537] -- 0:00:50
193500 -- (-413.736) [-410.819] (-414.236) (-413.864) * (-416.272) (-414.255) (-412.121) [-411.850] -- 0:00:50
194000 -- (-413.369) (-415.191) [-414.048] (-416.064) * (-415.488) (-420.042) [-413.261] (-411.083) -- 0:00:49
194500 -- (-413.214) (-418.201) [-413.687] (-411.998) * (-414.593) (-416.130) (-411.706) [-411.223] -- 0:00:49
195000 -- (-414.820) [-413.742] (-412.292) (-413.423) * (-414.534) (-412.660) (-417.036) [-410.242] -- 0:00:49
Average standard deviation of split frequencies: 0.021646
195500 -- (-413.326) [-412.557] (-415.714) (-413.091) * (-413.604) (-415.958) [-416.127] (-410.058) -- 0:00:49
196000 -- (-415.290) (-412.702) (-417.969) [-413.583] * (-415.683) (-416.621) (-412.836) [-412.041] -- 0:00:53
196500 -- (-414.136) (-415.150) [-414.546] (-412.378) * [-412.310] (-412.793) (-409.030) (-409.366) -- 0:00:53
197000 -- [-413.393] (-411.272) (-416.632) (-417.102) * (-417.369) [-413.628] (-413.115) (-410.473) -- 0:00:52
197500 -- (-415.220) [-410.652] (-413.056) (-412.458) * (-416.205) [-414.025] (-413.085) (-418.003) -- 0:00:52
198000 -- (-415.995) (-411.954) [-410.968] (-411.942) * (-411.884) [-415.107] (-413.332) (-413.450) -- 0:00:52
198500 -- (-424.494) (-416.972) (-415.495) [-411.906] * (-413.469) (-416.900) (-416.270) [-412.516] -- 0:00:52
199000 -- (-416.991) (-417.005) (-412.947) [-413.996] * (-414.419) (-415.123) (-412.871) [-412.931] -- 0:00:52
199500 -- (-414.148) (-413.974) (-415.209) [-413.422] * (-412.869) (-416.361) [-413.968] (-411.601) -- 0:00:52
200000 -- [-415.693] (-413.193) (-413.874) (-415.541) * (-413.413) (-416.415) [-413.138] (-415.253) -- 0:00:51
Average standard deviation of split frequencies: 0.019899
200500 -- (-411.070) (-413.173) [-410.272] (-414.870) * (-414.199) (-412.974) [-414.533] (-414.797) -- 0:00:51
201000 -- (-417.667) [-412.440] (-413.723) (-413.555) * (-412.784) (-414.767) [-411.544] (-412.054) -- 0:00:51
201500 -- [-416.260] (-414.154) (-412.837) (-412.508) * (-412.616) (-415.054) (-411.481) [-411.087] -- 0:00:51
202000 -- (-413.662) [-413.082] (-412.407) (-413.897) * (-415.341) [-414.168] (-412.490) (-413.019) -- 0:00:51
202500 -- (-412.737) [-414.084] (-412.517) (-411.749) * (-416.828) (-412.819) (-411.622) [-413.769] -- 0:00:51
203000 -- (-413.031) [-411.619] (-415.610) (-419.638) * (-414.738) (-416.216) (-411.821) [-411.305] -- 0:00:51
203500 -- (-410.311) [-412.538] (-417.136) (-416.186) * (-419.221) [-411.540] (-415.487) (-412.584) -- 0:00:50
204000 -- [-414.021] (-410.687) (-415.270) (-412.414) * (-419.389) (-419.478) [-415.155] (-413.052) -- 0:00:50
204500 -- (-416.799) (-410.251) (-416.780) [-411.786] * (-423.343) (-415.148) [-413.730] (-410.676) -- 0:00:50
205000 -- (-420.210) (-417.190) (-414.566) [-412.337] * (-416.458) [-414.188] (-412.955) (-410.004) -- 0:00:50
Average standard deviation of split frequencies: 0.018180
205500 -- (-416.527) (-410.136) [-410.991] (-416.397) * (-417.541) (-419.510) (-414.190) [-410.397] -- 0:00:50
206000 -- (-415.205) (-413.799) [-412.066] (-415.207) * (-412.095) (-415.006) (-415.805) [-411.495] -- 0:00:50
206500 -- (-417.029) (-415.971) (-412.393) [-410.745] * (-413.430) (-414.559) [-411.190] (-412.772) -- 0:00:49
207000 -- (-414.119) [-411.618] (-416.700) (-417.727) * (-416.029) (-413.357) (-412.291) [-409.726] -- 0:00:49
207500 -- (-414.332) (-413.283) [-417.296] (-414.321) * (-413.013) [-412.606] (-414.008) (-413.016) -- 0:00:49
208000 -- [-415.871] (-415.926) (-413.414) (-413.843) * (-411.627) (-415.955) (-416.668) [-415.518] -- 0:00:49
208500 -- (-416.686) (-414.900) [-412.005] (-410.140) * (-415.206) (-418.570) [-413.983] (-416.443) -- 0:00:49
209000 -- (-413.117) (-413.272) [-409.963] (-416.711) * (-422.822) (-421.064) [-417.552] (-412.576) -- 0:00:49
209500 -- (-414.950) (-414.911) [-410.553] (-413.942) * (-417.390) (-421.363) (-411.865) [-412.959] -- 0:00:49
210000 -- (-413.264) (-421.783) [-412.820] (-418.111) * (-417.684) (-415.449) [-415.127] (-413.735) -- 0:00:48
Average standard deviation of split frequencies: 0.018523
210500 -- [-415.595] (-418.396) (-417.136) (-413.623) * (-416.514) (-415.966) [-414.721] (-414.870) -- 0:00:48
211000 -- (-417.190) (-414.605) [-415.199] (-413.249) * [-413.544] (-416.084) (-414.191) (-421.635) -- 0:00:48
211500 -- (-412.016) [-411.532] (-412.133) (-418.928) * [-417.079] (-416.555) (-412.841) (-414.488) -- 0:00:52
212000 -- (-414.878) (-411.273) (-410.170) [-410.942] * (-415.312) (-417.223) (-416.295) [-416.879] -- 0:00:52
212500 -- (-414.778) (-415.371) [-411.792] (-415.430) * [-411.483] (-417.479) (-412.566) (-413.644) -- 0:00:51
213000 -- (-416.163) (-415.561) [-410.870] (-414.826) * (-415.904) (-414.902) [-413.235] (-412.625) -- 0:00:51
213500 -- (-416.762) (-415.166) [-412.627] (-411.319) * [-416.438] (-416.659) (-413.729) (-413.054) -- 0:00:51
214000 -- (-413.042) (-417.700) (-412.151) [-412.831] * (-413.044) (-413.552) (-412.316) [-412.663] -- 0:00:51
214500 -- (-413.118) [-410.285] (-418.566) (-416.832) * (-415.955) (-414.389) (-415.737) [-413.623] -- 0:00:51
215000 -- (-413.235) [-414.909] (-413.943) (-417.021) * [-416.989] (-416.528) (-417.571) (-410.393) -- 0:00:51
Average standard deviation of split frequencies: 0.016853
215500 -- [-414.110] (-412.507) (-413.398) (-415.605) * (-416.914) (-414.204) [-415.785] (-409.824) -- 0:00:50
216000 -- [-413.969] (-412.822) (-413.962) (-414.351) * (-413.688) (-415.661) [-414.185] (-411.561) -- 0:00:50
216500 -- (-411.382) [-413.721] (-411.206) (-413.133) * (-415.190) (-415.041) [-411.649] (-414.386) -- 0:00:50
217000 -- (-416.583) (-413.738) [-411.892] (-413.659) * [-419.631] (-415.821) (-416.427) (-411.607) -- 0:00:50
217500 -- (-416.735) [-411.989] (-410.800) (-412.036) * [-415.702] (-412.770) (-416.111) (-415.473) -- 0:00:50
218000 -- [-414.529] (-413.197) (-412.094) (-410.166) * (-411.948) (-417.971) [-410.879] (-411.451) -- 0:00:50
218500 -- (-412.072) (-416.524) (-413.648) [-414.966] * [-413.166] (-414.648) (-416.078) (-414.337) -- 0:00:50
219000 -- [-411.370] (-414.459) (-410.552) (-415.800) * (-417.174) (-413.077) [-411.918] (-417.412) -- 0:00:49
219500 -- [-413.102] (-414.035) (-412.333) (-417.625) * (-418.215) (-414.743) [-414.370] (-410.947) -- 0:00:49
220000 -- (-415.050) (-411.181) [-415.113] (-421.842) * (-413.201) (-412.458) [-412.045] (-416.531) -- 0:00:49
Average standard deviation of split frequencies: 0.016462
220500 -- (-412.118) (-414.613) (-411.909) [-413.097] * (-413.447) (-417.037) [-413.447] (-412.452) -- 0:00:49
221000 -- (-411.802) [-413.681] (-415.318) (-416.048) * [-412.041] (-412.830) (-412.920) (-414.390) -- 0:00:49
221500 -- (-413.993) (-411.616) [-413.160] (-420.133) * (-416.595) [-410.980] (-410.382) (-419.523) -- 0:00:49
222000 -- (-411.204) [-412.571] (-415.325) (-414.345) * (-412.914) (-412.552) [-410.232] (-415.022) -- 0:00:49
222500 -- (-412.559) (-417.446) (-414.257) [-414.094] * (-416.416) [-411.213] (-415.763) (-411.820) -- 0:00:48
223000 -- (-415.786) (-412.990) (-410.145) [-413.627] * (-414.934) [-414.930] (-412.075) (-414.399) -- 0:00:48
223500 -- (-414.652) [-415.603] (-412.868) (-416.594) * (-411.251) (-415.269) (-411.306) [-412.786] -- 0:00:48
224000 -- (-416.896) (-416.500) (-414.104) [-413.561] * (-415.078) (-413.151) (-414.566) [-412.425] -- 0:00:48
224500 -- (-414.521) (-409.318) (-411.202) [-412.336] * (-418.567) (-416.267) (-411.166) [-414.068] -- 0:00:48
225000 -- (-417.495) (-414.624) [-415.856] (-411.007) * (-419.415) (-420.153) [-411.616] (-415.396) -- 0:00:48
Average standard deviation of split frequencies: 0.015644
225500 -- (-419.693) (-416.310) (-414.232) [-413.254] * (-414.080) (-414.409) (-412.852) [-414.905] -- 0:00:48
226000 -- [-411.476] (-412.756) (-413.234) (-414.857) * (-415.293) [-412.307] (-413.503) (-413.090) -- 0:00:47
226500 -- (-412.262) [-411.872] (-412.561) (-417.758) * (-412.573) (-414.915) (-411.272) [-414.284] -- 0:00:47
227000 -- (-414.086) (-417.731) [-410.418] (-419.636) * (-411.455) (-412.420) [-411.207] (-417.765) -- 0:00:47
227500 -- [-411.970] (-417.185) (-415.475) (-412.361) * (-411.811) (-413.117) [-411.163] (-412.507) -- 0:00:50
228000 -- (-413.900) [-411.646] (-413.443) (-414.620) * (-414.194) (-411.781) (-412.623) [-413.261] -- 0:00:50
228500 -- (-414.442) [-413.856] (-415.285) (-419.786) * (-420.023) [-410.876] (-413.111) (-414.283) -- 0:00:50
229000 -- (-414.917) (-412.366) (-411.407) [-417.785] * [-412.461] (-415.870) (-414.908) (-416.473) -- 0:00:50
229500 -- (-415.341) (-414.623) (-416.674) [-414.807] * [-411.795] (-422.563) (-412.760) (-412.265) -- 0:00:50
230000 -- (-412.305) (-424.503) (-412.767) [-411.521] * (-412.661) [-414.325] (-415.630) (-412.986) -- 0:00:50
Average standard deviation of split frequencies: 0.017144
230500 -- [-410.820] (-420.525) (-416.138) (-415.611) * (-413.260) (-418.954) [-416.144] (-410.797) -- 0:00:50
231000 -- [-414.260] (-415.749) (-416.984) (-417.137) * (-413.156) (-412.127) (-414.325) [-413.528] -- 0:00:49
231500 -- (-414.901) (-413.923) (-410.253) [-413.480] * (-418.233) (-413.912) (-413.024) [-412.851] -- 0:00:49
232000 -- (-415.068) [-414.538] (-415.043) (-414.157) * (-412.109) (-417.025) [-412.757] (-413.868) -- 0:00:49
232500 -- (-417.052) [-413.827] (-412.002) (-411.362) * [-410.823] (-415.594) (-411.489) (-414.874) -- 0:00:49
233000 -- (-415.621) [-417.591] (-412.156) (-411.225) * [-411.150] (-417.053) (-410.385) (-417.500) -- 0:00:49
233500 -- (-421.059) (-413.334) (-413.384) [-410.637] * (-410.308) [-414.712] (-412.814) (-417.322) -- 0:00:49
234000 -- [-417.972] (-410.872) (-413.750) (-412.236) * (-412.108) (-414.821) (-413.876) [-412.035] -- 0:00:49
234500 -- (-416.216) [-412.699] (-413.084) (-411.145) * (-415.852) (-416.838) [-412.796] (-414.507) -- 0:00:48
235000 -- (-412.055) (-414.879) (-411.481) [-412.577] * (-414.640) (-417.020) [-411.598] (-414.935) -- 0:00:48
Average standard deviation of split frequencies: 0.016868
235500 -- (-413.038) (-413.109) (-412.133) [-413.391] * (-412.207) (-416.361) [-411.121] (-413.162) -- 0:00:48
236000 -- [-411.155] (-410.448) (-410.381) (-411.810) * (-415.120) (-413.055) [-416.323] (-415.359) -- 0:00:48
236500 -- (-415.268) [-412.713] (-411.638) (-413.039) * [-415.358] (-415.397) (-412.815) (-414.360) -- 0:00:48
237000 -- (-414.021) (-416.537) (-411.361) [-411.000] * [-414.200] (-415.822) (-413.301) (-415.007) -- 0:00:48
237500 -- (-422.526) (-413.906) (-409.769) [-410.822] * (-412.327) (-415.339) (-410.443) [-413.547] -- 0:00:48
238000 -- (-411.655) (-412.302) (-412.438) [-408.249] * [-411.842] (-415.351) (-416.693) (-416.196) -- 0:00:48
238500 -- (-412.502) [-409.811] (-409.883) (-412.786) * (-420.508) [-414.428] (-411.700) (-416.207) -- 0:00:47
239000 -- (-419.063) [-413.946] (-411.699) (-416.244) * (-420.127) (-418.434) [-410.579] (-416.264) -- 0:00:47
239500 -- (-415.447) (-413.602) [-410.276] (-413.702) * (-414.301) [-414.620] (-412.864) (-413.863) -- 0:00:47
240000 -- (-412.819) (-413.430) [-413.338] (-412.813) * [-413.080] (-412.242) (-413.752) (-415.949) -- 0:00:47
Average standard deviation of split frequencies: 0.017513
240500 -- (-413.321) (-413.787) (-413.638) [-413.341] * (-414.176) [-418.182] (-416.353) (-413.851) -- 0:00:47
241000 -- [-414.168] (-411.386) (-413.001) (-410.418) * (-413.267) (-417.042) [-414.894] (-416.589) -- 0:00:47
241500 -- (-416.468) (-421.096) [-411.825] (-415.177) * (-414.073) (-415.031) [-413.353] (-413.072) -- 0:00:47
242000 -- (-418.402) (-417.098) [-413.278] (-416.241) * (-413.944) (-415.520) (-414.657) [-414.041] -- 0:00:46
242500 -- (-414.468) [-415.874] (-411.757) (-412.663) * [-413.152] (-413.280) (-415.672) (-413.739) -- 0:00:46
243000 -- (-412.703) (-415.709) (-415.280) [-413.710] * [-412.773] (-414.748) (-412.899) (-417.102) -- 0:00:49
243500 -- [-411.111] (-413.305) (-411.333) (-410.606) * (-414.128) [-412.858] (-415.619) (-412.297) -- 0:00:49
244000 -- (-416.565) [-414.784] (-414.944) (-410.690) * [-416.268] (-421.438) (-414.094) (-411.810) -- 0:00:49
244500 -- (-414.141) (-412.634) [-410.564] (-411.130) * (-412.631) [-416.723] (-416.549) (-415.551) -- 0:00:49
245000 -- [-411.486] (-415.199) (-412.740) (-415.784) * (-414.994) (-417.580) (-415.444) [-410.573] -- 0:00:49
Average standard deviation of split frequencies: 0.017459
245500 -- [-413.096] (-416.173) (-412.382) (-415.994) * (-417.241) (-415.351) (-411.868) [-412.331] -- 0:00:49
246000 -- (-410.955) (-414.718) (-414.798) [-413.049] * (-415.577) (-413.397) [-411.917] (-410.893) -- 0:00:49
246500 -- [-412.226] (-414.859) (-420.841) (-413.439) * (-416.410) [-412.841] (-414.246) (-410.110) -- 0:00:48
247000 -- (-411.312) (-418.435) [-414.204] (-412.175) * (-413.311) (-417.367) (-415.706) [-413.681] -- 0:00:48
247500 -- (-415.062) (-413.691) [-411.858] (-413.430) * [-412.475] (-415.775) (-414.482) (-413.865) -- 0:00:48
248000 -- (-413.552) (-413.583) [-411.032] (-414.031) * [-414.000] (-411.066) (-412.893) (-409.921) -- 0:00:48
248500 -- (-412.797) [-413.130] (-412.541) (-415.345) * [-411.794] (-413.752) (-414.161) (-416.697) -- 0:00:48
249000 -- (-412.302) (-413.816) [-412.183] (-410.834) * (-415.010) (-411.798) (-418.817) [-416.058] -- 0:00:48
249500 -- [-414.503] (-414.520) (-413.843) (-414.661) * (-413.113) (-413.927) (-416.100) [-412.472] -- 0:00:48
250000 -- (-414.187) (-415.603) [-412.734] (-413.401) * (-414.328) [-418.618] (-416.910) (-411.296) -- 0:00:48
Average standard deviation of split frequencies: 0.017717
250500 -- (-416.797) (-414.251) [-409.712] (-413.395) * (-414.887) [-414.291] (-414.788) (-411.483) -- 0:00:47
251000 -- (-413.448) (-416.379) [-410.496] (-418.568) * (-413.420) [-417.202] (-420.012) (-417.176) -- 0:00:47
251500 -- (-418.991) (-414.572) [-413.793] (-421.332) * [-413.010] (-417.062) (-414.978) (-415.448) -- 0:00:47
252000 -- (-414.537) (-412.665) (-417.691) [-414.243] * [-413.412] (-415.810) (-412.732) (-414.167) -- 0:00:47
252500 -- (-411.803) (-411.465) (-414.899) [-411.659] * (-411.699) (-416.539) [-410.843] (-414.228) -- 0:00:47
253000 -- (-416.040) [-412.598] (-414.547) (-411.797) * (-415.388) [-411.218] (-415.494) (-409.801) -- 0:00:47
253500 -- [-416.294] (-416.259) (-414.494) (-414.272) * (-413.519) (-412.413) [-409.476] (-413.454) -- 0:00:47
254000 -- (-418.962) [-416.492] (-413.341) (-412.005) * (-411.829) (-412.778) (-411.023) [-411.944] -- 0:00:46
254500 -- (-420.291) [-413.266] (-412.247) (-414.442) * (-413.938) (-414.591) [-410.433] (-414.310) -- 0:00:46
255000 -- (-414.624) (-413.913) (-415.566) [-411.963] * (-415.211) (-413.386) (-413.403) [-411.340] -- 0:00:46
Average standard deviation of split frequencies: 0.016767
255500 -- (-414.043) (-408.721) [-416.796] (-415.563) * (-417.847) (-411.433) [-411.671] (-412.237) -- 0:00:46
256000 -- (-420.983) [-410.077] (-411.677) (-411.182) * (-415.547) [-410.792] (-413.307) (-411.151) -- 0:00:46
256500 -- (-414.855) (-412.514) [-410.686] (-413.991) * [-412.268] (-410.868) (-412.206) (-410.903) -- 0:00:46
257000 -- (-411.988) [-416.209] (-410.660) (-413.685) * (-411.528) [-414.977] (-410.809) (-418.225) -- 0:00:46
257500 -- (-413.731) (-412.993) [-413.431] (-410.685) * (-417.469) (-417.363) [-413.322] (-426.674) -- 0:00:46
258000 -- (-415.390) [-413.701] (-412.363) (-410.261) * (-418.264) [-413.812] (-414.022) (-412.274) -- 0:00:48
258500 -- (-415.964) (-411.776) [-411.367] (-412.957) * (-421.228) [-412.780] (-416.270) (-414.450) -- 0:00:48
259000 -- (-419.852) (-411.857) (-410.587) [-411.412] * (-414.814) [-413.800] (-415.253) (-416.434) -- 0:00:48
259500 -- [-413.573] (-412.626) (-413.980) (-413.032) * (-411.498) [-411.127] (-417.096) (-417.268) -- 0:00:48
260000 -- (-413.229) (-413.766) (-412.550) [-410.995] * (-412.124) (-413.335) [-415.000] (-412.894) -- 0:00:48
Average standard deviation of split frequencies: 0.016847
260500 -- (-417.873) [-412.944] (-413.128) (-413.710) * (-415.352) (-415.065) (-415.879) [-413.497] -- 0:00:48
261000 -- (-417.275) (-412.647) (-416.603) [-415.133] * (-414.328) (-418.461) [-415.554] (-411.726) -- 0:00:48
261500 -- (-415.769) [-415.553] (-413.159) (-411.853) * [-410.455] (-414.761) (-411.358) (-411.734) -- 0:00:48
262000 -- (-413.336) [-413.660] (-411.764) (-412.742) * (-411.692) (-416.974) [-412.657] (-414.706) -- 0:00:47
262500 -- (-414.305) (-416.382) [-411.449] (-412.821) * (-418.534) [-419.268] (-418.349) (-414.059) -- 0:00:47
263000 -- (-412.668) (-412.337) [-410.557] (-415.813) * (-413.592) (-411.253) (-416.078) [-415.897] -- 0:00:47
263500 -- (-416.986) (-412.708) [-412.152] (-418.236) * (-413.042) [-410.736] (-411.315) (-414.213) -- 0:00:47
264000 -- (-412.346) (-417.725) [-410.019] (-417.431) * [-412.946] (-410.896) (-414.639) (-415.486) -- 0:00:47
264500 -- [-411.423] (-415.458) (-413.846) (-416.818) * (-411.659) [-413.184] (-418.556) (-412.801) -- 0:00:47
265000 -- (-414.216) [-415.628] (-414.888) (-417.596) * [-414.384] (-412.604) (-411.632) (-415.352) -- 0:00:47
Average standard deviation of split frequencies: 0.016245
265500 -- [-413.220] (-413.351) (-418.168) (-423.543) * (-414.671) [-412.657] (-414.455) (-412.279) -- 0:00:47
266000 -- (-413.921) (-414.629) [-411.897] (-417.169) * [-412.693] (-413.900) (-417.622) (-414.809) -- 0:00:46
266500 -- (-411.660) (-415.697) (-412.854) [-414.556] * (-415.548) (-414.496) [-414.743] (-413.146) -- 0:00:46
267000 -- (-413.061) (-411.320) (-411.945) [-413.543] * [-416.259] (-413.187) (-412.937) (-415.032) -- 0:00:46
267500 -- (-413.930) (-412.189) [-410.215] (-413.703) * (-414.887) [-413.845] (-412.042) (-415.583) -- 0:00:46
268000 -- (-412.185) (-416.626) [-415.132] (-416.356) * (-413.782) (-417.329) (-419.307) [-412.895] -- 0:00:46
268500 -- (-414.311) (-415.704) [-410.035] (-420.401) * (-414.841) (-410.950) (-412.543) [-411.470] -- 0:00:46
269000 -- (-412.766) [-412.199] (-412.516) (-415.287) * (-414.270) (-417.508) (-414.381) [-412.891] -- 0:00:46
269500 -- (-413.841) (-414.668) (-412.069) [-417.919] * (-411.312) [-414.476] (-415.541) (-411.752) -- 0:00:46
270000 -- (-413.966) (-410.918) (-415.120) [-412.816] * (-417.271) (-414.635) (-415.874) [-412.033] -- 0:00:45
Average standard deviation of split frequencies: 0.016392
270500 -- (-412.268) [-414.300] (-416.106) (-419.918) * [-417.384] (-412.087) (-416.523) (-413.652) -- 0:00:45
271000 -- (-412.141) (-413.536) [-415.574] (-412.307) * (-418.453) (-414.704) [-414.323] (-410.374) -- 0:00:45
271500 -- [-411.278] (-410.959) (-411.251) (-414.467) * (-414.503) (-420.037) (-412.246) [-413.125] -- 0:00:45
272000 -- (-413.137) [-413.109] (-416.305) (-415.885) * (-416.412) [-412.211] (-415.414) (-412.868) -- 0:00:45
272500 -- (-413.634) [-410.760] (-411.461) (-417.800) * (-410.848) (-415.292) [-415.300] (-412.956) -- 0:00:48
273000 -- (-413.815) (-413.705) [-413.273] (-414.709) * [-409.283] (-410.529) (-417.739) (-413.233) -- 0:00:47
273500 -- (-417.245) (-415.033) (-420.114) [-418.522] * [-413.439] (-414.921) (-414.825) (-415.228) -- 0:00:47
274000 -- (-411.861) (-411.881) (-414.282) [-413.733] * (-413.144) (-417.588) [-415.956] (-415.097) -- 0:00:47
274500 -- (-416.392) (-411.707) (-415.915) [-415.100] * [-412.683] (-414.138) (-412.652) (-413.423) -- 0:00:47
275000 -- (-412.652) (-412.540) (-411.864) [-413.603] * (-411.612) (-412.432) [-413.602] (-412.250) -- 0:00:47
Average standard deviation of split frequencies: 0.015906
275500 -- (-413.773) [-413.327] (-415.361) (-413.148) * (-413.897) (-412.699) (-413.633) [-412.316] -- 0:00:47
276000 -- [-412.005] (-411.724) (-413.907) (-417.795) * (-415.724) [-413.627] (-413.558) (-419.107) -- 0:00:47
276500 -- (-416.803) [-416.844] (-413.941) (-416.462) * [-410.906] (-414.073) (-413.188) (-413.654) -- 0:00:47
277000 -- (-413.334) (-411.479) (-414.627) [-413.516] * (-415.044) (-417.030) [-414.236] (-414.007) -- 0:00:46
277500 -- (-414.679) (-413.588) [-415.884] (-417.204) * (-411.881) (-410.815) [-413.617] (-413.889) -- 0:00:46
278000 -- (-411.384) [-416.595] (-416.078) (-416.503) * (-411.722) (-417.500) (-415.748) [-414.215] -- 0:00:46
278500 -- (-415.758) [-413.709] (-414.507) (-419.340) * [-412.093] (-415.083) (-411.230) (-411.307) -- 0:00:46
279000 -- (-416.845) (-410.361) [-412.854] (-414.757) * [-410.897] (-414.517) (-413.200) (-419.119) -- 0:00:46
279500 -- [-412.292] (-410.516) (-417.304) (-418.479) * [-411.586] (-409.897) (-411.367) (-410.308) -- 0:00:46
280000 -- (-414.738) (-413.029) (-416.414) [-412.650] * (-410.743) [-413.450] (-413.852) (-418.303) -- 0:00:46
Average standard deviation of split frequencies: 0.016203
280500 -- (-414.988) (-414.681) (-412.837) [-413.197] * (-417.047) (-412.952) (-410.917) [-412.531] -- 0:00:46
281000 -- [-413.718] (-418.406) (-411.979) (-412.584) * [-414.839] (-413.429) (-411.637) (-416.938) -- 0:00:46
281500 -- [-410.703] (-412.635) (-411.676) (-414.552) * (-416.266) [-411.122] (-412.428) (-414.282) -- 0:00:45
282000 -- (-412.184) (-414.664) [-415.459] (-414.759) * (-412.984) [-416.881] (-413.247) (-415.731) -- 0:00:45
282500 -- (-415.252) (-414.778) (-414.758) [-414.533] * (-411.796) (-410.708) [-410.149] (-414.739) -- 0:00:45
283000 -- [-411.013] (-424.716) (-413.038) (-415.884) * (-411.481) (-412.413) (-413.513) [-413.225] -- 0:00:45
283500 -- (-412.410) [-411.895] (-416.734) (-415.582) * [-409.172] (-415.285) (-412.499) (-412.611) -- 0:00:45
284000 -- (-415.294) [-413.961] (-415.188) (-417.071) * (-415.394) (-413.642) (-411.711) [-416.178] -- 0:00:45
284500 -- (-411.967) (-417.036) [-416.597] (-415.097) * [-412.900] (-414.906) (-414.269) (-415.118) -- 0:00:45
285000 -- [-413.170] (-411.588) (-412.478) (-414.831) * (-412.121) (-414.345) [-412.010] (-412.147) -- 0:00:45
Average standard deviation of split frequencies: 0.015384
285500 -- (-410.133) (-413.606) (-414.345) [-416.997] * [-411.883] (-414.858) (-412.796) (-413.953) -- 0:00:45
286000 -- (-414.639) [-415.742] (-416.438) (-418.391) * (-414.635) [-414.992] (-419.023) (-412.840) -- 0:00:44
286500 -- [-413.508] (-410.738) (-414.437) (-414.289) * [-413.559] (-417.106) (-418.876) (-415.868) -- 0:00:44
287000 -- [-411.848] (-412.895) (-413.801) (-419.304) * [-412.276] (-416.560) (-419.913) (-417.116) -- 0:00:47
287500 -- (-414.826) [-413.280] (-416.151) (-421.635) * (-413.380) (-413.476) (-419.555) [-411.509] -- 0:00:47
288000 -- (-414.828) [-411.215] (-413.631) (-415.198) * [-411.768] (-415.279) (-412.864) (-415.222) -- 0:00:46
288500 -- (-413.926) (-409.956) (-410.882) [-412.259] * (-414.531) (-413.249) [-413.244] (-417.329) -- 0:00:46
289000 -- (-416.222) [-418.326] (-412.321) (-413.654) * (-417.774) (-411.147) (-415.872) [-412.552] -- 0:00:46
289500 -- (-411.971) [-414.177] (-412.576) (-416.760) * (-415.042) (-417.249) (-415.295) [-411.323] -- 0:00:46
290000 -- (-413.649) [-413.640] (-411.779) (-413.516) * (-412.816) (-415.716) [-413.807] (-413.208) -- 0:00:46
Average standard deviation of split frequencies: 0.015741
290500 -- [-411.360] (-410.691) (-410.298) (-412.333) * (-414.307) (-411.529) [-415.358] (-414.059) -- 0:00:46
291000 -- (-412.564) (-414.077) [-414.071] (-418.383) * (-415.704) [-414.751] (-412.218) (-413.925) -- 0:00:46
291500 -- (-413.389) (-414.027) [-412.270] (-415.042) * [-409.901] (-415.276) (-410.650) (-416.968) -- 0:00:46
292000 -- (-415.699) (-415.740) (-412.564) [-415.571] * (-413.318) [-414.959] (-411.782) (-415.806) -- 0:00:46
292500 -- (-413.867) (-417.666) (-412.566) [-414.806] * (-411.571) [-414.175] (-414.110) (-413.257) -- 0:00:45
293000 -- (-414.655) [-415.158] (-413.996) (-413.894) * (-412.817) (-413.582) (-413.806) [-413.687] -- 0:00:45
293500 -- (-413.285) [-410.838] (-413.221) (-416.379) * (-414.845) (-410.918) [-416.524] (-415.503) -- 0:00:45
294000 -- (-416.295) (-416.810) [-414.357] (-413.155) * (-412.439) (-413.538) (-413.474) [-412.604] -- 0:00:45
294500 -- (-412.569) (-413.207) [-410.115] (-412.510) * [-413.851] (-412.538) (-419.852) (-412.121) -- 0:00:45
295000 -- [-415.880] (-412.704) (-414.185) (-411.226) * (-413.375) (-415.156) [-414.889] (-412.275) -- 0:00:45
Average standard deviation of split frequencies: 0.016899
295500 -- (-411.323) [-415.474] (-414.938) (-411.076) * (-415.766) (-418.285) (-410.881) [-411.360] -- 0:00:45
296000 -- (-413.559) (-413.671) (-413.144) [-414.266] * (-415.769) [-414.067] (-414.412) (-416.413) -- 0:00:45
296500 -- (-414.735) (-418.773) [-415.897] (-413.598) * (-414.725) (-415.368) [-410.459] (-416.780) -- 0:00:45
297000 -- (-413.356) (-415.249) (-411.522) [-414.982] * (-417.991) (-420.526) (-420.553) [-414.161] -- 0:00:44
297500 -- (-414.413) [-413.852] (-413.385) (-416.712) * (-411.583) [-413.216] (-410.672) (-413.476) -- 0:00:44
298000 -- [-411.180] (-416.963) (-410.845) (-411.414) * (-414.777) (-415.656) (-414.981) [-413.502] -- 0:00:44
298500 -- (-412.601) (-415.325) (-412.149) [-412.759] * [-413.844] (-416.924) (-413.237) (-417.059) -- 0:00:44
299000 -- (-415.624) [-411.166] (-410.379) (-413.672) * (-414.421) (-416.096) [-413.805] (-414.156) -- 0:00:44
299500 -- (-416.406) (-412.557) [-413.156] (-416.467) * (-414.099) (-415.470) [-412.402] (-411.740) -- 0:00:44
300000 -- (-415.696) (-414.928) (-415.865) [-414.598] * (-415.688) [-415.412] (-417.018) (-412.928) -- 0:00:44
Average standard deviation of split frequencies: 0.016878
300500 -- (-418.616) [-416.601] (-410.756) (-414.769) * (-416.085) (-411.970) (-413.007) [-413.652] -- 0:00:44
301000 -- (-413.323) (-411.732) [-413.613] (-413.217) * (-412.000) [-413.547] (-414.998) (-415.868) -- 0:00:44
301500 -- (-411.187) [-414.917] (-413.730) (-415.751) * [-415.850] (-411.960) (-416.661) (-414.967) -- 0:00:46
302000 -- (-414.524) (-411.552) [-412.808] (-417.275) * (-414.752) (-413.740) [-412.197] (-411.766) -- 0:00:46
302500 -- (-415.400) (-415.690) [-414.407] (-412.571) * (-413.746) (-413.375) (-418.421) [-412.502] -- 0:00:46
303000 -- (-419.081) (-410.642) (-410.871) [-410.707] * [-412.755] (-415.126) (-413.056) (-409.495) -- 0:00:46
303500 -- (-419.109) (-413.480) (-416.321) [-412.908] * (-413.339) (-411.375) [-410.088] (-409.991) -- 0:00:45
304000 -- (-412.964) [-411.574] (-414.925) (-412.707) * (-414.247) (-411.505) (-417.569) [-413.945] -- 0:00:45
304500 -- (-414.548) (-412.301) [-409.904] (-416.564) * [-414.416] (-415.849) (-413.002) (-417.928) -- 0:00:45
305000 -- (-410.214) (-415.188) (-410.609) [-414.363] * (-414.647) (-413.161) (-415.138) [-413.020] -- 0:00:45
Average standard deviation of split frequencies: 0.017288
305500 -- (-409.503) [-413.934] (-417.481) (-413.702) * (-414.592) (-411.489) [-413.452] (-416.193) -- 0:00:45
306000 -- (-416.189) (-414.952) (-412.967) [-413.090] * (-410.814) (-410.715) [-412.590] (-415.607) -- 0:00:45
306500 -- (-410.199) (-414.120) [-415.189] (-415.455) * (-415.134) (-412.169) (-411.646) [-413.765] -- 0:00:45
307000 -- (-409.064) (-409.469) (-410.339) [-414.269] * (-409.503) (-414.840) (-411.193) [-419.051] -- 0:00:45
307500 -- (-415.886) (-413.200) [-413.429] (-412.776) * (-410.835) (-416.279) [-412.808] (-412.681) -- 0:00:45
308000 -- (-411.752) (-413.476) [-412.369] (-414.357) * [-409.972] (-416.970) (-416.783) (-411.046) -- 0:00:44
308500 -- (-415.832) [-412.756] (-415.798) (-414.768) * (-411.365) (-411.090) [-414.865] (-412.752) -- 0:00:44
309000 -- (-420.334) [-412.729] (-416.741) (-414.647) * (-412.605) [-411.507] (-416.290) (-417.895) -- 0:00:44
309500 -- (-417.892) (-408.762) [-411.416] (-420.250) * (-413.042) (-418.695) [-415.012] (-415.379) -- 0:00:44
310000 -- (-414.513) (-417.055) (-409.677) [-414.126] * [-414.081] (-412.654) (-416.420) (-418.902) -- 0:00:44
Average standard deviation of split frequencies: 0.016372
310500 -- (-417.148) (-412.532) [-413.137] (-412.576) * [-411.501] (-418.898) (-421.103) (-414.404) -- 0:00:44
311000 -- (-416.001) [-408.854] (-413.418) (-411.541) * [-414.693] (-414.358) (-416.580) (-418.172) -- 0:00:44
311500 -- (-414.605) [-412.210] (-416.045) (-414.488) * (-415.135) (-413.246) (-413.799) [-409.818] -- 0:00:44
312000 -- (-414.626) (-415.245) (-412.325) [-416.825] * (-411.059) [-413.955] (-419.459) (-416.243) -- 0:00:44
312500 -- (-416.453) [-413.737] (-412.679) (-415.928) * [-411.803] (-414.186) (-418.905) (-416.396) -- 0:00:44
313000 -- (-413.980) (-410.193) [-410.237] (-413.431) * [-415.577] (-414.898) (-415.235) (-415.555) -- 0:00:43
313500 -- [-413.642] (-417.524) (-414.099) (-414.087) * (-416.104) (-414.483) [-416.023] (-415.107) -- 0:00:43
314000 -- [-412.774] (-414.088) (-410.732) (-414.137) * (-418.771) [-413.333] (-414.256) (-414.126) -- 0:00:43
314500 -- (-412.146) (-414.882) [-411.598] (-412.698) * (-417.505) (-410.506) (-411.351) [-411.802] -- 0:00:43
315000 -- [-411.588] (-412.820) (-413.133) (-414.040) * (-413.773) (-415.361) (-413.418) [-411.784] -- 0:00:43
Average standard deviation of split frequencies: 0.017238
315500 -- [-410.436] (-415.261) (-410.717) (-411.056) * (-412.220) (-411.928) (-412.270) [-413.620] -- 0:00:43
316000 -- (-416.416) (-416.846) (-417.141) [-415.495] * (-420.245) (-412.370) [-420.336] (-415.147) -- 0:00:45
316500 -- (-414.936) (-413.142) [-416.263] (-412.491) * (-413.824) (-412.797) (-416.380) [-415.147] -- 0:00:45
317000 -- (-412.424) (-416.342) (-418.344) [-414.628] * (-412.552) [-412.006] (-416.349) (-413.434) -- 0:00:45
317500 -- (-411.665) [-412.393] (-414.181) (-412.199) * (-414.372) (-415.732) (-417.124) [-412.613] -- 0:00:45
318000 -- [-410.310] (-412.543) (-412.863) (-413.133) * (-415.474) (-412.606) (-414.099) [-412.365] -- 0:00:45
318500 -- (-413.331) (-411.368) (-415.742) [-414.712] * (-417.541) [-410.208] (-411.321) (-414.674) -- 0:00:44
319000 -- (-415.349) [-413.604] (-416.714) (-412.522) * [-414.703] (-412.510) (-418.116) (-412.713) -- 0:00:44
319500 -- (-412.344) (-413.559) (-413.541) [-410.363] * [-412.267] (-412.741) (-416.333) (-416.439) -- 0:00:44
320000 -- (-416.899) [-414.273] (-416.837) (-413.414) * (-415.077) [-414.071] (-413.435) (-413.983) -- 0:00:44
Average standard deviation of split frequencies: 0.016824
320500 -- (-417.003) (-414.011) [-414.441] (-414.513) * (-415.349) [-411.669] (-412.613) (-418.768) -- 0:00:44
321000 -- [-413.885] (-414.723) (-416.839) (-409.662) * (-414.051) [-414.711] (-413.581) (-415.329) -- 0:00:44
321500 -- (-414.986) (-417.963) (-415.318) [-411.397] * (-412.013) (-416.303) [-413.505] (-414.413) -- 0:00:44
322000 -- [-413.890] (-410.758) (-417.115) (-413.683) * (-412.583) [-414.229] (-416.905) (-412.831) -- 0:00:44
322500 -- (-413.569) [-414.375] (-416.310) (-413.327) * (-418.190) [-418.051] (-424.653) (-418.033) -- 0:00:44
323000 -- (-416.752) (-415.227) [-416.688] (-414.686) * (-415.499) [-410.060] (-419.500) (-418.088) -- 0:00:44
323500 -- (-417.443) (-413.006) [-411.946] (-411.451) * [-414.882] (-409.325) (-414.241) (-415.289) -- 0:00:43
324000 -- (-415.161) [-411.698] (-417.509) (-412.951) * (-415.128) [-411.514] (-414.316) (-416.923) -- 0:00:43
324500 -- (-419.547) (-412.916) (-419.509) [-415.666] * (-417.888) (-412.615) (-412.798) [-414.261] -- 0:00:43
325000 -- (-418.410) [-414.552] (-415.349) (-414.767) * (-419.126) [-411.412] (-413.138) (-413.999) -- 0:00:43
Average standard deviation of split frequencies: 0.016667
325500 -- (-415.911) (-417.185) (-416.897) [-416.156] * (-415.818) [-412.709] (-414.905) (-414.120) -- 0:00:43
326000 -- (-415.869) (-418.242) [-413.880] (-414.664) * (-413.543) [-410.600] (-419.176) (-416.199) -- 0:00:43
326500 -- [-414.391] (-416.680) (-417.136) (-415.222) * [-413.590] (-412.508) (-416.403) (-413.512) -- 0:00:43
327000 -- (-413.429) (-413.988) (-418.834) [-411.373] * (-415.855) (-412.871) [-411.980] (-410.823) -- 0:00:43
327500 -- (-414.327) (-413.004) (-413.075) [-413.871] * (-413.295) (-410.278) [-410.252] (-414.124) -- 0:00:43
328000 -- (-416.744) (-413.906) (-412.877) [-420.751] * (-412.983) (-415.798) (-410.462) [-414.999] -- 0:00:43
328500 -- (-418.382) (-413.460) [-412.846] (-415.333) * (-413.476) (-411.392) (-414.106) [-414.010] -- 0:00:42
329000 -- (-417.500) [-412.546] (-414.020) (-421.373) * (-414.307) (-413.051) (-413.615) [-411.100] -- 0:00:42
329500 -- (-418.539) (-413.813) (-412.624) [-415.185] * [-413.492] (-410.871) (-414.110) (-411.760) -- 0:00:42
330000 -- (-418.363) [-413.769] (-410.081) (-413.602) * (-416.815) (-412.687) [-413.069] (-409.683) -- 0:00:44
Average standard deviation of split frequencies: 0.016057
330500 -- (-414.577) [-411.867] (-411.635) (-419.765) * (-417.260) (-413.566) [-413.865] (-416.170) -- 0:00:44
331000 -- [-412.053] (-413.327) (-412.473) (-412.446) * (-412.418) (-414.631) (-412.886) [-413.683] -- 0:00:44
331500 -- [-417.291] (-412.905) (-414.936) (-413.938) * (-417.899) [-415.261] (-413.949) (-410.999) -- 0:00:44
332000 -- (-414.880) (-414.604) [-412.299] (-416.464) * (-413.535) [-413.584] (-412.739) (-412.621) -- 0:00:44
332500 -- (-412.764) (-411.537) [-411.817] (-410.933) * (-409.852) [-413.013] (-415.836) (-412.237) -- 0:00:44
333000 -- [-413.401] (-411.754) (-414.928) (-411.457) * [-410.030] (-410.778) (-415.178) (-413.924) -- 0:00:44
333500 -- (-415.144) [-410.456] (-412.793) (-415.365) * (-413.725) (-412.258) (-417.760) [-414.046] -- 0:00:43
334000 -- (-414.057) [-409.137] (-410.952) (-414.258) * (-415.509) [-412.671] (-417.429) (-410.874) -- 0:00:43
334500 -- [-415.465] (-410.143) (-414.695) (-415.183) * [-416.033] (-414.836) (-412.699) (-413.339) -- 0:00:43
335000 -- (-411.382) (-414.471) (-413.949) [-415.246] * [-414.146] (-411.950) (-411.157) (-410.982) -- 0:00:43
Average standard deviation of split frequencies: 0.016245
335500 -- (-412.541) (-411.377) (-413.042) [-411.913] * (-411.556) [-413.066] (-415.457) (-413.271) -- 0:00:43
336000 -- (-421.949) (-413.575) [-413.146] (-413.140) * (-414.823) [-411.578] (-414.301) (-412.703) -- 0:00:43
336500 -- (-416.859) (-415.828) (-414.236) [-411.183] * (-410.572) [-411.828] (-411.773) (-416.060) -- 0:00:43
337000 -- (-415.799) [-412.783] (-419.772) (-412.320) * (-412.460) [-417.404] (-416.078) (-412.264) -- 0:00:43
337500 -- (-420.222) (-412.331) [-415.792] (-411.717) * (-417.754) (-414.308) [-412.902] (-414.779) -- 0:00:43
338000 -- (-416.443) [-412.205] (-417.990) (-410.457) * (-416.270) (-414.852) [-411.386] (-414.861) -- 0:00:43
338500 -- (-420.364) (-420.963) [-416.463] (-412.976) * (-411.673) (-412.082) (-418.805) [-415.991] -- 0:00:42
339000 -- (-417.830) (-412.909) [-417.284] (-411.207) * (-411.470) (-411.163) (-418.195) [-412.325] -- 0:00:42
339500 -- (-416.566) (-413.137) (-411.457) [-413.609] * (-420.490) (-412.254) (-412.814) [-411.131] -- 0:00:42
340000 -- (-412.799) [-412.428] (-414.925) (-413.243) * (-411.851) (-414.628) [-414.619] (-410.506) -- 0:00:42
Average standard deviation of split frequencies: 0.016460
340500 -- (-411.028) [-414.518] (-415.926) (-411.274) * [-410.890] (-410.852) (-415.328) (-412.044) -- 0:00:42
341000 -- (-412.603) [-410.481] (-415.816) (-411.272) * (-414.414) [-415.288] (-418.143) (-417.199) -- 0:00:42
341500 -- (-414.010) (-413.107) (-412.203) [-412.693] * (-416.911) (-414.443) [-415.133] (-410.797) -- 0:00:42
342000 -- [-412.433] (-410.571) (-413.514) (-411.565) * (-412.922) (-412.494) (-416.597) [-412.315] -- 0:00:42
342500 -- (-413.181) [-415.698] (-415.286) (-413.369) * (-415.231) (-411.652) (-412.875) [-412.608] -- 0:00:42
343000 -- (-413.704) (-415.026) [-417.176] (-413.034) * (-414.318) [-412.140] (-416.208) (-413.842) -- 0:00:42
343500 -- [-416.542] (-417.153) (-414.276) (-413.155) * (-411.133) (-410.359) (-416.206) [-413.232] -- 0:00:42
344000 -- (-418.334) [-414.972] (-415.225) (-414.789) * (-410.750) [-413.595] (-416.538) (-415.338) -- 0:00:41
344500 -- (-411.792) (-413.137) (-419.516) [-411.598] * (-410.629) (-413.992) (-415.374) [-415.069] -- 0:00:43
345000 -- (-415.523) [-411.596] (-414.369) (-412.548) * [-413.294] (-413.875) (-418.250) (-410.739) -- 0:00:43
Average standard deviation of split frequencies: 0.016564
345500 -- [-410.480] (-413.946) (-411.793) (-415.996) * (-414.364) [-414.743] (-414.319) (-413.935) -- 0:00:43
346000 -- (-414.091) [-411.926] (-415.799) (-415.102) * (-421.576) (-411.667) [-413.036] (-415.385) -- 0:00:43
346500 -- (-411.591) (-413.364) [-414.083] (-412.007) * (-414.581) [-410.022] (-416.855) (-413.932) -- 0:00:43
347000 -- (-412.546) (-410.676) (-419.155) [-412.855] * (-416.777) (-412.964) [-414.605] (-417.665) -- 0:00:43
347500 -- (-415.517) (-410.583) [-417.538] (-411.015) * (-413.983) [-412.528] (-418.726) (-415.162) -- 0:00:43
348000 -- (-414.997) (-410.809) [-415.394] (-410.436) * (-416.713) [-415.457] (-412.300) (-413.361) -- 0:00:43
348500 -- (-419.776) (-415.446) [-416.371] (-411.196) * (-416.766) (-414.293) (-413.363) [-411.768] -- 0:00:42
349000 -- (-419.789) [-411.757] (-414.412) (-410.437) * (-416.244) [-409.666] (-412.747) (-412.006) -- 0:00:42
349500 -- (-412.264) (-415.879) [-416.736] (-412.149) * [-416.620] (-412.162) (-412.613) (-410.457) -- 0:00:42
350000 -- [-414.305] (-413.045) (-417.180) (-413.981) * (-417.134) [-410.027] (-410.666) (-412.274) -- 0:00:42
Average standard deviation of split frequencies: 0.016356
350500 -- [-416.987] (-411.824) (-416.768) (-412.253) * (-411.908) (-412.762) [-411.272] (-412.940) -- 0:00:42
351000 -- (-415.305) [-411.212] (-412.505) (-415.888) * [-411.264] (-414.781) (-414.360) (-414.802) -- 0:00:42
351500 -- (-415.004) (-413.023) (-413.788) [-411.481] * [-412.296] (-412.654) (-414.434) (-411.092) -- 0:00:42
352000 -- (-412.864) (-415.125) (-418.532) [-411.267] * (-413.443) (-411.725) (-411.941) [-412.610] -- 0:00:42
352500 -- (-412.196) [-412.916] (-415.577) (-410.607) * (-411.116) (-410.420) [-416.403] (-414.591) -- 0:00:42
353000 -- (-415.385) (-412.585) (-417.561) [-413.417] * (-409.551) (-413.766) (-415.664) [-413.304] -- 0:00:42
353500 -- (-415.448) (-409.565) (-418.453) [-414.980] * (-410.614) (-412.783) [-410.691] (-411.978) -- 0:00:42
354000 -- [-413.441] (-416.141) (-414.045) (-419.004) * [-415.760] (-409.634) (-411.730) (-412.239) -- 0:00:41
354500 -- (-414.702) [-412.941] (-417.122) (-413.513) * (-417.265) (-415.893) (-412.464) [-411.582] -- 0:00:41
355000 -- (-419.098) (-413.799) [-413.755] (-412.471) * (-414.953) [-412.801] (-410.377) (-411.268) -- 0:00:41
Average standard deviation of split frequencies: 0.016591
355500 -- (-418.021) [-413.499] (-412.585) (-416.338) * [-417.910] (-412.534) (-410.306) (-414.862) -- 0:00:41
356000 -- (-416.196) (-412.931) (-415.564) [-414.691] * (-415.220) (-411.330) [-416.704] (-415.522) -- 0:00:41
356500 -- [-414.557] (-415.003) (-417.396) (-414.502) * (-414.921) [-413.289] (-416.051) (-412.923) -- 0:00:41
357000 -- [-411.377] (-413.435) (-414.368) (-413.439) * [-411.716] (-409.645) (-417.224) (-416.650) -- 0:00:41
357500 -- (-411.816) (-415.295) (-414.450) [-413.620] * (-413.477) [-411.900] (-414.054) (-416.952) -- 0:00:41
358000 -- [-412.827] (-414.476) (-412.685) (-413.491) * [-411.205] (-417.091) (-415.697) (-415.390) -- 0:00:41
358500 -- (-413.233) (-420.218) [-413.628] (-412.227) * (-411.967) (-413.996) [-413.014] (-417.295) -- 0:00:42
359000 -- (-411.161) (-416.202) [-417.482] (-411.992) * [-413.608] (-413.388) (-412.607) (-417.942) -- 0:00:42
359500 -- [-409.401] (-414.113) (-414.630) (-412.216) * (-413.742) [-412.888] (-416.044) (-418.909) -- 0:00:42
360000 -- (-411.924) [-414.059] (-420.210) (-413.496) * (-413.420) (-413.673) (-416.717) [-419.995] -- 0:00:42
Average standard deviation of split frequencies: 0.016376
360500 -- (-413.066) (-412.018) (-417.041) [-412.988] * (-415.294) (-414.019) [-411.887] (-411.478) -- 0:00:42
361000 -- (-412.108) (-413.173) (-414.000) [-416.351] * (-411.382) (-413.177) (-423.067) [-412.557] -- 0:00:42
361500 -- [-413.124] (-410.605) (-414.286) (-416.899) * (-411.685) [-411.729] (-416.442) (-412.968) -- 0:00:42
362000 -- (-410.902) (-412.893) (-412.222) [-414.777] * (-415.324) (-413.123) (-416.106) [-412.242] -- 0:00:42
362500 -- (-408.460) (-417.054) (-416.520) [-417.431] * [-413.144] (-415.164) (-417.612) (-412.575) -- 0:00:42
363000 -- [-410.759] (-411.037) (-413.426) (-415.682) * (-412.662) (-413.430) (-419.385) [-411.511] -- 0:00:42
363500 -- (-411.909) [-414.008] (-413.233) (-415.246) * [-409.625] (-411.700) (-418.227) (-412.701) -- 0:00:42
364000 -- (-412.316) [-416.669] (-413.799) (-414.248) * (-412.322) (-411.512) (-413.035) [-411.148] -- 0:00:41
364500 -- (-413.455) [-412.509] (-412.046) (-414.975) * [-413.689] (-412.278) (-414.009) (-411.080) -- 0:00:41
365000 -- (-412.976) [-412.696] (-411.712) (-415.836) * (-412.110) (-411.655) (-419.710) [-411.082] -- 0:00:41
Average standard deviation of split frequencies: 0.016214
365500 -- (-418.352) (-411.546) [-414.073] (-413.304) * (-418.981) (-415.053) [-411.246] (-410.126) -- 0:00:41
366000 -- [-411.404] (-417.343) (-413.114) (-416.790) * (-419.644) [-414.071] (-414.653) (-411.470) -- 0:00:41
366500 -- (-414.624) (-414.769) [-412.908] (-412.695) * (-414.222) (-414.354) [-415.319] (-415.374) -- 0:00:41
367000 -- (-414.046) [-411.885] (-414.395) (-415.076) * (-409.812) [-412.384] (-412.442) (-417.927) -- 0:00:41
367500 -- (-414.888) [-410.865] (-413.777) (-417.095) * (-412.139) [-413.983] (-411.490) (-410.807) -- 0:00:41
368000 -- (-409.735) [-410.444] (-416.090) (-413.680) * [-410.878] (-412.428) (-414.454) (-413.407) -- 0:00:41
368500 -- (-413.187) [-414.842] (-414.686) (-412.621) * (-412.788) (-414.744) (-417.742) [-414.042] -- 0:00:41
369000 -- (-411.985) (-414.462) (-414.890) [-411.271] * (-413.404) (-411.229) [-413.906] (-419.562) -- 0:00:41
369500 -- [-413.387] (-413.662) (-413.149) (-410.838) * (-414.783) (-417.380) [-411.266] (-416.454) -- 0:00:40
370000 -- (-411.669) (-413.737) [-414.101] (-412.047) * [-413.016] (-417.239) (-412.111) (-412.309) -- 0:00:40
Average standard deviation of split frequencies: 0.015403
370500 -- [-410.413] (-412.208) (-414.833) (-412.625) * (-411.584) (-411.500) [-410.914] (-415.201) -- 0:00:40
371000 -- (-409.377) (-413.250) (-412.466) [-411.666] * (-412.841) (-411.871) [-411.320] (-416.490) -- 0:00:40
371500 -- (-415.665) [-411.065] (-416.234) (-410.317) * [-413.752] (-419.145) (-413.567) (-412.825) -- 0:00:40
372000 -- (-413.886) [-409.771] (-415.029) (-412.928) * (-416.189) (-414.558) (-413.498) [-413.716] -- 0:00:40
372500 -- (-413.365) (-416.523) (-415.192) [-413.177] * (-411.802) (-414.051) [-411.525] (-414.692) -- 0:00:42
373000 -- (-411.315) (-412.595) [-412.142] (-413.717) * (-414.237) (-416.783) (-416.115) [-413.538] -- 0:00:42
373500 -- (-413.166) (-411.757) (-418.202) [-409.706] * (-412.647) (-412.627) (-414.020) [-413.241] -- 0:00:41
374000 -- (-414.421) [-416.974] (-411.665) (-413.646) * (-419.083) (-413.432) (-414.092) [-411.973] -- 0:00:41
374500 -- (-409.397) (-414.005) (-414.086) [-412.377] * (-412.421) [-412.857] (-413.281) (-410.500) -- 0:00:41
375000 -- (-414.053) (-412.358) (-415.358) [-412.143] * (-411.268) [-410.874] (-413.754) (-414.761) -- 0:00:41
Average standard deviation of split frequencies: 0.015184
375500 -- (-413.126) (-414.861) [-417.090] (-411.451) * [-412.569] (-414.513) (-412.637) (-415.160) -- 0:00:41
376000 -- [-417.735] (-411.584) (-411.556) (-415.586) * (-412.623) (-412.181) [-411.649] (-414.246) -- 0:00:41
376500 -- (-418.920) (-410.936) [-408.954] (-412.847) * (-416.067) (-413.138) (-415.082) [-412.804] -- 0:00:41
377000 -- (-410.680) (-412.071) [-412.665] (-409.646) * [-411.486] (-412.441) (-410.869) (-418.503) -- 0:00:41
377500 -- (-410.512) (-418.545) [-410.574] (-412.712) * (-411.783) (-415.560) (-409.134) [-412.782] -- 0:00:41
378000 -- (-412.418) (-416.032) (-411.562) [-411.120] * [-410.981] (-413.933) (-410.301) (-416.735) -- 0:00:41
378500 -- (-410.979) (-413.316) (-410.414) [-412.603] * (-413.675) (-415.518) (-413.116) [-413.867] -- 0:00:41
379000 -- (-411.175) (-415.434) [-408.729] (-412.741) * [-411.941] (-419.266) (-415.118) (-414.407) -- 0:00:40
379500 -- (-412.294) (-413.971) [-412.637] (-412.613) * (-417.201) (-418.333) [-411.209] (-416.817) -- 0:00:40
380000 -- (-415.897) [-410.218] (-415.966) (-413.878) * [-416.677] (-415.933) (-412.573) (-415.707) -- 0:00:40
Average standard deviation of split frequencies: 0.015152
380500 -- (-411.165) (-418.317) (-414.511) [-410.978] * (-419.202) (-417.065) [-412.726] (-413.118) -- 0:00:40
381000 -- [-411.158] (-415.929) (-414.281) (-412.197) * [-412.976] (-417.183) (-413.476) (-411.790) -- 0:00:40
381500 -- [-415.918] (-418.476) (-410.225) (-410.671) * (-412.701) [-412.310] (-414.921) (-413.572) -- 0:00:40
382000 -- (-410.536) (-411.738) (-411.915) [-416.260] * (-413.406) [-410.925] (-413.431) (-412.606) -- 0:00:40
382500 -- [-409.916] (-412.757) (-414.245) (-410.359) * (-415.793) [-410.912] (-411.915) (-415.080) -- 0:00:40
383000 -- (-412.824) [-418.048] (-412.831) (-418.255) * (-416.926) [-410.188] (-415.399) (-412.548) -- 0:00:40
383500 -- (-416.321) (-415.441) [-413.527] (-417.108) * (-411.802) [-413.307] (-413.787) (-414.142) -- 0:00:40
384000 -- (-413.997) [-414.696] (-411.294) (-418.985) * (-413.068) (-412.061) [-410.290] (-411.462) -- 0:00:40
384500 -- (-417.810) (-414.883) (-418.399) [-411.583] * (-412.400) [-412.114] (-413.644) (-414.068) -- 0:00:40
385000 -- [-411.425] (-416.471) (-417.928) (-417.165) * (-411.449) [-411.098] (-414.018) (-416.308) -- 0:00:39
Average standard deviation of split frequencies: 0.015130
385500 -- (-411.628) (-415.653) (-420.385) [-414.638] * [-411.967] (-414.773) (-417.623) (-419.963) -- 0:00:39
386000 -- [-415.654] (-414.512) (-421.068) (-413.353) * (-415.734) [-410.144] (-412.851) (-414.382) -- 0:00:39
386500 -- [-412.527] (-417.430) (-414.582) (-412.478) * (-413.746) [-413.715] (-411.889) (-415.985) -- 0:00:39
387000 -- (-413.508) (-414.160) (-412.922) [-414.836] * [-414.282] (-416.528) (-410.804) (-412.600) -- 0:00:39
387500 -- [-418.338] (-411.911) (-410.205) (-412.393) * [-410.851] (-415.289) (-412.194) (-412.952) -- 0:00:39
388000 -- (-412.525) (-411.782) [-412.545] (-419.216) * [-414.562] (-416.846) (-415.427) (-412.505) -- 0:00:39
388500 -- (-412.463) (-412.013) [-414.253] (-412.735) * [-415.575] (-413.498) (-414.027) (-420.604) -- 0:00:40
389000 -- (-417.363) (-417.704) (-413.525) [-413.615] * [-413.161] (-413.488) (-413.248) (-419.718) -- 0:00:40
389500 -- (-415.255) [-412.846] (-416.476) (-414.911) * (-413.525) (-416.922) [-413.096] (-415.425) -- 0:00:40
390000 -- (-413.667) (-413.998) [-414.077] (-412.186) * [-413.608] (-412.033) (-417.638) (-420.494) -- 0:00:40
Average standard deviation of split frequencies: 0.014480
390500 -- (-412.910) (-412.013) (-416.166) [-412.194] * (-415.054) (-414.988) [-410.642] (-412.609) -- 0:00:40
391000 -- (-412.927) (-413.791) (-411.583) [-410.982] * (-411.825) (-417.039) [-415.852] (-410.853) -- 0:00:40
391500 -- (-412.657) [-412.114] (-415.259) (-412.750) * [-414.621] (-414.221) (-412.209) (-413.235) -- 0:00:40
392000 -- (-414.635) (-412.480) [-412.403] (-411.572) * [-414.191] (-418.608) (-414.612) (-410.868) -- 0:00:40
392500 -- (-416.065) [-411.104] (-413.636) (-410.859) * (-417.846) (-413.812) (-414.883) [-412.958] -- 0:00:40
393000 -- (-419.885) (-413.437) (-413.072) [-413.225] * (-419.701) (-415.052) [-414.331] (-416.171) -- 0:00:40
393500 -- (-418.360) (-411.314) [-417.376] (-411.090) * (-412.556) (-411.338) (-411.533) [-415.596] -- 0:00:40
394000 -- (-421.884) [-412.059] (-415.666) (-415.651) * [-411.458] (-412.802) (-415.327) (-420.491) -- 0:00:39
394500 -- (-420.040) (-413.334) [-412.914] (-412.723) * [-413.259] (-413.391) (-418.972) (-410.645) -- 0:00:39
395000 -- (-412.758) [-411.004] (-413.406) (-414.458) * [-410.473] (-413.653) (-414.125) (-411.360) -- 0:00:39
Average standard deviation of split frequencies: 0.015773
395500 -- (-415.467) [-412.021] (-412.615) (-415.783) * [-411.691] (-412.767) (-415.235) (-414.507) -- 0:00:39
396000 -- (-418.321) (-413.095) [-412.975] (-413.268) * (-413.665) (-413.951) (-416.102) [-412.547] -- 0:00:39
396500 -- (-413.603) (-413.505) (-417.311) [-416.297] * [-411.487] (-414.190) (-420.863) (-413.002) -- 0:00:39
397000 -- [-413.399] (-417.043) (-416.304) (-412.875) * (-412.528) (-412.985) [-418.190] (-414.099) -- 0:00:39
397500 -- (-413.228) (-417.808) (-416.010) [-411.252] * [-415.241] (-415.111) (-415.715) (-415.858) -- 0:00:39
398000 -- [-412.297] (-416.141) (-413.421) (-411.012) * (-414.608) (-417.306) (-413.922) [-411.375] -- 0:00:39
398500 -- (-413.620) (-415.447) (-415.804) [-411.775] * (-409.890) [-413.777] (-414.657) (-413.449) -- 0:00:39
399000 -- (-411.867) (-415.119) (-416.513) [-413.068] * (-413.673) (-415.700) (-415.821) [-410.885] -- 0:00:39
399500 -- (-412.569) [-412.127] (-415.082) (-411.934) * (-412.646) [-416.245] (-414.799) (-415.720) -- 0:00:39
400000 -- [-412.963] (-413.872) (-415.597) (-412.527) * (-411.879) (-411.951) (-418.062) [-410.959] -- 0:00:39
Average standard deviation of split frequencies: 0.016178
400500 -- (-415.957) [-410.397] (-416.037) (-415.973) * [-415.761] (-413.176) (-418.755) (-410.966) -- 0:00:38
401000 -- (-411.070) (-410.297) [-416.325] (-411.836) * (-414.791) (-411.639) [-414.851] (-418.241) -- 0:00:38
401500 -- [-410.656] (-412.264) (-414.718) (-415.835) * [-413.747] (-417.536) (-416.235) (-417.610) -- 0:00:38
402000 -- (-413.563) (-414.948) (-415.766) [-416.130] * (-413.822) (-417.885) (-413.563) [-413.475] -- 0:00:38
402500 -- [-411.759] (-411.145) (-414.615) (-416.241) * (-412.204) (-414.011) (-413.729) [-412.203] -- 0:00:38
403000 -- [-414.359] (-412.876) (-416.122) (-414.451) * (-413.277) (-413.795) (-415.854) [-412.367] -- 0:00:38
403500 -- [-412.370] (-414.358) (-414.802) (-411.064) * (-415.671) [-411.555] (-415.955) (-414.301) -- 0:00:38
404000 -- [-411.794] (-413.147) (-414.019) (-415.256) * [-410.112] (-414.110) (-415.815) (-416.240) -- 0:00:39
404500 -- (-412.053) [-412.251] (-414.854) (-412.436) * [-414.313] (-413.720) (-414.984) (-414.917) -- 0:00:39
405000 -- (-414.036) (-415.796) [-412.750] (-414.214) * (-412.031) (-413.963) [-415.113] (-412.329) -- 0:00:39
Average standard deviation of split frequencies: 0.016119
405500 -- (-414.565) (-412.290) (-411.190) [-410.642] * (-418.471) (-415.719) (-415.984) [-417.875] -- 0:00:39
406000 -- (-417.988) (-419.527) [-412.996] (-414.057) * (-416.473) [-413.344] (-415.166) (-418.639) -- 0:00:39
406500 -- (-421.663) (-412.268) (-413.224) [-410.473] * [-412.464] (-415.173) (-414.072) (-414.722) -- 0:00:39
407000 -- (-418.765) (-409.839) [-413.503] (-411.477) * (-411.213) [-412.966] (-413.630) (-416.993) -- 0:00:39
407500 -- (-415.772) [-412.834] (-413.591) (-417.816) * (-414.733) [-413.589] (-414.964) (-415.484) -- 0:00:39
408000 -- (-413.578) [-415.326] (-416.098) (-411.778) * (-411.527) (-411.466) (-412.884) [-414.909] -- 0:00:39
408500 -- (-417.162) (-412.171) (-416.306) [-412.769] * (-413.345) (-415.270) (-412.924) [-414.893] -- 0:00:39
409000 -- (-412.962) [-415.154] (-412.697) (-417.969) * (-414.302) [-412.749] (-412.768) (-412.726) -- 0:00:39
409500 -- (-414.442) (-414.935) (-420.584) [-413.237] * (-411.829) (-414.600) [-414.758] (-414.514) -- 0:00:38
410000 -- (-415.260) (-419.726) [-416.424] (-412.117) * (-414.532) [-412.251] (-410.485) (-417.660) -- 0:00:38
Average standard deviation of split frequencies: 0.017354
410500 -- (-412.829) [-409.259] (-416.264) (-413.656) * (-416.845) (-414.792) [-413.306] (-414.078) -- 0:00:38
411000 -- (-411.532) (-410.916) (-416.049) [-410.124] * (-413.236) (-417.076) [-413.645] (-415.620) -- 0:00:38
411500 -- (-417.674) [-412.490] (-416.116) (-414.770) * [-413.695] (-415.403) (-414.070) (-419.123) -- 0:00:38
412000 -- [-412.672] (-413.722) (-410.354) (-414.187) * (-414.668) [-414.635] (-417.194) (-413.222) -- 0:00:38
412500 -- (-412.924) [-412.604] (-414.802) (-410.494) * (-415.306) (-411.539) (-414.729) [-411.509] -- 0:00:38
413000 -- [-417.275] (-416.370) (-414.007) (-412.436) * (-413.036) (-415.823) [-414.037] (-417.575) -- 0:00:38
413500 -- [-416.577] (-413.297) (-420.233) (-413.362) * (-413.056) [-417.150] (-416.867) (-417.587) -- 0:00:38
414000 -- [-413.151] (-410.582) (-418.089) (-415.003) * (-413.919) (-413.632) [-413.975] (-420.758) -- 0:00:38
414500 -- (-417.970) (-409.663) (-416.665) [-410.592] * (-414.322) [-415.034] (-416.826) (-417.787) -- 0:00:38
415000 -- [-414.165] (-415.567) (-414.114) (-412.655) * (-413.796) (-414.035) (-412.136) [-412.788] -- 0:00:38
Average standard deviation of split frequencies: 0.016683
415500 -- (-411.875) [-410.661] (-414.171) (-411.605) * (-416.083) [-418.179] (-412.141) (-412.344) -- 0:00:37
416000 -- (-410.001) (-413.742) [-412.273] (-412.077) * (-415.050) (-415.889) [-411.367] (-415.703) -- 0:00:37
416500 -- (-409.661) (-414.484) (-414.877) [-412.945] * (-414.608) (-417.301) [-413.088] (-410.464) -- 0:00:37
417000 -- (-412.486) (-412.131) [-412.572] (-414.391) * (-413.807) (-417.945) (-416.053) [-410.753] -- 0:00:37
417500 -- [-409.011] (-413.764) (-411.234) (-410.708) * (-414.036) (-416.741) (-415.186) [-411.534] -- 0:00:37
418000 -- [-410.590] (-416.023) (-414.434) (-415.477) * [-417.117] (-416.578) (-418.781) (-415.285) -- 0:00:37
418500 -- [-413.988] (-414.534) (-412.326) (-416.678) * (-416.023) (-412.734) (-414.828) [-413.171] -- 0:00:37
419000 -- (-413.759) (-412.385) [-412.478] (-412.695) * (-414.081) (-416.751) [-412.577] (-412.687) -- 0:00:37
419500 -- (-417.354) (-412.842) [-411.122] (-416.297) * [-414.642] (-418.400) (-414.592) (-413.444) -- 0:00:37
420000 -- (-413.956) [-422.417] (-413.064) (-413.561) * (-421.355) [-415.997] (-414.546) (-416.319) -- 0:00:38
Average standard deviation of split frequencies: 0.016480
420500 -- (-415.146) [-413.866] (-413.482) (-413.282) * (-420.517) [-414.094] (-412.578) (-415.925) -- 0:00:38
421000 -- [-410.059] (-416.958) (-415.627) (-412.373) * (-422.424) [-411.138] (-415.685) (-416.327) -- 0:00:38
421500 -- [-413.992] (-413.800) (-410.251) (-411.796) * [-417.151] (-418.086) (-420.772) (-411.688) -- 0:00:38
422000 -- (-414.121) (-411.875) (-413.341) [-410.287] * (-412.148) (-415.400) (-414.709) [-410.174] -- 0:00:38
422500 -- (-412.193) (-413.470) (-410.751) [-412.704] * [-412.417] (-415.781) (-414.836) (-414.713) -- 0:00:38
423000 -- (-413.513) (-417.879) [-411.981] (-411.172) * (-415.327) [-409.799] (-416.333) (-417.865) -- 0:00:38
423500 -- [-415.408] (-415.218) (-414.847) (-414.384) * (-416.385) (-414.456) [-414.193] (-415.726) -- 0:00:38
424000 -- [-412.785] (-413.262) (-414.897) (-412.142) * [-411.008] (-416.147) (-413.166) (-417.911) -- 0:00:38
424500 -- (-414.755) [-417.323] (-414.154) (-411.349) * (-415.255) (-416.812) (-412.079) [-413.262] -- 0:00:37
425000 -- (-415.334) (-415.346) (-415.579) [-413.032] * (-410.469) [-414.034] (-415.744) (-416.884) -- 0:00:37
Average standard deviation of split frequencies: 0.014877
425500 -- (-412.746) (-413.423) [-415.731] (-414.666) * (-414.027) (-413.195) [-414.392] (-412.598) -- 0:00:37
426000 -- (-414.259) (-416.159) (-417.457) [-412.473] * (-414.787) [-415.935] (-414.349) (-414.723) -- 0:00:37
426500 -- (-413.584) (-416.135) (-413.480) [-412.043] * [-413.802] (-414.815) (-412.296) (-411.671) -- 0:00:37
427000 -- (-415.884) (-413.382) (-413.598) [-413.529] * [-416.245] (-413.197) (-415.437) (-415.030) -- 0:00:37
427500 -- (-413.397) [-410.727] (-416.849) (-416.364) * [-415.843] (-413.159) (-413.284) (-410.966) -- 0:00:37
428000 -- (-413.816) (-413.093) (-410.549) [-410.421] * [-410.170] (-413.743) (-411.312) (-415.142) -- 0:00:37
428500 -- (-413.074) (-416.915) [-409.801] (-411.288) * [-414.158] (-414.909) (-412.684) (-415.330) -- 0:00:37
429000 -- (-411.263) (-415.071) [-412.308] (-415.248) * (-414.495) (-418.314) (-413.605) [-411.776] -- 0:00:37
429500 -- (-410.849) (-413.807) (-413.428) [-413.921] * (-412.147) [-413.323] (-414.508) (-412.290) -- 0:00:37
430000 -- [-412.522] (-415.871) (-417.595) (-417.987) * (-414.158) (-413.862) (-412.983) [-411.685] -- 0:00:37
Average standard deviation of split frequencies: 0.016226
430500 -- (-413.675) (-414.660) [-413.621] (-414.796) * (-413.724) (-413.861) [-411.655] (-413.001) -- 0:00:37
431000 -- [-411.257] (-413.244) (-416.645) (-414.075) * (-416.510) (-417.678) (-417.102) [-411.337] -- 0:00:36
431500 -- [-419.743] (-413.899) (-411.652) (-419.443) * (-417.003) (-413.961) (-412.860) [-414.352] -- 0:00:36
432000 -- [-413.502] (-413.714) (-411.744) (-411.679) * [-414.195] (-417.557) (-417.736) (-417.067) -- 0:00:36
432500 -- (-410.461) (-411.177) [-411.910] (-413.855) * (-415.635) [-414.502] (-417.423) (-412.117) -- 0:00:36
433000 -- (-420.739) (-413.634) [-410.562] (-412.166) * [-411.711] (-416.492) (-413.552) (-415.633) -- 0:00:36
433500 -- (-415.834) (-414.806) [-411.636] (-414.025) * (-411.017) [-409.926] (-419.051) (-414.169) -- 0:00:36
434000 -- (-414.308) (-414.081) [-410.819] (-416.244) * [-412.022] (-413.039) (-416.040) (-413.455) -- 0:00:36
434500 -- (-418.571) (-416.445) (-410.829) [-411.446] * (-413.422) (-412.800) [-414.028] (-411.341) -- 0:00:36
435000 -- (-415.668) (-415.964) [-412.650] (-410.385) * [-413.311] (-419.452) (-413.426) (-410.485) -- 0:00:36
Average standard deviation of split frequencies: 0.016600
435500 -- [-412.912] (-413.051) (-412.126) (-410.064) * [-411.429] (-418.890) (-414.795) (-412.222) -- 0:00:37
436000 -- (-413.257) (-414.456) (-413.385) [-413.481] * (-413.162) (-415.197) (-411.554) [-415.034] -- 0:00:37
436500 -- [-413.601] (-414.679) (-412.442) (-417.382) * (-413.149) [-415.427] (-414.876) (-411.368) -- 0:00:37
437000 -- [-413.075] (-411.207) (-412.204) (-415.009) * [-414.896] (-414.838) (-417.036) (-414.376) -- 0:00:37
437500 -- (-418.681) (-410.764) [-414.387] (-411.936) * (-411.665) [-413.919] (-418.438) (-412.522) -- 0:00:37
438000 -- (-414.564) (-412.988) (-412.124) [-414.028] * (-410.907) (-415.600) [-413.064] (-412.037) -- 0:00:37
438500 -- (-413.544) (-414.180) [-414.411] (-416.781) * (-414.193) (-416.208) (-412.382) [-413.384] -- 0:00:37
439000 -- [-411.059] (-416.531) (-411.135) (-414.395) * (-411.258) (-417.174) (-414.667) [-415.441] -- 0:00:37
439500 -- [-413.357] (-413.384) (-412.099) (-419.893) * (-414.438) (-412.490) [-413.645] (-414.540) -- 0:00:36
440000 -- (-410.699) (-412.555) (-412.956) [-411.609] * (-413.942) (-412.900) [-413.276] (-417.182) -- 0:00:36
Average standard deviation of split frequencies: 0.016046
440500 -- [-417.827] (-413.789) (-414.743) (-410.861) * (-415.219) [-413.761] (-413.970) (-415.808) -- 0:00:36
441000 -- (-419.288) (-416.243) (-414.390) [-413.734] * [-414.877] (-415.901) (-414.454) (-416.916) -- 0:00:36
441500 -- (-413.190) (-418.626) [-413.800] (-415.111) * (-414.969) [-414.216] (-416.947) (-414.248) -- 0:00:36
442000 -- (-417.418) [-411.161] (-414.900) (-413.088) * [-411.600] (-415.438) (-415.353) (-412.636) -- 0:00:36
442500 -- (-417.657) (-412.995) (-414.507) [-413.492] * [-414.701] (-410.121) (-412.648) (-416.130) -- 0:00:36
443000 -- (-415.203) (-413.899) [-414.657] (-413.372) * (-416.038) (-416.304) [-411.656] (-415.340) -- 0:00:36
443500 -- (-416.637) [-412.863] (-413.497) (-412.574) * (-414.390) (-417.236) [-412.197] (-416.911) -- 0:00:36
444000 -- (-417.981) [-414.186] (-412.596) (-410.722) * (-415.507) (-411.802) [-413.765] (-415.073) -- 0:00:36
444500 -- (-414.535) (-412.007) (-411.566) [-411.253] * [-415.901] (-417.028) (-414.677) (-416.697) -- 0:00:36
445000 -- (-417.802) (-414.556) (-414.586) [-412.615] * (-412.561) (-417.472) (-413.777) [-413.803] -- 0:00:36
Average standard deviation of split frequencies: 0.015544
445500 -- (-413.586) [-412.502] (-414.679) (-413.681) * [-414.609] (-415.128) (-412.136) (-418.041) -- 0:00:36
446000 -- (-415.276) [-412.696] (-413.055) (-414.197) * (-413.458) [-413.694] (-413.395) (-413.063) -- 0:00:36
446500 -- (-416.568) (-414.752) [-412.213] (-412.521) * [-412.065] (-413.021) (-412.011) (-412.665) -- 0:00:35
447000 -- (-416.498) (-416.385) [-411.152] (-412.909) * [-413.730] (-414.783) (-415.337) (-415.333) -- 0:00:35
447500 -- (-417.580) (-414.900) [-408.873] (-418.207) * (-412.180) [-417.232] (-413.321) (-417.311) -- 0:00:35
448000 -- (-413.847) [-413.774] (-413.759) (-413.951) * [-410.667] (-415.480) (-415.152) (-416.163) -- 0:00:35
448500 -- (-414.072) (-409.426) (-410.604) [-414.623] * (-412.588) (-413.924) (-416.842) [-410.075] -- 0:00:35
449000 -- (-413.794) (-409.970) [-414.450] (-419.432) * (-415.790) (-412.752) [-414.445] (-415.268) -- 0:00:35
449500 -- (-415.288) (-411.396) [-413.879] (-415.072) * (-416.297) (-413.042) (-416.694) [-410.446] -- 0:00:35
450000 -- (-414.523) (-412.948) [-412.681] (-414.522) * (-413.943) (-415.167) [-412.279] (-411.281) -- 0:00:35
Average standard deviation of split frequencies: 0.014767
450500 -- (-416.160) [-411.726] (-412.588) (-416.763) * (-414.731) (-414.700) [-411.313] (-412.830) -- 0:00:35
451000 -- (-413.917) (-412.834) (-415.907) [-412.518] * (-414.034) (-413.171) (-412.345) [-412.709] -- 0:00:36
451500 -- [-415.110] (-413.193) (-411.983) (-412.365) * (-411.422) [-415.373] (-413.488) (-415.479) -- 0:00:36
452000 -- (-411.265) (-416.159) [-410.412] (-413.468) * (-415.754) (-414.545) [-414.871] (-417.880) -- 0:00:36
452500 -- [-414.534] (-410.105) (-413.475) (-415.965) * (-416.752) [-411.971] (-413.450) (-417.813) -- 0:00:36
453000 -- (-414.233) [-414.576] (-416.384) (-410.960) * [-408.993] (-414.746) (-415.146) (-417.866) -- 0:00:36
453500 -- [-416.621] (-415.523) (-415.563) (-413.042) * [-411.956] (-412.596) (-414.907) (-419.208) -- 0:00:36
454000 -- (-415.169) [-412.358] (-415.538) (-416.361) * [-411.574] (-414.673) (-418.433) (-411.236) -- 0:00:36
454500 -- [-411.457] (-412.212) (-414.641) (-415.864) * (-411.690) (-412.564) [-413.802] (-411.754) -- 0:00:36
455000 -- (-414.063) (-415.737) [-414.520] (-417.201) * (-412.610) [-412.794] (-412.452) (-416.431) -- 0:00:35
Average standard deviation of split frequencies: 0.014716
455500 -- [-409.757] (-412.565) (-410.621) (-417.274) * (-415.306) [-418.171] (-413.791) (-409.192) -- 0:00:35
456000 -- (-416.237) (-409.238) [-413.390] (-416.467) * [-413.445] (-414.360) (-413.343) (-415.102) -- 0:00:35
456500 -- (-414.601) [-411.228] (-414.452) (-416.950) * [-411.328] (-416.460) (-411.665) (-413.419) -- 0:00:35
457000 -- [-412.572] (-411.875) (-414.184) (-413.232) * (-412.461) (-414.280) [-413.391] (-411.108) -- 0:00:35
457500 -- (-415.269) (-409.863) [-411.881] (-414.788) * (-411.284) (-413.279) (-415.376) [-413.463] -- 0:00:35
458000 -- (-414.937) (-413.211) (-414.219) [-414.266] * (-415.642) [-414.224] (-416.828) (-414.711) -- 0:00:35
458500 -- (-415.800) [-409.146] (-418.639) (-412.851) * (-413.122) [-411.188] (-414.426) (-410.812) -- 0:00:35
459000 -- (-417.202) [-413.128] (-414.584) (-413.314) * (-418.682) [-414.803] (-412.769) (-409.979) -- 0:00:35
459500 -- (-413.714) (-414.136) (-413.796) [-413.982] * (-420.776) (-416.048) (-414.320) [-414.149] -- 0:00:35
460000 -- (-416.226) [-415.244] (-414.342) (-416.605) * (-416.468) (-415.677) [-415.830] (-411.411) -- 0:00:35
Average standard deviation of split frequencies: 0.015109
460500 -- [-412.237] (-419.195) (-412.662) (-415.083) * (-417.691) (-418.182) (-417.616) [-411.012] -- 0:00:35
461000 -- (-412.383) [-412.217] (-411.499) (-413.745) * (-414.016) (-419.007) (-417.283) [-416.770] -- 0:00:35
461500 -- (-414.361) (-416.149) [-412.638] (-417.171) * [-414.435] (-413.744) (-417.302) (-418.340) -- 0:00:35
462000 -- (-412.417) [-415.965] (-417.750) (-417.801) * (-411.391) [-411.428] (-415.020) (-412.448) -- 0:00:34
462500 -- (-412.656) (-412.007) [-414.530] (-417.860) * (-415.727) (-413.016) (-410.083) [-412.754] -- 0:00:34
463000 -- (-413.558) (-410.061) (-414.823) [-412.709] * (-414.437) (-417.047) (-417.556) [-411.113] -- 0:00:34
463500 -- (-413.929) (-417.234) [-414.316] (-417.289) * (-414.060) (-418.870) (-413.941) [-412.071] -- 0:00:34
464000 -- (-413.355) (-419.326) (-414.591) [-418.681] * (-411.680) (-413.360) [-412.266] (-417.633) -- 0:00:34
464500 -- (-413.100) (-415.269) (-416.040) [-414.691] * [-410.903] (-410.926) (-414.676) (-419.916) -- 0:00:34
465000 -- (-416.215) [-416.880] (-414.622) (-412.381) * (-414.047) (-416.023) (-416.347) [-412.877] -- 0:00:34
Average standard deviation of split frequencies: 0.015888
465500 -- (-411.438) (-417.179) [-412.794] (-417.926) * (-415.247) [-414.006] (-412.418) (-414.136) -- 0:00:34
466000 -- (-412.022) (-414.860) [-415.716] (-413.803) * [-415.511] (-414.825) (-421.465) (-413.205) -- 0:00:34
466500 -- (-412.337) [-411.700] (-416.542) (-416.774) * [-415.180] (-413.200) (-412.847) (-413.227) -- 0:00:35
467000 -- (-416.761) (-416.743) (-412.685) [-413.964] * (-417.615) (-415.215) [-418.039] (-411.827) -- 0:00:35
467500 -- (-416.549) [-416.834] (-412.656) (-415.583) * (-415.379) (-415.234) (-413.422) [-415.452] -- 0:00:35
468000 -- (-413.263) (-415.887) [-414.448] (-412.337) * (-415.020) (-417.535) (-416.651) [-411.536] -- 0:00:35
468500 -- (-412.951) (-415.901) [-414.096] (-411.204) * (-411.108) (-413.817) (-415.051) [-412.427] -- 0:00:35
469000 -- [-413.909] (-412.196) (-413.772) (-414.366) * (-413.580) (-416.143) [-414.482] (-411.910) -- 0:00:35
469500 -- [-411.109] (-413.779) (-416.934) (-415.717) * [-414.834] (-414.458) (-413.686) (-412.224) -- 0:00:35
470000 -- (-415.904) (-410.956) [-413.559] (-412.454) * (-416.113) (-413.747) (-414.537) [-412.458] -- 0:00:34
Average standard deviation of split frequencies: 0.015672
470500 -- (-411.869) [-412.377] (-413.486) (-419.484) * [-414.820] (-413.170) (-412.557) (-417.534) -- 0:00:34
471000 -- (-410.136) (-414.799) [-416.964] (-412.182) * (-418.530) (-415.520) [-411.951] (-416.059) -- 0:00:34
471500 -- (-413.750) (-413.333) [-416.525] (-416.612) * (-414.205) (-414.261) (-413.610) [-411.646] -- 0:00:34
472000 -- (-416.857) [-411.322] (-415.568) (-416.667) * (-415.745) [-411.701] (-413.145) (-410.869) -- 0:00:34
472500 -- [-413.628] (-411.602) (-415.490) (-419.168) * (-415.307) [-415.533] (-413.483) (-417.355) -- 0:00:34
473000 -- (-417.817) (-415.909) (-415.238) [-417.411] * (-418.796) [-415.568] (-414.548) (-415.199) -- 0:00:34
473500 -- (-412.970) (-415.253) (-420.329) [-417.100] * (-423.684) [-414.708] (-417.265) (-414.643) -- 0:00:34
474000 -- (-414.696) [-415.225] (-419.720) (-414.496) * [-416.274] (-413.526) (-411.727) (-415.521) -- 0:00:34
474500 -- (-423.646) (-411.011) [-415.442] (-415.079) * (-417.422) (-409.554) (-414.609) [-411.345] -- 0:00:34
475000 -- (-418.255) [-414.084] (-415.806) (-413.900) * (-419.323) (-414.142) [-413.506] (-415.000) -- 0:00:34
Average standard deviation of split frequencies: 0.014564
475500 -- (-415.345) (-411.373) (-419.178) [-412.264] * (-414.588) (-413.526) [-414.254] (-414.604) -- 0:00:34
476000 -- [-414.135] (-411.508) (-421.530) (-412.611) * (-415.833) (-413.181) [-412.002] (-414.103) -- 0:00:34
476500 -- [-413.938] (-410.999) (-416.438) (-417.482) * (-413.412) [-412.544] (-411.904) (-417.500) -- 0:00:34
477000 -- (-417.613) [-411.949] (-414.698) (-413.110) * (-416.690) (-416.674) (-414.236) [-411.536] -- 0:00:33
477500 -- (-416.851) (-415.002) [-416.196] (-412.733) * [-413.396] (-418.150) (-413.638) (-413.232) -- 0:00:33
478000 -- [-417.745] (-414.064) (-416.050) (-415.972) * (-417.036) (-413.898) [-411.501] (-409.982) -- 0:00:33
478500 -- [-412.933] (-415.153) (-418.135) (-417.089) * (-415.711) [-412.128] (-413.708) (-413.633) -- 0:00:33
479000 -- [-412.579] (-414.900) (-417.611) (-411.665) * (-421.198) [-414.379] (-414.556) (-410.554) -- 0:00:33
479500 -- (-412.210) (-415.443) [-413.128] (-412.446) * (-413.824) (-418.923) (-412.458) [-410.305] -- 0:00:33
480000 -- (-417.961) (-413.950) [-414.823] (-415.207) * [-410.711] (-419.053) (-417.387) (-411.558) -- 0:00:33
Average standard deviation of split frequencies: 0.014769
480500 -- (-415.681) (-410.492) [-414.961] (-415.000) * (-416.209) (-411.912) [-411.687] (-414.721) -- 0:00:33
481000 -- (-415.129) (-411.731) [-416.340] (-414.663) * (-413.867) (-413.413) (-412.850) [-413.753] -- 0:00:33
481500 -- (-412.518) (-411.650) [-416.549] (-414.440) * (-414.780) (-410.353) [-414.681] (-413.013) -- 0:00:33
482000 -- (-417.977) [-413.755] (-418.299) (-410.063) * (-415.122) [-411.464] (-416.363) (-414.637) -- 0:00:33
482500 -- (-414.799) [-411.832] (-413.496) (-416.464) * [-412.733] (-414.832) (-415.655) (-411.730) -- 0:00:34
483000 -- (-414.338) (-413.384) [-413.170] (-414.241) * [-415.207] (-412.113) (-411.802) (-414.312) -- 0:00:34
483500 -- (-413.484) [-413.759] (-412.498) (-416.579) * (-417.301) (-410.483) [-412.476] (-419.948) -- 0:00:34
484000 -- [-413.096] (-412.913) (-412.336) (-414.711) * (-412.176) [-410.496] (-413.017) (-410.952) -- 0:00:34
484500 -- [-411.931] (-414.139) (-414.477) (-416.927) * (-414.612) (-411.807) (-412.329) [-412.199] -- 0:00:34
485000 -- [-413.020] (-417.529) (-415.486) (-413.107) * (-413.538) [-417.040] (-413.260) (-413.064) -- 0:00:33
Average standard deviation of split frequencies: 0.014607
485500 -- [-412.040] (-411.957) (-418.172) (-410.303) * [-411.338] (-413.669) (-416.476) (-413.308) -- 0:00:33
486000 -- (-414.149) (-411.859) (-414.281) [-413.011] * (-412.491) [-414.527] (-414.850) (-418.328) -- 0:00:33
486500 -- (-415.648) [-413.570] (-416.478) (-413.272) * (-412.103) [-415.646] (-413.443) (-413.805) -- 0:00:33
487000 -- (-413.077) [-412.989] (-416.383) (-413.609) * (-417.951) [-411.579] (-411.646) (-416.404) -- 0:00:33
487500 -- (-413.944) (-415.128) (-413.692) [-410.996] * [-411.564] (-413.516) (-414.226) (-415.842) -- 0:00:33
488000 -- (-411.924) (-421.385) [-414.049] (-411.881) * (-414.564) [-411.257] (-413.513) (-415.121) -- 0:00:33
488500 -- [-419.772] (-415.661) (-415.540) (-412.746) * (-417.176) (-411.638) [-413.378] (-418.544) -- 0:00:33
489000 -- [-417.338] (-415.374) (-415.496) (-413.286) * (-415.151) [-413.851] (-415.003) (-416.221) -- 0:00:33
489500 -- (-416.140) [-413.839] (-412.485) (-411.795) * (-415.909) (-410.444) [-413.817] (-422.944) -- 0:00:33
490000 -- (-416.593) [-414.217] (-417.380) (-412.919) * (-413.983) [-411.547] (-418.745) (-419.857) -- 0:00:33
Average standard deviation of split frequencies: 0.014298
490500 -- [-416.762] (-415.712) (-415.991) (-412.755) * (-412.887) (-420.408) [-415.189] (-416.827) -- 0:00:33
491000 -- [-416.039] (-418.057) (-415.564) (-410.686) * (-411.000) (-414.587) (-412.425) [-420.464] -- 0:00:33
491500 -- (-412.709) [-410.846] (-419.167) (-414.172) * (-413.734) (-415.047) [-410.710] (-412.208) -- 0:00:33
492000 -- (-418.056) [-410.746] (-414.711) (-410.823) * (-410.669) (-410.369) [-409.560] (-415.191) -- 0:00:33
492500 -- (-414.337) (-415.543) (-415.400) [-412.407] * (-414.094) [-414.021] (-410.422) (-416.444) -- 0:00:32
493000 -- (-416.566) (-414.941) [-415.672] (-410.605) * (-413.439) (-418.644) [-411.511] (-416.388) -- 0:00:32
493500 -- [-413.271] (-412.663) (-415.097) (-414.062) * (-415.376) [-409.973] (-411.002) (-415.949) -- 0:00:32
494000 -- (-414.225) (-414.357) (-414.958) [-411.412] * (-415.086) (-409.159) [-413.003] (-413.143) -- 0:00:32
494500 -- (-412.680) (-416.099) [-417.057] (-412.632) * [-413.405] (-412.492) (-412.932) (-420.199) -- 0:00:32
495000 -- (-414.672) [-412.523] (-414.111) (-413.379) * (-413.274) (-412.461) (-412.599) [-419.714] -- 0:00:32
Average standard deviation of split frequencies: 0.013977
495500 -- [-416.933] (-413.560) (-413.428) (-413.512) * (-410.636) [-412.967] (-412.557) (-413.892) -- 0:00:32
496000 -- (-416.704) [-416.951] (-412.347) (-413.614) * [-412.121] (-416.694) (-414.391) (-414.109) -- 0:00:32
496500 -- (-414.613) (-413.658) [-412.015] (-414.591) * (-414.143) (-410.571) (-414.208) [-413.177] -- 0:00:32
497000 -- (-419.288) [-413.192] (-413.991) (-414.726) * (-417.116) (-413.539) (-410.870) [-414.863] -- 0:00:32
497500 -- [-415.188] (-414.778) (-413.278) (-415.945) * (-414.286) (-410.513) (-411.319) [-413.490] -- 0:00:32
498000 -- (-416.361) (-412.377) (-411.994) [-413.273] * (-412.586) [-411.176] (-412.293) (-417.144) -- 0:00:33
498500 -- (-415.063) (-413.098) (-411.964) [-411.406] * [-412.534] (-411.266) (-414.637) (-418.102) -- 0:00:33
499000 -- (-414.451) (-411.812) [-416.147] (-415.521) * (-411.652) (-413.739) [-413.329] (-417.360) -- 0:00:33
499500 -- [-413.356] (-411.003) (-414.348) (-417.467) * [-412.834] (-414.393) (-414.069) (-412.076) -- 0:00:33
500000 -- (-413.828) (-414.132) (-412.347) [-416.102] * [-414.328] (-413.117) (-412.053) (-414.014) -- 0:00:33
Average standard deviation of split frequencies: 0.014345
500500 -- (-413.584) (-411.958) [-411.949] (-414.378) * (-413.792) (-410.743) [-416.311] (-410.252) -- 0:00:32
501000 -- (-416.251) (-418.458) [-412.570] (-411.596) * (-416.701) (-413.432) [-411.863] (-414.243) -- 0:00:32
501500 -- (-413.116) (-415.164) (-414.052) [-413.908] * [-410.796] (-412.208) (-411.949) (-411.869) -- 0:00:32
502000 -- (-414.201) (-415.305) (-414.823) [-412.601] * (-411.253) [-411.818] (-410.370) (-413.557) -- 0:00:32
502500 -- (-415.256) (-414.665) (-416.573) [-410.723] * (-413.019) (-413.256) [-412.746] (-416.409) -- 0:00:32
503000 -- (-414.700) (-415.880) (-414.311) [-412.960] * [-411.438] (-413.770) (-415.365) (-411.883) -- 0:00:32
503500 -- [-416.170] (-417.224) (-410.580) (-412.533) * (-412.217) (-412.042) (-412.483) [-413.734] -- 0:00:32
504000 -- (-414.937) (-414.472) [-415.447] (-416.579) * (-413.937) (-420.673) [-410.483] (-412.741) -- 0:00:32
504500 -- [-418.858] (-417.892) (-417.520) (-412.692) * (-412.176) (-414.476) [-411.140] (-413.073) -- 0:00:32
505000 -- [-416.883] (-415.674) (-411.694) (-414.890) * (-416.750) (-413.489) [-412.889] (-416.467) -- 0:00:32
Average standard deviation of split frequencies: 0.013426
505500 -- (-421.480) (-416.173) [-414.254] (-411.785) * (-415.544) (-413.065) [-409.726] (-412.400) -- 0:00:32
506000 -- [-420.334] (-417.037) (-411.966) (-413.400) * (-419.184) [-415.786] (-412.743) (-411.489) -- 0:00:32
506500 -- (-416.377) (-421.968) (-416.666) [-412.451] * [-414.815] (-415.690) (-419.755) (-411.592) -- 0:00:32
507000 -- [-414.379] (-416.082) (-412.559) (-410.243) * (-411.802) (-416.881) (-410.900) [-412.973] -- 0:00:32
507500 -- (-416.942) (-414.073) (-413.041) [-412.726] * [-418.887] (-415.588) (-413.591) (-417.754) -- 0:00:32
508000 -- (-412.317) (-413.681) [-418.199] (-413.277) * (-415.649) [-414.571] (-410.398) (-418.946) -- 0:00:31
508500 -- (-415.512) (-413.448) [-413.755] (-415.485) * (-413.505) (-415.126) [-411.076] (-415.242) -- 0:00:31
509000 -- (-413.781) (-418.322) (-414.803) [-411.399] * (-416.098) (-416.101) (-414.946) [-414.290] -- 0:00:31
509500 -- (-412.321) (-415.854) (-415.731) [-414.558] * [-412.654] (-415.703) (-417.268) (-413.538) -- 0:00:31
510000 -- (-412.767) (-414.336) [-415.491] (-412.711) * (-414.027) [-413.465] (-417.607) (-410.912) -- 0:00:31
Average standard deviation of split frequencies: 0.012978
510500 -- (-413.888) (-415.485) [-410.693] (-412.080) * (-411.179) (-415.836) [-413.129] (-416.455) -- 0:00:31
511000 -- (-417.332) (-416.315) [-418.041] (-413.420) * (-412.557) (-413.300) (-410.789) [-411.955] -- 0:00:31
511500 -- (-415.721) (-415.255) [-415.711] (-410.047) * (-417.953) (-415.475) (-411.835) [-413.820] -- 0:00:31
512000 -- (-418.909) (-414.849) (-417.595) [-410.887] * [-411.403] (-414.750) (-415.793) (-414.756) -- 0:00:31
512500 -- [-414.670] (-415.087) (-421.744) (-413.467) * [-413.003] (-416.878) (-412.362) (-410.653) -- 0:00:31
513000 -- (-414.645) (-414.263) [-417.222] (-413.148) * (-416.136) (-416.110) (-411.372) [-413.626] -- 0:00:31
513500 -- (-417.743) [-415.504] (-417.672) (-413.635) * (-413.451) [-412.759] (-410.666) (-411.323) -- 0:00:32
514000 -- (-417.904) (-413.571) [-413.925] (-412.413) * [-411.203] (-418.404) (-415.259) (-412.863) -- 0:00:32
514500 -- (-415.720) (-411.854) (-412.116) [-412.819] * (-418.734) (-415.408) [-410.666] (-411.113) -- 0:00:32
515000 -- (-419.337) (-414.999) (-412.908) [-410.609] * (-414.807) (-416.449) [-411.338] (-411.625) -- 0:00:32
Average standard deviation of split frequencies: 0.013166
515500 -- (-422.085) (-413.314) (-415.526) [-412.515] * (-414.167) (-414.822) (-412.836) [-412.162] -- 0:00:31
516000 -- (-417.699) (-412.033) (-415.850) [-409.117] * (-412.164) [-411.614] (-412.728) (-411.109) -- 0:00:31
516500 -- (-415.239) [-412.389] (-417.592) (-411.980) * (-412.398) (-411.690) (-414.325) [-411.251] -- 0:00:31
517000 -- (-418.763) [-410.817] (-416.531) (-411.715) * [-413.531] (-415.758) (-413.625) (-412.133) -- 0:00:31
517500 -- (-414.904) (-416.775) (-410.856) [-415.099] * [-413.367] (-416.680) (-413.817) (-412.758) -- 0:00:31
518000 -- (-412.462) [-415.509] (-414.152) (-416.733) * (-411.835) (-415.771) [-412.181] (-411.680) -- 0:00:31
518500 -- (-414.379) (-417.675) (-414.332) [-412.609] * (-410.940) [-414.279] (-415.860) (-415.243) -- 0:00:31
519000 -- (-418.389) [-412.788] (-412.458) (-415.237) * (-416.002) [-417.569] (-416.898) (-412.997) -- 0:00:31
519500 -- (-415.388) (-415.580) [-414.736] (-413.281) * (-412.726) (-412.327) (-411.826) [-412.508] -- 0:00:31
520000 -- [-416.223] (-412.828) (-412.026) (-417.627) * [-413.590] (-413.538) (-412.867) (-415.801) -- 0:00:31
Average standard deviation of split frequencies: 0.012888
520500 -- (-416.181) [-410.737] (-413.454) (-411.382) * (-414.494) [-413.360] (-418.774) (-416.031) -- 0:00:31
521000 -- [-415.045] (-411.064) (-416.388) (-410.708) * [-413.535] (-411.663) (-417.579) (-410.365) -- 0:00:31
521500 -- (-419.823) (-415.438) (-415.059) [-415.015] * [-413.010] (-418.309) (-413.801) (-409.717) -- 0:00:31
522000 -- (-422.907) (-417.056) [-414.241] (-415.199) * (-417.248) (-414.505) [-414.662] (-413.092) -- 0:00:31
522500 -- (-420.197) (-418.714) (-415.533) [-414.703] * (-419.561) (-413.758) (-413.699) [-412.405] -- 0:00:31
523000 -- (-419.055) [-419.451] (-410.699) (-412.263) * (-418.406) (-415.252) (-410.285) [-415.297] -- 0:00:31
523500 -- (-415.711) [-416.830] (-417.109) (-412.432) * (-417.619) (-413.194) (-409.732) [-412.019] -- 0:00:30
524000 -- (-413.886) (-410.237) (-410.765) [-410.698] * [-416.824] (-414.871) (-414.762) (-412.104) -- 0:00:30
524500 -- (-414.031) [-410.926] (-411.425) (-411.843) * (-414.693) [-412.244] (-413.912) (-414.603) -- 0:00:30
525000 -- (-416.424) (-413.271) (-415.385) [-410.650] * (-416.157) (-416.497) (-410.141) [-413.854] -- 0:00:30
Average standard deviation of split frequencies: 0.013127
525500 -- [-416.632] (-414.810) (-414.750) (-412.955) * [-413.681] (-413.843) (-411.084) (-411.077) -- 0:00:30
526000 -- (-416.285) (-417.144) (-413.659) [-412.121] * (-413.863) (-412.998) [-412.558] (-411.681) -- 0:00:30
526500 -- (-416.840) (-414.710) (-413.476) [-415.122] * [-412.766] (-412.901) (-413.318) (-411.532) -- 0:00:30
527000 -- (-419.590) [-415.009] (-408.341) (-411.039) * (-413.171) (-419.457) (-412.620) [-411.369] -- 0:00:30
527500 -- (-416.466) (-416.687) (-415.523) [-410.802] * (-416.932) [-414.651] (-413.778) (-413.829) -- 0:00:30
528000 -- (-416.944) (-416.721) (-415.218) [-408.926] * [-418.389] (-412.140) (-414.085) (-412.756) -- 0:00:30
528500 -- (-415.106) (-415.350) (-411.908) [-411.999] * (-411.594) [-412.647] (-412.796) (-410.365) -- 0:00:30
529000 -- (-410.982) (-416.213) [-412.709] (-409.880) * (-415.528) [-412.874] (-413.197) (-412.060) -- 0:00:30
529500 -- (-409.924) (-412.550) [-410.856] (-411.290) * (-415.936) [-410.618] (-414.419) (-417.330) -- 0:00:31
530000 -- (-413.763) [-410.803] (-411.362) (-409.273) * (-416.273) (-415.890) [-412.792] (-415.713) -- 0:00:31
Average standard deviation of split frequencies: 0.013168
530500 -- (-410.897) (-416.363) (-412.972) [-412.281] * [-411.249] (-411.170) (-413.209) (-413.275) -- 0:00:30
531000 -- [-414.545] (-414.946) (-416.736) (-413.951) * (-417.225) (-414.297) [-411.959] (-411.620) -- 0:00:30
531500 -- (-413.915) (-416.618) [-411.603] (-415.433) * (-420.066) (-418.762) [-411.953] (-413.830) -- 0:00:30
532000 -- [-414.166] (-413.439) (-416.950) (-412.768) * (-414.872) (-414.462) [-415.039] (-414.039) -- 0:00:30
532500 -- (-414.646) (-412.040) (-414.938) [-413.347] * (-413.655) (-417.520) (-414.722) [-412.165] -- 0:00:30
533000 -- [-415.430] (-415.439) (-412.735) (-416.424) * (-413.667) [-413.344] (-417.483) (-415.226) -- 0:00:30
533500 -- (-416.537) [-416.982] (-410.759) (-416.102) * (-417.706) (-412.332) (-418.352) [-411.366] -- 0:00:30
534000 -- (-415.325) [-414.067] (-411.997) (-413.614) * (-410.756) (-416.489) [-415.887] (-416.366) -- 0:00:30
534500 -- (-417.879) (-416.046) (-410.542) [-412.416] * [-412.232] (-416.642) (-412.286) (-410.651) -- 0:00:30
535000 -- (-415.793) (-411.946) [-410.988] (-414.346) * (-413.665) (-413.915) [-413.528] (-412.497) -- 0:00:30
Average standard deviation of split frequencies: 0.012675
535500 -- (-415.849) (-412.635) [-412.907] (-413.196) * [-413.830] (-410.998) (-416.904) (-412.223) -- 0:00:30
536000 -- [-415.350] (-414.574) (-413.737) (-419.101) * [-413.401] (-410.763) (-414.575) (-413.091) -- 0:00:30
536500 -- (-416.289) (-424.040) (-409.172) [-419.780] * (-413.630) (-412.902) (-415.844) [-410.193] -- 0:00:30
537000 -- (-416.508) (-413.760) [-410.031] (-412.933) * (-415.037) (-412.743) [-412.096] (-411.087) -- 0:00:30
537500 -- (-416.677) (-415.437) (-415.059) [-414.210] * (-414.791) (-417.165) (-413.450) [-412.461] -- 0:00:30
538000 -- (-421.185) [-409.348] (-410.320) (-415.139) * [-414.557] (-418.068) (-415.171) (-419.179) -- 0:00:30
538500 -- (-419.398) [-414.264] (-411.757) (-413.137) * (-414.544) [-413.486] (-416.216) (-411.984) -- 0:00:29
539000 -- (-415.411) (-417.990) [-409.088] (-410.527) * (-413.360) (-411.205) [-413.389] (-412.092) -- 0:00:29
539500 -- (-417.554) [-420.584] (-416.055) (-412.209) * (-416.311) (-411.393) [-412.986] (-411.962) -- 0:00:29
540000 -- (-418.696) (-416.068) [-410.624] (-411.609) * (-414.660) [-411.891] (-412.765) (-411.429) -- 0:00:29
Average standard deviation of split frequencies: 0.012719
540500 -- (-411.212) (-417.856) (-413.276) [-412.580] * (-410.249) [-412.633] (-415.788) (-413.874) -- 0:00:29
541000 -- (-411.877) (-416.564) [-415.453] (-417.126) * (-412.224) [-412.343] (-415.137) (-410.887) -- 0:00:29
541500 -- (-417.311) (-419.020) (-412.393) [-413.640] * (-413.348) [-411.940] (-417.007) (-411.759) -- 0:00:29
542000 -- (-414.691) (-413.946) [-412.399] (-409.832) * [-412.728] (-414.020) (-413.499) (-411.783) -- 0:00:29
542500 -- (-412.824) [-413.632] (-414.132) (-411.595) * (-412.307) [-411.168] (-413.450) (-414.823) -- 0:00:29
543000 -- (-415.731) (-409.725) (-414.388) [-411.750] * [-412.715] (-413.657) (-415.654) (-413.394) -- 0:00:29
543500 -- [-413.922] (-412.906) (-414.845) (-411.577) * [-413.687] (-411.774) (-412.250) (-415.936) -- 0:00:29
544000 -- (-412.633) [-417.284] (-416.675) (-411.586) * [-413.254] (-415.648) (-411.398) (-416.091) -- 0:00:29
544500 -- [-415.374] (-411.712) (-410.554) (-415.654) * (-416.224) [-411.984] (-413.951) (-414.774) -- 0:00:29
545000 -- (-413.316) (-419.084) (-410.344) [-410.884] * (-416.060) (-412.148) [-412.789] (-413.547) -- 0:00:30
Average standard deviation of split frequencies: 0.012494
545500 -- [-416.370] (-415.026) (-412.512) (-414.172) * [-414.721] (-414.739) (-412.672) (-410.602) -- 0:00:29
546000 -- (-413.124) [-413.627] (-412.443) (-410.551) * (-413.906) (-410.074) (-421.164) [-409.740] -- 0:00:29
546500 -- [-413.103] (-413.899) (-412.081) (-411.317) * (-412.553) [-414.519] (-413.408) (-416.166) -- 0:00:29
547000 -- (-411.712) (-412.793) (-415.509) [-412.825] * (-414.304) [-411.595] (-415.551) (-412.823) -- 0:00:29
547500 -- (-414.786) [-413.446] (-413.317) (-412.156) * (-413.788) (-417.676) [-412.979] (-411.291) -- 0:00:29
548000 -- (-415.929) (-417.066) (-414.596) [-417.536] * (-415.122) [-413.390] (-415.222) (-412.042) -- 0:00:29
548500 -- [-414.569] (-414.340) (-416.115) (-413.770) * (-413.570) [-416.069] (-410.847) (-412.967) -- 0:00:29
549000 -- (-413.148) [-413.936] (-415.042) (-414.305) * (-415.676) (-414.185) (-414.981) [-411.782] -- 0:00:29
549500 -- (-415.495) [-410.939] (-414.537) (-415.184) * (-414.057) [-412.552] (-410.511) (-412.003) -- 0:00:29
550000 -- (-417.083) (-415.030) [-417.922] (-414.302) * (-417.582) [-410.714] (-411.924) (-414.980) -- 0:00:29
Average standard deviation of split frequencies: 0.012086
550500 -- (-414.671) [-411.266] (-414.966) (-412.227) * (-418.710) [-412.603] (-412.644) (-410.001) -- 0:00:29
551000 -- [-415.157] (-409.314) (-416.086) (-410.924) * (-414.076) (-411.826) [-413.396] (-420.330) -- 0:00:29
551500 -- (-412.702) (-412.365) [-417.631] (-413.405) * (-413.034) [-411.205] (-413.431) (-415.981) -- 0:00:29
552000 -- [-416.401] (-412.234) (-415.053) (-414.000) * (-417.660) (-411.220) [-415.178] (-415.224) -- 0:00:29
552500 -- (-414.935) (-410.363) [-414.339] (-413.604) * (-423.887) (-412.724) (-413.699) [-416.803] -- 0:00:29
553000 -- [-412.674] (-415.098) (-416.209) (-411.148) * (-413.596) (-411.904) [-408.921] (-415.107) -- 0:00:29
553500 -- (-413.681) [-414.537] (-413.300) (-412.532) * (-415.872) [-412.464] (-412.918) (-420.170) -- 0:00:29
554000 -- (-414.747) (-416.189) [-412.745] (-412.076) * [-416.781] (-411.976) (-410.606) (-417.174) -- 0:00:28
554500 -- (-412.068) (-411.665) (-415.196) [-413.903] * (-415.108) (-412.072) (-411.778) [-417.034] -- 0:00:28
555000 -- [-411.418] (-412.902) (-415.258) (-412.692) * (-413.401) (-416.249) [-411.325] (-417.117) -- 0:00:28
Average standard deviation of split frequencies: 0.011321
555500 -- (-411.394) (-415.033) (-412.542) [-411.041] * (-414.728) (-417.131) [-411.470] (-412.718) -- 0:00:28
556000 -- (-414.923) [-414.862] (-413.538) (-415.199) * (-415.793) (-415.690) [-412.181] (-416.814) -- 0:00:28
556500 -- [-414.496] (-413.176) (-415.629) (-415.814) * (-416.252) (-415.177) (-413.583) [-409.801] -- 0:00:28
557000 -- (-413.118) (-414.151) (-411.186) [-412.496] * (-413.896) [-413.237] (-413.461) (-420.472) -- 0:00:28
557500 -- (-416.381) [-411.000] (-420.775) (-411.076) * [-414.726] (-417.511) (-414.507) (-413.902) -- 0:00:28
558000 -- (-413.548) (-410.804) (-418.187) [-412.083] * [-414.718] (-417.251) (-413.729) (-415.776) -- 0:00:28
558500 -- [-414.898] (-411.413) (-414.206) (-412.151) * [-413.934] (-414.665) (-411.933) (-416.323) -- 0:00:28
559000 -- [-415.773] (-416.861) (-415.871) (-413.394) * (-413.608) (-413.685) (-418.207) [-411.918] -- 0:00:28
559500 -- (-413.838) [-411.198] (-413.700) (-413.484) * [-414.706] (-413.502) (-414.457) (-415.284) -- 0:00:28
560000 -- (-411.974) [-409.920] (-418.346) (-412.121) * (-418.213) (-412.480) (-412.977) [-412.730] -- 0:00:28
Average standard deviation of split frequencies: 0.011722
560500 -- (-411.978) [-413.516] (-418.239) (-410.083) * (-417.377) (-417.352) (-413.617) [-415.076] -- 0:00:28
561000 -- (-412.425) (-411.974) [-414.159] (-418.784) * (-412.396) [-410.682] (-416.668) (-410.645) -- 0:00:28
561500 -- (-412.043) [-411.652] (-415.963) (-412.064) * (-411.473) [-412.955] (-417.547) (-414.860) -- 0:00:28
562000 -- (-414.829) [-411.147] (-416.326) (-415.168) * (-418.574) [-413.074] (-413.512) (-416.245) -- 0:00:28
562500 -- (-414.128) [-410.200] (-416.269) (-414.631) * (-414.707) (-414.110) [-412.243] (-414.607) -- 0:00:28
563000 -- (-411.702) [-410.649] (-416.003) (-414.585) * [-414.342] (-412.508) (-410.220) (-414.130) -- 0:00:28
563500 -- (-411.350) (-411.569) (-414.981) [-416.879] * [-413.473] (-415.468) (-413.939) (-418.881) -- 0:00:28
564000 -- [-414.036] (-413.423) (-420.362) (-414.589) * (-415.136) (-415.226) [-413.332] (-413.752) -- 0:00:28
564500 -- (-417.556) (-410.604) [-413.631] (-414.264) * (-411.395) (-412.791) (-413.869) [-414.042] -- 0:00:28
565000 -- (-412.279) (-412.483) [-414.016] (-415.051) * (-413.094) (-415.242) (-414.773) [-412.224] -- 0:00:28
Average standard deviation of split frequencies: 0.011954
565500 -- [-410.628] (-411.607) (-419.275) (-410.875) * (-413.920) [-413.234] (-425.583) (-411.451) -- 0:00:28
566000 -- (-414.474) [-411.384] (-417.104) (-420.400) * (-417.468) [-411.622] (-418.274) (-415.717) -- 0:00:28
566500 -- (-413.504) [-410.880] (-415.682) (-410.362) * (-414.796) (-413.672) [-409.920] (-414.384) -- 0:00:28
567000 -- [-414.593] (-409.889) (-417.583) (-410.400) * (-414.987) (-412.095) [-415.224] (-412.200) -- 0:00:28
567500 -- (-413.033) (-414.445) (-415.173) [-410.254] * (-419.599) (-414.199) [-413.232] (-411.881) -- 0:00:28
568000 -- [-412.822] (-414.555) (-416.445) (-413.633) * (-413.724) (-416.544) (-418.172) [-412.228] -- 0:00:28
568500 -- (-413.560) (-413.553) (-415.924) [-414.530] * (-418.326) (-410.277) (-413.161) [-415.902] -- 0:00:28
569000 -- (-415.845) [-415.962] (-413.160) (-410.624) * (-416.044) (-414.408) [-413.086] (-416.104) -- 0:00:28
569500 -- (-415.052) (-417.869) [-411.891] (-410.116) * (-415.250) (-415.012) [-412.300] (-413.368) -- 0:00:27
570000 -- (-411.578) [-411.512] (-412.492) (-410.155) * (-413.089) [-413.180] (-417.194) (-417.426) -- 0:00:27
Average standard deviation of split frequencies: 0.011662
570500 -- (-413.382) [-411.222] (-412.003) (-414.209) * (-413.035) [-410.784] (-411.341) (-415.518) -- 0:00:27
571000 -- [-418.356] (-413.470) (-412.795) (-411.491) * (-416.447) (-412.028) [-413.041] (-412.206) -- 0:00:27
571500 -- (-412.542) [-412.689] (-411.251) (-410.316) * (-419.800) [-411.039] (-412.814) (-413.794) -- 0:00:27
572000 -- (-410.814) [-411.680] (-420.098) (-413.567) * [-413.565] (-412.805) (-412.784) (-411.155) -- 0:00:27
572500 -- [-412.673] (-412.064) (-415.456) (-413.961) * (-416.794) (-410.907) (-415.389) [-416.998] -- 0:00:27
573000 -- (-416.189) [-412.257] (-412.589) (-410.169) * (-416.442) (-412.527) [-412.046] (-414.504) -- 0:00:27
573500 -- (-413.859) (-412.424) (-412.056) [-411.701] * (-415.162) (-414.852) (-416.402) [-413.806] -- 0:00:27
574000 -- (-415.235) (-411.680) [-413.230] (-410.721) * (-414.801) [-410.220] (-417.822) (-411.861) -- 0:00:27
574500 -- [-412.687] (-411.793) (-409.696) (-410.757) * (-413.882) (-414.874) [-408.415] (-411.614) -- 0:00:27
575000 -- (-412.396) (-411.853) (-409.690) [-410.761] * (-414.045) (-415.913) [-411.058] (-412.674) -- 0:00:27
Average standard deviation of split frequencies: 0.011891
575500 -- (-414.317) (-411.658) [-413.765] (-412.447) * (-419.153) (-413.238) (-413.131) [-414.297] -- 0:00:27
576000 -- (-410.177) (-410.576) (-412.903) [-413.680] * (-414.099) [-415.290] (-418.180) (-413.088) -- 0:00:27
576500 -- (-414.176) [-418.032] (-411.850) (-417.246) * (-415.937) (-413.328) [-412.210] (-418.702) -- 0:00:27
577000 -- [-413.776] (-413.875) (-410.736) (-416.296) * (-415.662) (-417.189) (-412.471) [-412.944] -- 0:00:27
577500 -- (-415.959) (-413.643) [-413.783] (-411.805) * (-422.146) (-417.519) (-415.516) [-418.790] -- 0:00:27
578000 -- (-419.559) (-413.990) (-414.455) [-412.364] * [-415.456] (-415.680) (-415.416) (-418.438) -- 0:00:27
578500 -- (-413.690) (-416.782) (-413.743) [-412.535] * (-417.830) [-412.230] (-411.573) (-415.883) -- 0:00:27
579000 -- [-415.239] (-416.385) (-414.497) (-416.396) * (-416.070) [-414.360] (-415.426) (-413.541) -- 0:00:27
579500 -- (-419.536) (-417.172) [-412.929] (-412.839) * [-413.888] (-414.468) (-412.008) (-416.761) -- 0:00:27
580000 -- [-411.204] (-413.012) (-415.235) (-420.589) * (-418.968) [-412.839] (-416.656) (-414.848) -- 0:00:27
Average standard deviation of split frequencies: 0.011366
580500 -- (-414.029) (-411.218) (-410.967) [-411.805] * [-416.857] (-411.110) (-414.990) (-416.676) -- 0:00:27
581000 -- (-413.764) (-411.163) (-414.994) [-414.526] * [-416.349] (-413.516) (-413.243) (-414.418) -- 0:00:27
581500 -- (-412.356) (-411.748) [-412.988] (-417.598) * (-420.269) (-413.907) [-411.371] (-416.149) -- 0:00:27
582000 -- [-411.477] (-410.481) (-411.174) (-413.750) * (-414.704) (-414.778) [-412.334] (-413.606) -- 0:00:27
582500 -- [-409.143] (-411.556) (-413.947) (-411.001) * (-415.907) (-414.907) [-411.075] (-412.279) -- 0:00:27
583000 -- [-412.273] (-414.273) (-416.216) (-414.673) * (-417.394) [-411.794] (-412.951) (-413.034) -- 0:00:27
583500 -- [-412.273] (-414.064) (-411.392) (-414.848) * (-415.836) (-414.574) (-413.065) [-413.329] -- 0:00:27
584000 -- [-414.217] (-413.610) (-410.391) (-414.467) * (-414.963) (-416.274) [-416.022] (-412.534) -- 0:00:27
584500 -- [-418.776] (-413.024) (-411.529) (-414.951) * (-415.307) (-416.130) [-415.997] (-411.938) -- 0:00:27
585000 -- (-414.995) (-412.735) [-417.379] (-418.604) * (-421.069) (-412.337) (-413.615) [-412.621] -- 0:00:26
Average standard deviation of split frequencies: 0.010637
585500 -- (-411.687) (-412.924) [-408.788] (-412.379) * (-416.602) (-416.403) (-413.491) [-414.825] -- 0:00:26
586000 -- [-412.639] (-412.397) (-412.463) (-416.924) * [-416.095] (-411.086) (-419.994) (-419.742) -- 0:00:26
586500 -- (-414.220) [-411.419] (-412.402) (-414.604) * [-414.078] (-418.505) (-412.624) (-415.053) -- 0:00:26
587000 -- [-414.759] (-416.516) (-411.807) (-414.696) * (-410.967) (-418.595) (-413.450) [-410.267] -- 0:00:26
587500 -- (-416.466) [-414.284] (-411.057) (-411.526) * (-415.751) (-410.445) [-413.889] (-411.677) -- 0:00:26
588000 -- (-417.965) (-415.914) (-413.422) [-412.113] * (-412.798) [-411.974] (-412.715) (-414.125) -- 0:00:26
588500 -- (-413.621) (-413.467) [-411.751] (-414.330) * (-412.970) (-413.383) [-411.430] (-417.592) -- 0:00:26
589000 -- (-413.731) (-413.558) (-411.178) [-416.958] * (-413.203) (-413.184) (-411.497) [-417.203] -- 0:00:26
589500 -- (-416.361) [-413.540] (-412.831) (-412.791) * [-413.578] (-411.892) (-411.541) (-416.447) -- 0:00:26
590000 -- [-412.333] (-410.966) (-411.301) (-415.308) * (-413.652) (-416.175) [-411.185] (-413.676) -- 0:00:26
Average standard deviation of split frequencies: 0.010422
590500 -- [-414.567] (-412.416) (-413.175) (-419.735) * [-412.590] (-413.821) (-414.870) (-414.586) -- 0:00:26
591000 -- (-411.224) [-414.847] (-416.759) (-416.700) * (-419.099) (-418.085) [-412.429] (-410.409) -- 0:00:26
591500 -- (-413.157) (-412.477) [-411.084] (-414.864) * (-418.919) (-413.195) (-411.579) [-413.355] -- 0:00:26
592000 -- (-416.872) (-417.311) (-418.795) [-414.008] * (-412.512) (-413.487) (-412.888) [-411.058] -- 0:00:26
592500 -- (-416.197) (-413.300) (-414.968) [-414.188] * (-414.453) (-414.154) (-413.945) [-413.211] -- 0:00:26
593000 -- [-414.126] (-415.494) (-414.638) (-415.314) * [-413.345] (-418.150) (-410.993) (-411.513) -- 0:00:26
593500 -- (-414.379) (-413.432) (-412.807) [-412.547] * [-410.372] (-409.575) (-413.831) (-414.598) -- 0:00:26
594000 -- (-412.956) (-416.104) [-410.601] (-417.162) * (-416.632) (-415.144) [-413.379] (-412.794) -- 0:00:26
594500 -- (-411.698) [-414.008] (-414.190) (-415.886) * (-414.169) [-416.102] (-411.316) (-414.244) -- 0:00:26
595000 -- (-411.900) [-417.477] (-414.795) (-419.723) * (-414.699) [-414.667] (-411.778) (-413.151) -- 0:00:26
Average standard deviation of split frequencies: 0.010282
595500 -- (-412.629) (-413.364) (-415.076) [-415.902] * (-419.046) [-417.328] (-414.620) (-414.152) -- 0:00:26
596000 -- (-416.435) (-411.530) [-412.042] (-417.152) * (-423.858) [-412.718] (-412.616) (-411.333) -- 0:00:26
596500 -- (-412.966) [-414.295] (-412.017) (-419.299) * [-414.076] (-411.829) (-411.508) (-411.681) -- 0:00:26
597000 -- (-411.478) (-416.358) [-414.835] (-416.623) * [-415.619] (-416.137) (-414.884) (-414.604) -- 0:00:26
597500 -- [-414.940] (-414.168) (-416.237) (-413.788) * (-417.315) (-414.724) (-411.623) [-412.298] -- 0:00:26
598000 -- [-410.544] (-410.958) (-411.916) (-414.348) * [-415.616] (-413.387) (-413.906) (-418.398) -- 0:00:26
598500 -- (-414.274) (-415.474) [-417.295] (-413.012) * (-416.550) [-411.219] (-413.213) (-414.067) -- 0:00:26
599000 -- (-413.890) [-410.195] (-413.687) (-412.305) * (-415.122) (-414.734) (-415.243) [-417.048] -- 0:00:26
599500 -- (-415.120) [-415.826] (-414.634) (-412.261) * (-415.466) (-413.335) [-412.157] (-411.722) -- 0:00:26
600000 -- (-415.464) [-412.822] (-413.717) (-415.203) * (-416.892) [-414.026] (-411.633) (-415.769) -- 0:00:25
Average standard deviation of split frequencies: 0.010664
600500 -- (-416.432) [-412.256] (-414.785) (-414.266) * (-413.932) [-413.067] (-416.483) (-413.575) -- 0:00:25
601000 -- (-418.447) (-412.423) (-413.325) [-413.910] * [-416.337] (-412.497) (-410.890) (-412.955) -- 0:00:25
601500 -- (-412.746) (-420.475) (-415.502) [-412.671] * (-415.313) (-413.564) (-413.507) [-414.500] -- 0:00:25
602000 -- (-412.572) (-416.546) [-416.214] (-415.650) * [-412.842] (-410.886) (-413.317) (-419.562) -- 0:00:25
602500 -- (-416.323) [-416.211] (-411.466) (-421.037) * (-419.867) [-415.324] (-413.510) (-416.910) -- 0:00:25
603000 -- (-414.296) [-410.879] (-415.698) (-418.652) * (-415.082) [-414.486] (-415.477) (-413.968) -- 0:00:25
603500 -- [-411.821] (-414.084) (-414.945) (-416.582) * (-415.644) [-412.602] (-415.765) (-413.335) -- 0:00:25
604000 -- (-413.201) (-413.052) (-412.275) [-411.115] * (-415.695) (-414.639) (-413.897) [-413.847] -- 0:00:25
604500 -- [-410.320] (-419.284) (-415.046) (-413.596) * (-413.136) [-413.047] (-412.770) (-413.397) -- 0:00:25
605000 -- (-417.449) (-412.682) [-409.986] (-410.445) * (-413.948) (-414.304) [-413.579] (-412.388) -- 0:00:25
Average standard deviation of split frequencies: 0.010707
605500 -- (-409.626) (-412.374) [-412.525] (-417.237) * (-417.046) (-411.891) [-412.221] (-414.664) -- 0:00:25
606000 -- (-414.071) (-413.136) [-414.937] (-414.826) * (-415.906) (-414.231) [-410.877] (-412.943) -- 0:00:25
606500 -- [-413.929] (-412.222) (-414.750) (-415.243) * (-416.007) (-415.561) [-414.088] (-414.103) -- 0:00:25
607000 -- [-414.631] (-414.138) (-414.451) (-412.595) * (-412.332) [-411.652] (-415.348) (-415.289) -- 0:00:25
607500 -- (-418.835) (-416.128) (-413.236) [-412.610] * [-412.248] (-414.971) (-414.373) (-418.477) -- 0:00:25
608000 -- (-421.731) (-417.787) [-411.202] (-414.259) * (-414.749) [-411.232] (-413.208) (-415.064) -- 0:00:25
608500 -- [-413.200] (-416.756) (-411.683) (-412.187) * (-416.957) (-414.492) [-413.977] (-414.570) -- 0:00:25
609000 -- (-415.508) (-412.974) [-415.370] (-416.436) * (-412.345) (-415.228) [-410.724] (-413.552) -- 0:00:25
609500 -- (-416.099) [-412.915] (-420.694) (-415.982) * [-410.433] (-412.258) (-412.743) (-413.128) -- 0:00:25
610000 -- [-414.274] (-411.380) (-414.098) (-417.991) * (-413.619) (-414.625) [-411.800] (-416.099) -- 0:00:25
Average standard deviation of split frequencies: 0.010626
610500 -- [-415.996] (-413.797) (-415.118) (-416.353) * (-412.654) (-415.630) [-410.255] (-414.259) -- 0:00:25
611000 -- (-416.746) (-418.668) [-412.637] (-413.686) * (-414.377) (-412.950) [-412.153] (-415.595) -- 0:00:25
611500 -- [-413.525] (-417.495) (-414.932) (-414.266) * (-411.241) (-410.738) [-418.058] (-415.386) -- 0:00:25
612000 -- [-415.438] (-413.234) (-413.113) (-416.113) * (-412.606) [-416.751] (-412.041) (-413.413) -- 0:00:25
612500 -- (-414.965) (-413.611) (-414.018) [-412.397] * (-415.508) [-415.210] (-411.311) (-417.073) -- 0:00:25
613000 -- [-414.856] (-414.356) (-419.328) (-419.864) * (-411.545) [-411.986] (-415.128) (-413.911) -- 0:00:25
613500 -- (-414.028) (-413.739) (-415.819) [-414.975] * (-413.208) (-414.786) (-414.996) [-410.807] -- 0:00:25
614000 -- (-416.382) (-411.359) [-419.422] (-417.246) * (-415.754) (-412.777) (-414.526) [-414.479] -- 0:00:25
614500 -- [-417.380] (-415.500) (-415.789) (-417.129) * (-417.777) (-413.186) [-414.235] (-413.228) -- 0:00:25
615000 -- (-414.831) (-415.088) (-415.761) [-414.571] * (-410.116) [-413.224] (-411.541) (-413.386) -- 0:00:25
Average standard deviation of split frequencies: 0.010894
615500 -- (-413.146) (-414.638) [-412.534] (-419.882) * (-412.740) (-413.791) [-415.122] (-415.761) -- 0:00:24
616000 -- (-414.330) [-412.747] (-415.118) (-419.805) * [-415.881] (-414.458) (-414.535) (-414.697) -- 0:00:24
616500 -- (-420.154) [-416.972] (-417.395) (-413.576) * (-412.353) [-411.102] (-417.273) (-417.264) -- 0:00:24
617000 -- [-415.727] (-414.458) (-416.109) (-415.358) * (-411.435) (-412.637) [-412.851] (-414.801) -- 0:00:24
617500 -- (-417.423) (-415.172) [-412.132] (-412.833) * (-416.700) [-408.756] (-412.585) (-413.419) -- 0:00:24
618000 -- (-412.707) (-412.941) [-414.676] (-415.789) * (-416.909) [-411.023] (-414.817) (-416.815) -- 0:00:24
618500 -- (-414.610) [-410.940] (-417.989) (-420.300) * (-415.063) (-411.757) (-415.757) [-412.772] -- 0:00:24
619000 -- (-415.251) (-412.315) [-415.266] (-412.916) * (-412.855) [-411.943] (-418.269) (-416.428) -- 0:00:24
619500 -- (-415.229) (-416.542) [-415.243] (-416.471) * [-409.590] (-415.517) (-414.528) (-416.940) -- 0:00:24
620000 -- [-415.136] (-413.858) (-417.969) (-414.197) * (-411.605) (-413.770) [-411.656] (-415.551) -- 0:00:24
Average standard deviation of split frequencies: 0.010946
620500 -- (-413.749) (-410.738) [-413.706] (-414.180) * (-414.063) (-412.945) (-413.410) [-413.070] -- 0:00:24
621000 -- (-413.401) (-412.927) (-414.578) [-412.531] * (-410.530) [-413.102] (-417.642) (-414.815) -- 0:00:24
621500 -- (-415.120) (-414.080) (-413.642) [-414.459] * (-413.568) (-414.246) (-418.081) [-414.849] -- 0:00:24
622000 -- (-417.178) [-413.936] (-414.182) (-412.020) * [-413.497] (-412.134) (-418.694) (-419.429) -- 0:00:24
622500 -- (-413.228) [-421.244] (-416.350) (-416.000) * [-412.749] (-412.952) (-415.891) (-417.801) -- 0:00:24
623000 -- (-419.262) (-416.392) [-415.324] (-414.347) * (-412.696) (-410.184) [-413.071] (-413.526) -- 0:00:24
623500 -- (-414.228) (-416.463) [-412.642] (-415.780) * (-414.494) (-413.305) [-414.874] (-415.782) -- 0:00:24
624000 -- (-417.374) (-415.607) (-419.058) [-414.604] * (-413.071) (-410.882) (-415.041) [-413.870] -- 0:00:24
624500 -- (-412.913) [-410.898] (-417.490) (-413.150) * (-414.095) [-411.872] (-415.396) (-415.545) -- 0:00:24
625000 -- (-412.409) [-412.098] (-416.024) (-412.223) * (-414.858) [-410.161] (-415.348) (-418.404) -- 0:00:24
Average standard deviation of split frequencies: 0.011163
625500 -- [-411.643] (-412.696) (-418.449) (-415.441) * (-411.214) [-413.748] (-417.454) (-413.677) -- 0:00:24
626000 -- (-412.120) (-415.799) [-416.013] (-414.475) * (-413.905) [-412.540] (-415.380) (-414.217) -- 0:00:24
626500 -- (-411.827) (-413.817) [-412.153] (-416.783) * [-412.702] (-413.140) (-416.828) (-410.863) -- 0:00:24
627000 -- (-418.979) (-412.762) [-416.693] (-414.871) * (-412.800) (-411.485) (-413.535) [-415.422] -- 0:00:24
627500 -- (-412.895) (-415.620) (-415.512) [-415.145] * (-411.705) [-414.171] (-412.136) (-413.951) -- 0:00:24
628000 -- [-414.136] (-415.192) (-418.637) (-410.480) * (-411.996) (-412.070) [-415.503] (-414.602) -- 0:00:24
628500 -- (-414.298) [-418.892] (-415.567) (-419.121) * (-411.492) [-408.920] (-414.029) (-411.822) -- 0:00:24
629000 -- (-416.751) (-415.229) (-413.998) [-414.754] * (-411.990) (-411.636) [-413.104] (-414.490) -- 0:00:24
629500 -- [-413.986] (-415.493) (-414.549) (-411.764) * [-409.246] (-412.164) (-412.521) (-420.330) -- 0:00:24
630000 -- (-413.825) (-411.542) (-417.308) [-414.326] * (-411.158) [-409.747] (-414.708) (-419.952) -- 0:00:24
Average standard deviation of split frequencies: 0.011828
630500 -- [-412.738] (-416.606) (-413.879) (-414.080) * (-411.981) (-412.144) (-416.276) [-418.667] -- 0:00:24
631000 -- (-415.473) (-417.811) [-417.311] (-414.395) * [-415.409] (-415.057) (-412.181) (-412.997) -- 0:00:23
631500 -- (-413.969) (-416.881) [-414.552] (-418.103) * (-413.180) (-413.735) [-413.823] (-416.089) -- 0:00:23
632000 -- (-416.443) (-414.812) [-414.371] (-418.095) * (-412.116) (-413.358) [-412.055] (-409.512) -- 0:00:23
632500 -- (-414.081) [-410.330] (-416.650) (-416.084) * (-412.218) [-412.370] (-414.098) (-413.391) -- 0:00:23
633000 -- (-413.823) (-415.730) (-414.399) [-414.841] * [-413.602] (-415.178) (-412.097) (-419.390) -- 0:00:23
633500 -- (-416.071) [-422.433] (-416.993) (-413.210) * (-415.215) (-411.920) (-412.987) [-412.458] -- 0:00:23
634000 -- (-417.154) [-419.211] (-413.998) (-413.282) * (-414.299) [-410.759] (-413.192) (-414.153) -- 0:00:23
634500 -- (-417.514) (-413.625) (-414.736) [-411.875] * [-415.708] (-412.747) (-415.047) (-417.640) -- 0:00:23
635000 -- (-419.623) [-413.882] (-418.450) (-418.347) * (-413.202) (-412.576) [-413.558] (-414.532) -- 0:00:23
Average standard deviation of split frequencies: 0.011772
635500 -- (-415.008) (-416.215) [-412.589] (-418.042) * (-413.721) [-418.424] (-413.667) (-416.249) -- 0:00:23
636000 -- (-415.050) (-418.047) [-410.394] (-415.073) * (-416.754) (-413.558) (-417.659) [-413.571] -- 0:00:23
636500 -- (-413.653) (-410.661) [-413.566] (-414.279) * (-413.808) (-412.903) [-416.920] (-413.153) -- 0:00:23
637000 -- (-413.012) [-416.600] (-420.425) (-412.290) * (-413.570) (-416.367) [-412.561] (-413.739) -- 0:00:23
637500 -- [-412.938] (-412.943) (-415.562) (-416.866) * (-411.279) [-418.631] (-411.102) (-421.335) -- 0:00:23
638000 -- (-413.701) (-412.205) [-413.935] (-412.172) * (-412.499) (-413.730) [-414.013] (-413.419) -- 0:00:23
638500 -- (-414.250) (-414.474) (-413.950) [-416.031] * [-412.176] (-413.698) (-413.110) (-415.760) -- 0:00:23
639000 -- (-416.074) (-414.891) (-411.640) [-411.836] * [-413.589] (-412.761) (-411.135) (-416.830) -- 0:00:23
639500 -- (-418.025) [-413.898] (-411.829) (-413.772) * [-410.148] (-414.877) (-410.394) (-414.017) -- 0:00:23
640000 -- (-413.324) (-411.850) [-412.570] (-412.986) * (-411.760) (-412.394) [-412.425] (-412.534) -- 0:00:23
Average standard deviation of split frequencies: 0.011129
640500 -- [-413.564] (-414.411) (-413.717) (-416.539) * [-411.429] (-411.222) (-416.451) (-413.019) -- 0:00:23
641000 -- (-418.051) (-414.231) [-412.611] (-415.264) * (-413.861) (-411.332) [-413.470] (-411.694) -- 0:00:23
641500 -- (-417.624) (-411.557) [-412.850] (-416.223) * (-413.057) (-413.891) (-415.655) [-416.781] -- 0:00:23
642000 -- [-415.227] (-412.133) (-412.556) (-415.588) * [-410.767] (-413.381) (-418.396) (-414.995) -- 0:00:23
642500 -- (-414.343) (-412.432) [-411.838] (-412.645) * (-413.219) (-411.974) [-413.277] (-413.507) -- 0:00:23
643000 -- [-415.140] (-420.595) (-413.379) (-414.516) * (-413.532) [-411.189] (-415.591) (-416.340) -- 0:00:23
643500 -- (-418.993) [-415.026] (-413.118) (-413.199) * [-412.434] (-411.578) (-415.161) (-412.860) -- 0:00:23
644000 -- (-415.952) (-416.720) [-411.606] (-412.446) * (-413.327) (-413.640) (-413.526) [-413.300] -- 0:00:23
644500 -- (-417.274) (-413.839) [-410.522] (-416.676) * (-414.130) [-413.096] (-414.252) (-413.782) -- 0:00:23
645000 -- (-416.057) (-412.452) [-411.100] (-409.174) * (-412.592) (-411.692) [-414.750] (-414.436) -- 0:00:23
Average standard deviation of split frequencies: 0.011083
645500 -- (-416.233) (-415.824) [-413.071] (-412.837) * [-409.608] (-412.082) (-416.166) (-412.432) -- 0:00:23
646000 -- (-412.701) (-416.581) (-414.521) [-413.945] * (-412.479) [-415.981] (-413.547) (-413.969) -- 0:00:23
646500 -- (-415.424) (-416.799) (-412.806) [-410.572] * (-412.989) (-412.999) (-417.862) [-412.566] -- 0:00:22
647000 -- [-414.977] (-416.263) (-413.391) (-413.561) * (-412.703) (-412.037) (-413.463) [-414.519] -- 0:00:22
647500 -- [-415.599] (-416.175) (-418.265) (-416.483) * (-414.457) [-410.697] (-412.784) (-412.097) -- 0:00:22
648000 -- (-413.841) (-414.127) (-414.031) [-410.715] * (-409.437) [-411.852] (-413.517) (-412.452) -- 0:00:22
648500 -- [-414.607] (-413.269) (-414.102) (-414.325) * [-409.727] (-412.302) (-415.741) (-412.656) -- 0:00:22
649000 -- (-418.190) (-415.651) (-410.411) [-412.952] * (-410.145) (-411.911) (-415.014) [-410.777] -- 0:00:22
649500 -- (-412.342) (-418.053) (-414.060) [-414.026] * [-414.183] (-414.897) (-419.643) (-414.947) -- 0:00:22
650000 -- (-415.629) (-420.491) (-415.577) [-412.879] * (-414.300) [-409.897] (-412.751) (-414.181) -- 0:00:22
Average standard deviation of split frequencies: 0.010867
650500 -- (-416.397) (-415.132) (-416.189) [-413.882] * (-412.725) [-413.027] (-411.550) (-414.043) -- 0:00:22
651000 -- (-413.656) (-415.252) (-413.927) [-413.996] * (-410.973) (-413.354) (-413.901) [-413.962] -- 0:00:22
651500 -- (-415.580) [-416.654] (-416.181) (-414.542) * (-417.421) [-412.643] (-414.922) (-414.343) -- 0:00:22
652000 -- [-416.072] (-416.858) (-411.891) (-413.990) * [-413.157] (-413.262) (-414.819) (-413.113) -- 0:00:22
652500 -- (-411.890) (-416.284) [-412.071] (-417.593) * (-412.950) [-410.042] (-415.986) (-416.578) -- 0:00:22
653000 -- (-412.141) (-412.844) (-413.564) [-412.440] * (-412.715) [-410.448] (-414.906) (-411.852) -- 0:00:22
653500 -- (-412.906) (-420.426) (-412.953) [-413.213] * [-413.308] (-415.514) (-417.400) (-415.956) -- 0:00:22
654000 -- (-414.567) (-412.663) [-410.002] (-414.110) * (-410.336) (-410.335) (-418.000) [-415.283] -- 0:00:22
654500 -- (-413.813) (-416.598) [-417.524] (-417.227) * (-412.576) [-410.832] (-415.439) (-414.991) -- 0:00:22
655000 -- (-413.235) (-415.857) [-412.685] (-414.418) * (-415.343) (-411.803) (-417.956) [-415.380] -- 0:00:22
Average standard deviation of split frequencies: 0.011667
655500 -- (-411.750) (-412.499) (-417.189) [-411.919] * (-412.314) [-410.294] (-413.783) (-411.692) -- 0:00:22
656000 -- (-412.164) (-414.455) [-413.747] (-419.758) * (-414.342) [-410.534] (-417.240) (-415.691) -- 0:00:22
656500 -- (-413.583) [-412.462] (-412.164) (-415.993) * [-414.037] (-414.267) (-420.517) (-413.987) -- 0:00:22
657000 -- (-412.679) (-411.106) (-412.707) [-413.271] * (-410.922) [-412.939] (-415.119) (-412.398) -- 0:00:22
657500 -- (-413.806) (-418.127) [-412.620] (-416.906) * [-413.647] (-411.000) (-415.884) (-415.117) -- 0:00:22
658000 -- (-415.551) [-413.578] (-411.511) (-416.761) * (-410.954) (-412.832) [-412.367] (-413.604) -- 0:00:22
658500 -- [-413.767] (-415.423) (-413.066) (-411.857) * (-412.059) (-412.767) (-413.870) [-415.278] -- 0:00:22
659000 -- (-414.285) (-412.074) [-412.683] (-411.691) * (-413.597) [-409.581] (-416.076) (-416.893) -- 0:00:22
659500 -- (-415.760) (-413.255) [-410.529] (-414.215) * (-421.036) (-413.234) [-412.381] (-411.353) -- 0:00:22
660000 -- (-417.302) [-413.561] (-411.925) (-416.582) * [-412.527] (-412.261) (-416.275) (-412.593) -- 0:00:22
Average standard deviation of split frequencies: 0.011836
660500 -- (-413.718) (-415.531) (-415.673) [-411.842] * (-415.310) (-411.348) [-414.488] (-413.132) -- 0:00:22
661000 -- (-413.922) (-411.657) (-413.393) [-413.512] * (-414.158) (-410.775) (-415.289) [-409.856] -- 0:00:22
661500 -- (-416.102) [-409.453] (-412.985) (-412.176) * [-414.312] (-416.993) (-414.424) (-412.475) -- 0:00:22
662000 -- (-416.648) (-410.780) [-414.815] (-414.396) * (-418.700) (-412.438) [-413.597] (-410.840) -- 0:00:21
662500 -- (-411.332) [-413.739] (-412.435) (-419.482) * (-414.518) (-410.530) [-413.732] (-412.244) -- 0:00:21
663000 -- (-412.566) (-412.374) (-411.442) [-418.070] * [-410.107] (-411.592) (-416.944) (-410.668) -- 0:00:21
663500 -- (-413.031) [-413.518] (-415.903) (-412.070) * (-415.221) (-410.680) (-415.904) [-411.840] -- 0:00:21
664000 -- [-410.977] (-410.396) (-413.308) (-418.614) * (-412.907) (-415.473) (-416.390) [-412.321] -- 0:00:21
664500 -- (-412.966) (-415.717) [-413.891] (-417.431) * [-414.049] (-412.776) (-415.080) (-414.515) -- 0:00:21
665000 -- (-413.719) [-415.037] (-416.943) (-413.851) * (-417.280) (-414.252) [-416.804] (-413.621) -- 0:00:21
Average standard deviation of split frequencies: 0.011492
665500 -- (-414.790) (-414.346) [-418.767] (-412.234) * (-417.578) (-416.762) (-411.737) [-411.722] -- 0:00:21
666000 -- [-414.838] (-411.229) (-413.759) (-412.898) * [-415.323] (-412.440) (-418.496) (-410.505) -- 0:00:21
666500 -- (-414.182) [-411.384] (-412.118) (-414.080) * [-413.257] (-413.449) (-415.504) (-418.231) -- 0:00:21
667000 -- (-414.180) [-415.320] (-416.207) (-415.269) * (-416.727) (-410.857) (-418.981) [-414.513] -- 0:00:21
667500 -- (-415.845) (-414.952) (-416.319) [-412.974] * (-413.579) (-410.692) [-413.859] (-420.489) -- 0:00:21
668000 -- (-413.633) (-414.211) [-412.523] (-415.488) * (-411.080) (-415.542) (-416.134) [-414.375] -- 0:00:21
668500 -- [-414.107] (-414.513) (-414.035) (-416.616) * (-414.317) [-411.847] (-415.604) (-418.285) -- 0:00:21
669000 -- (-412.492) (-412.632) [-412.390] (-413.805) * (-411.958) (-412.817) [-416.940] (-419.968) -- 0:00:21
669500 -- (-413.590) (-410.149) [-413.190] (-412.903) * (-413.839) [-411.035] (-414.958) (-413.025) -- 0:00:21
670000 -- (-412.934) [-414.457] (-415.652) (-413.540) * (-415.004) [-411.697] (-414.778) (-412.491) -- 0:00:21
Average standard deviation of split frequencies: 0.011577
670500 -- (-412.627) [-411.779] (-412.324) (-415.123) * (-413.852) (-413.227) (-416.046) [-413.315] -- 0:00:21
671000 -- (-415.442) [-415.086] (-415.121) (-414.698) * (-419.108) (-418.120) [-411.974] (-418.015) -- 0:00:21
671500 -- (-411.232) (-416.897) (-411.328) [-416.704] * (-415.099) [-415.855] (-415.173) (-418.333) -- 0:00:21
672000 -- (-411.440) (-417.699) [-412.638] (-416.000) * (-414.790) (-413.951) (-413.077) [-416.163] -- 0:00:21
672500 -- (-412.715) [-413.304] (-410.836) (-413.951) * (-411.938) (-415.020) [-413.261] (-414.652) -- 0:00:21
673000 -- [-411.455] (-415.577) (-413.130) (-414.637) * (-410.602) (-409.971) [-414.580] (-419.561) -- 0:00:21
673500 -- (-413.621) [-415.135] (-412.255) (-413.851) * (-412.706) [-410.401] (-410.009) (-414.494) -- 0:00:21
674000 -- (-414.768) (-419.496) [-409.520] (-415.545) * (-411.668) [-411.777] (-410.955) (-413.907) -- 0:00:21
674500 -- (-413.043) [-411.662] (-415.730) (-412.209) * [-410.956] (-412.045) (-416.959) (-415.798) -- 0:00:21
675000 -- [-414.171] (-415.784) (-411.463) (-415.575) * (-412.900) (-413.625) [-412.371] (-417.348) -- 0:00:21
Average standard deviation of split frequencies: 0.011814
675500 -- [-417.248] (-418.314) (-412.037) (-417.089) * [-411.456] (-412.331) (-415.820) (-416.243) -- 0:00:21
676000 -- (-414.355) [-412.966] (-415.231) (-410.586) * [-416.698] (-413.547) (-416.189) (-417.584) -- 0:00:21
676500 -- (-412.821) (-416.521) (-418.536) [-414.707] * (-413.603) [-416.007] (-417.875) (-414.094) -- 0:00:21
677000 -- (-413.611) (-413.942) (-418.301) [-413.883] * (-412.760) [-414.369] (-414.043) (-413.598) -- 0:00:20
677500 -- (-411.187) [-413.111] (-418.648) (-414.522) * [-413.391] (-411.158) (-415.522) (-416.511) -- 0:00:20
678000 -- [-413.075] (-414.649) (-420.712) (-416.240) * (-412.371) (-412.205) [-410.936] (-416.653) -- 0:00:20
678500 -- [-412.475] (-413.645) (-411.063) (-413.998) * (-415.870) [-414.158] (-418.378) (-413.233) -- 0:00:20
679000 -- (-407.744) [-412.044] (-414.220) (-411.687) * (-413.788) (-412.872) (-412.425) [-413.521] -- 0:00:20
679500 -- (-412.365) (-412.163) (-420.867) [-418.808] * (-415.771) [-410.726] (-414.515) (-410.916) -- 0:00:20
680000 -- (-411.631) [-411.107] (-418.105) (-417.521) * (-412.044) [-410.360] (-418.934) (-413.377) -- 0:00:20
Average standard deviation of split frequencies: 0.011038
680500 -- [-410.336] (-414.903) (-415.225) (-418.845) * (-413.304) (-415.230) (-417.183) [-412.098] -- 0:00:20
681000 -- (-410.249) [-410.265] (-415.491) (-420.258) * (-417.480) [-411.364] (-417.247) (-413.962) -- 0:00:20
681500 -- (-412.242) (-415.373) (-414.646) [-413.034] * (-418.245) (-419.927) (-411.714) [-414.016] -- 0:00:20
682000 -- (-412.696) (-413.250) (-413.589) [-415.589] * (-415.526) (-413.167) (-414.074) [-412.836] -- 0:00:20
682500 -- (-413.263) [-412.418] (-410.592) (-412.854) * (-414.191) [-413.093] (-409.218) (-413.002) -- 0:00:20
683000 -- (-416.750) (-417.479) [-412.748] (-415.799) * [-414.283] (-413.615) (-413.478) (-416.122) -- 0:00:20
683500 -- (-413.277) (-413.217) [-410.281] (-414.673) * (-417.859) [-412.541] (-412.811) (-413.534) -- 0:00:20
684000 -- [-416.733] (-415.913) (-412.682) (-412.013) * (-412.880) [-413.417] (-415.646) (-410.098) -- 0:00:20
684500 -- (-410.318) (-416.026) [-410.374] (-416.224) * (-414.829) (-412.470) (-414.614) [-413.168] -- 0:00:20
685000 -- (-414.238) [-417.504] (-412.925) (-412.361) * (-412.541) (-411.907) [-413.659] (-414.382) -- 0:00:20
Average standard deviation of split frequencies: 0.011424
685500 -- (-412.894) [-413.040] (-412.257) (-413.606) * [-412.525] (-415.144) (-414.597) (-409.381) -- 0:00:20
686000 -- (-415.911) [-410.948] (-413.367) (-415.822) * [-410.551] (-414.683) (-413.797) (-412.066) -- 0:00:20
686500 -- (-412.355) [-415.394] (-412.523) (-416.254) * [-410.677] (-415.856) (-415.931) (-414.800) -- 0:00:20
687000 -- [-418.293] (-413.575) (-410.213) (-413.976) * (-412.593) [-412.733] (-414.910) (-419.032) -- 0:00:20
687500 -- (-416.342) (-412.305) (-409.486) [-417.140] * [-414.413] (-413.644) (-415.719) (-414.769) -- 0:00:20
688000 -- (-411.572) (-414.190) (-413.026) [-416.382] * (-416.332) (-414.251) [-411.575] (-411.281) -- 0:00:20
688500 -- (-414.743) (-412.700) [-412.266] (-418.687) * (-412.211) [-414.099] (-420.155) (-420.039) -- 0:00:20
689000 -- (-415.358) (-414.356) (-413.214) [-411.929] * [-413.875] (-414.630) (-416.403) (-415.537) -- 0:00:20
689500 -- [-412.730] (-412.534) (-413.520) (-415.963) * [-410.288] (-412.833) (-412.624) (-411.297) -- 0:00:20
690000 -- [-411.333] (-417.908) (-417.650) (-415.135) * (-415.729) [-413.261] (-414.135) (-413.860) -- 0:00:20
Average standard deviation of split frequencies: 0.011239
690500 -- (-414.513) (-414.250) (-413.418) [-415.763] * (-414.781) (-413.550) (-413.090) [-413.315] -- 0:00:20
691000 -- (-413.857) (-413.988) (-414.563) [-417.126] * (-412.903) (-416.837) (-413.509) [-410.729] -- 0:00:20
691500 -- (-415.503) (-413.694) [-414.441] (-412.436) * [-414.661] (-417.076) (-412.236) (-412.498) -- 0:00:20
692000 -- (-414.207) [-414.512] (-416.446) (-417.006) * [-412.893] (-419.583) (-412.628) (-413.594) -- 0:00:20
692500 -- (-413.150) (-413.394) (-411.705) [-411.505] * [-415.887] (-417.376) (-413.129) (-412.307) -- 0:00:19
693000 -- (-413.027) [-415.125] (-416.335) (-411.022) * (-416.221) (-418.429) [-416.182] (-413.056) -- 0:00:19
693500 -- (-411.867) (-413.403) [-412.778] (-414.664) * (-414.409) (-416.190) [-411.930] (-411.553) -- 0:00:19
694000 -- [-411.019] (-414.473) (-415.375) (-411.136) * (-416.915) (-415.079) (-414.365) [-409.435] -- 0:00:19
694500 -- (-414.035) (-413.426) [-414.791] (-413.883) * (-413.237) [-413.056] (-415.043) (-410.860) -- 0:00:19
695000 -- (-413.152) [-413.562] (-415.695) (-417.688) * (-412.737) (-413.722) [-413.600] (-411.841) -- 0:00:19
Average standard deviation of split frequencies: 0.011557
695500 -- [-413.927] (-412.525) (-412.745) (-412.387) * [-415.829] (-417.605) (-418.876) (-415.533) -- 0:00:19
696000 -- (-416.809) (-417.048) [-412.121] (-414.435) * (-416.073) (-416.349) [-415.239] (-412.589) -- 0:00:19
696500 -- [-413.789] (-415.842) (-415.092) (-413.380) * (-414.148) [-414.018] (-414.624) (-411.517) -- 0:00:19
697000 -- (-415.216) [-416.656] (-413.533) (-411.840) * [-412.370] (-416.248) (-414.980) (-412.636) -- 0:00:19
697500 -- (-415.818) (-414.424) [-415.354] (-413.252) * [-415.852] (-414.554) (-412.180) (-412.656) -- 0:00:19
698000 -- [-410.791] (-411.832) (-415.881) (-413.661) * (-419.419) (-413.329) [-412.614] (-411.362) -- 0:00:19
698500 -- [-412.479] (-416.547) (-413.852) (-414.689) * [-417.815] (-411.839) (-413.047) (-410.323) -- 0:00:19
699000 -- [-412.942] (-415.642) (-413.831) (-415.325) * (-415.707) (-416.101) (-411.091) [-413.415] -- 0:00:19
699500 -- (-410.178) (-415.989) (-410.919) [-413.345] * (-413.850) (-415.897) [-415.429] (-412.892) -- 0:00:19
700000 -- (-411.992) [-412.453] (-411.437) (-413.758) * (-418.251) (-414.596) [-412.958] (-417.456) -- 0:00:19
Average standard deviation of split frequencies: 0.011393
700500 -- (-417.137) [-413.850] (-412.819) (-416.549) * (-412.619) [-410.019] (-414.018) (-416.885) -- 0:00:19
701000 -- (-415.792) (-415.091) (-412.574) [-410.956] * (-416.903) [-409.818] (-410.664) (-411.792) -- 0:00:19
701500 -- (-412.830) (-412.939) (-413.934) [-410.539] * [-414.126] (-414.537) (-417.063) (-412.836) -- 0:00:19
702000 -- (-413.397) (-418.409) (-412.588) [-412.150] * (-413.334) (-412.871) (-413.547) [-414.611] -- 0:00:19
702500 -- (-410.669) (-414.192) (-414.026) [-413.288] * (-415.623) (-412.497) (-412.699) [-412.278] -- 0:00:19
703000 -- (-414.352) (-417.881) [-415.697] (-422.720) * (-413.398) (-410.763) (-414.162) [-410.944] -- 0:00:19
703500 -- [-412.189] (-413.501) (-413.960) (-412.362) * (-415.002) (-415.979) (-415.834) [-413.751] -- 0:00:19
704000 -- (-416.366) (-416.100) [-411.674] (-415.677) * (-413.568) [-416.086] (-414.369) (-415.064) -- 0:00:19
704500 -- (-410.493) (-410.392) (-411.357) [-412.853] * (-417.625) (-416.302) [-413.793] (-412.716) -- 0:00:19
705000 -- (-415.731) (-412.359) (-412.016) [-412.913] * (-411.950) (-415.998) (-412.627) [-413.178] -- 0:00:19
Average standard deviation of split frequencies: 0.011885
705500 -- (-412.671) (-410.381) (-413.134) [-418.686] * (-418.628) [-416.864] (-411.528) (-411.827) -- 0:00:19
706000 -- (-417.221) [-411.656] (-415.408) (-416.497) * (-416.885) [-414.582] (-411.379) (-414.243) -- 0:00:19
706500 -- [-412.718] (-413.148) (-411.780) (-415.236) * (-413.058) (-419.519) [-413.539] (-411.581) -- 0:00:19
707000 -- [-413.080] (-411.047) (-415.388) (-412.002) * [-414.725] (-411.219) (-415.616) (-411.973) -- 0:00:19
707500 -- (-414.779) [-413.875] (-416.116) (-415.585) * (-411.677) (-412.095) (-411.961) [-413.957] -- 0:00:19
708000 -- (-420.012) [-413.317] (-415.782) (-411.709) * (-413.656) (-414.006) [-411.537] (-419.654) -- 0:00:18
708500 -- [-415.899] (-411.283) (-416.012) (-413.089) * (-413.762) (-416.861) (-411.574) [-413.675] -- 0:00:18
709000 -- (-415.900) [-411.261] (-413.851) (-415.093) * (-413.110) (-416.918) (-409.856) [-412.780] -- 0:00:18
709500 -- (-412.439) (-411.740) (-415.552) [-416.421] * (-413.534) (-414.604) (-415.186) [-412.271] -- 0:00:18
710000 -- (-417.258) [-412.272] (-415.112) (-415.393) * [-411.548] (-414.647) (-416.570) (-416.338) -- 0:00:18
Average standard deviation of split frequencies: 0.011763
710500 -- (-414.805) (-416.501) (-419.520) [-412.525] * [-410.745] (-421.983) (-413.830) (-413.077) -- 0:00:18
711000 -- [-416.245] (-411.555) (-413.818) (-416.068) * (-414.031) (-413.857) [-411.559] (-416.685) -- 0:00:18
711500 -- (-416.018) (-414.838) [-418.374] (-421.102) * (-411.226) (-416.684) (-411.517) [-413.069] -- 0:00:18
712000 -- [-412.565] (-412.953) (-413.106) (-413.719) * (-411.238) [-418.067] (-412.059) (-414.895) -- 0:00:18
712500 -- (-415.287) (-415.275) [-416.152] (-413.029) * (-415.899) [-414.892] (-415.765) (-413.043) -- 0:00:18
713000 -- (-414.587) (-416.847) (-412.564) [-413.843] * (-415.156) (-415.799) (-413.748) [-415.430] -- 0:00:18
713500 -- [-413.113] (-414.482) (-414.807) (-411.260) * (-411.603) [-414.803] (-417.715) (-418.411) -- 0:00:18
714000 -- (-413.196) [-414.229] (-410.717) (-413.854) * (-414.977) (-416.297) [-415.116] (-412.592) -- 0:00:18
714500 -- (-412.767) [-414.956] (-410.436) (-418.417) * [-409.622] (-412.709) (-418.409) (-410.709) -- 0:00:18
715000 -- [-412.492] (-417.382) (-413.944) (-413.272) * (-410.968) [-416.095] (-418.938) (-410.295) -- 0:00:18
Average standard deviation of split frequencies: 0.011851
715500 -- (-415.435) (-416.078) [-415.153] (-417.338) * (-416.277) (-413.085) (-413.598) [-415.233] -- 0:00:18
716000 -- (-416.627) [-414.570] (-412.146) (-413.008) * (-410.809) (-413.515) (-414.625) [-411.925] -- 0:00:18
716500 -- (-414.162) [-414.473] (-411.643) (-415.945) * (-411.381) [-410.097] (-414.458) (-412.697) -- 0:00:18
717000 -- [-413.223] (-415.330) (-411.389) (-413.261) * (-413.618) [-413.498] (-412.781) (-414.932) -- 0:00:18
717500 -- (-413.633) (-412.961) (-410.726) [-412.582] * (-411.057) [-413.837] (-415.957) (-413.455) -- 0:00:18
718000 -- (-412.319) (-415.305) (-418.830) [-413.503] * [-411.285] (-417.459) (-414.894) (-410.859) -- 0:00:18
718500 -- (-411.822) (-416.088) [-417.263] (-412.295) * (-409.254) (-413.903) (-414.387) [-418.041] -- 0:00:18
719000 -- [-411.059] (-413.321) (-416.838) (-411.071) * (-414.181) (-413.629) [-413.461] (-420.619) -- 0:00:18
719500 -- (-415.214) [-414.926] (-413.398) (-416.556) * (-411.323) [-410.749] (-416.730) (-412.621) -- 0:00:18
720000 -- (-409.798) [-414.669] (-414.861) (-411.815) * (-414.135) (-412.042) (-416.423) [-414.903] -- 0:00:18
Average standard deviation of split frequencies: 0.011897
720500 -- (-413.373) [-411.652] (-416.126) (-417.173) * (-415.326) [-412.019] (-416.267) (-414.686) -- 0:00:18
721000 -- (-415.363) [-411.079] (-419.410) (-415.827) * [-412.255] (-410.151) (-418.431) (-413.948) -- 0:00:18
721500 -- (-413.746) (-415.803) (-413.139) [-415.670] * [-413.293] (-413.432) (-420.464) (-414.535) -- 0:00:18
722000 -- (-411.514) [-413.056] (-412.380) (-414.555) * (-413.066) [-412.642] (-413.344) (-413.329) -- 0:00:18
722500 -- (-411.010) (-412.896) [-409.679] (-412.242) * (-409.719) [-411.938] (-413.722) (-413.879) -- 0:00:18
723000 -- (-412.524) (-416.392) [-412.026] (-415.189) * (-413.874) (-411.912) (-417.413) [-411.693] -- 0:00:18
723500 -- [-414.893] (-413.390) (-414.873) (-414.447) * (-415.041) (-411.611) (-411.960) [-413.770] -- 0:00:17
724000 -- [-410.878] (-410.917) (-411.354) (-414.005) * (-412.206) (-412.855) (-415.481) [-411.703] -- 0:00:17
724500 -- (-413.944) (-413.203) (-412.279) [-411.097] * [-413.940] (-412.391) (-413.422) (-414.840) -- 0:00:17
725000 -- (-415.360) (-410.259) [-412.223] (-412.846) * [-412.562] (-413.722) (-416.675) (-411.432) -- 0:00:17
Average standard deviation of split frequencies: 0.011850
725500 -- (-413.241) (-412.246) [-409.829] (-413.174) * (-410.160) (-411.077) (-414.846) [-411.707] -- 0:00:17
726000 -- (-411.445) [-411.684] (-411.929) (-416.702) * [-411.897] (-413.105) (-415.916) (-415.482) -- 0:00:17
726500 -- [-413.313] (-414.644) (-414.176) (-413.706) * (-411.169) (-416.897) [-412.410] (-413.089) -- 0:00:17
727000 -- (-416.567) (-413.393) (-410.593) [-413.167] * [-411.055] (-412.863) (-416.714) (-415.332) -- 0:00:17
727500 -- [-417.746] (-411.828) (-419.751) (-415.325) * (-410.387) [-411.097] (-411.926) (-424.482) -- 0:00:17
728000 -- (-411.335) [-410.216] (-413.147) (-417.481) * (-414.814) [-411.141] (-415.359) (-413.473) -- 0:00:17
728500 -- [-419.618] (-410.823) (-414.808) (-410.840) * (-411.209) [-414.303] (-415.185) (-414.538) -- 0:00:17
729000 -- [-413.658] (-412.281) (-413.752) (-413.693) * [-412.172] (-411.468) (-415.409) (-412.644) -- 0:00:17
729500 -- (-422.562) [-414.149] (-413.172) (-414.927) * (-414.710) (-415.218) [-413.678] (-414.007) -- 0:00:17
730000 -- (-415.520) [-414.544] (-411.939) (-415.993) * (-415.213) (-412.452) (-412.189) [-412.625] -- 0:00:17
Average standard deviation of split frequencies: 0.011573
730500 -- [-413.393] (-412.961) (-414.598) (-417.783) * (-414.249) (-415.633) [-416.113] (-413.724) -- 0:00:17
731000 -- (-417.240) (-413.611) [-416.699] (-417.732) * (-416.735) (-415.833) [-414.079] (-411.372) -- 0:00:17
731500 -- (-415.825) [-412.544] (-416.311) (-412.026) * [-412.016] (-414.391) (-415.330) (-412.710) -- 0:00:17
732000 -- (-413.752) (-411.918) (-413.569) [-411.726] * (-416.708) (-413.363) [-417.178] (-415.950) -- 0:00:17
732500 -- (-416.174) [-413.877] (-412.682) (-412.069) * (-418.370) (-411.559) [-411.377] (-413.006) -- 0:00:17
733000 -- (-413.604) (-416.280) [-410.854] (-411.912) * [-417.124] (-413.417) (-414.757) (-410.403) -- 0:00:17
733500 -- (-412.290) (-414.611) [-413.100] (-413.795) * (-413.140) (-413.664) (-416.187) [-410.730] -- 0:00:17
734000 -- (-414.052) [-413.410] (-414.067) (-411.462) * [-412.845] (-412.647) (-415.752) (-414.320) -- 0:00:17
734500 -- (-413.157) [-414.051] (-409.753) (-414.362) * (-413.149) (-411.128) (-421.003) [-411.588] -- 0:00:17
735000 -- (-414.007) [-410.326] (-409.884) (-415.142) * (-412.444) [-411.249] (-416.167) (-414.589) -- 0:00:17
Average standard deviation of split frequencies: 0.011889
735500 -- (-413.536) (-411.753) (-410.868) [-410.375] * (-414.638) (-409.751) [-414.135] (-416.155) -- 0:00:17
736000 -- (-414.887) (-410.804) (-415.726) [-411.693] * (-420.705) (-412.140) [-415.935] (-417.740) -- 0:00:17
736500 -- (-412.831) (-414.304) (-412.068) [-410.309] * (-414.290) (-410.803) [-417.351] (-415.377) -- 0:00:17
737000 -- [-416.771] (-412.564) (-412.497) (-409.943) * (-413.946) (-413.655) (-415.816) [-411.259] -- 0:00:17
737500 -- (-416.971) (-413.683) (-414.171) [-412.815] * (-415.365) (-412.446) [-416.477] (-412.343) -- 0:00:17
738000 -- (-414.047) (-413.274) (-414.113) [-414.236] * [-411.413] (-412.193) (-414.906) (-411.237) -- 0:00:17
738500 -- (-412.950) [-413.167] (-412.653) (-412.544) * (-412.319) [-412.695] (-413.389) (-414.558) -- 0:00:16
739000 -- (-411.407) (-414.798) [-412.382] (-417.829) * (-415.619) (-413.732) [-413.357] (-412.879) -- 0:00:16
739500 -- (-418.113) [-415.155] (-416.964) (-414.928) * (-413.994) (-413.882) (-411.870) [-411.002] -- 0:00:16
740000 -- (-415.228) [-415.998] (-415.606) (-416.051) * (-412.867) (-414.586) [-414.387] (-411.482) -- 0:00:16
Average standard deviation of split frequencies: 0.012172
740500 -- (-413.980) [-412.922] (-414.047) (-415.068) * [-410.664] (-419.361) (-410.887) (-415.677) -- 0:00:16
741000 -- (-419.441) (-417.352) (-415.187) [-413.201] * (-413.127) (-411.409) [-413.733] (-410.305) -- 0:00:16
741500 -- (-423.334) (-419.128) (-411.393) [-412.315] * (-415.376) (-418.501) (-416.204) [-412.083] -- 0:00:16
742000 -- (-415.665) (-415.096) (-414.377) [-416.474] * (-414.862) (-414.227) [-413.235] (-413.519) -- 0:00:16
742500 -- (-415.702) [-411.523] (-413.462) (-416.723) * [-412.740] (-413.533) (-414.870) (-411.605) -- 0:00:16
743000 -- (-411.620) [-411.161] (-412.706) (-415.098) * (-412.863) [-415.731] (-413.962) (-411.400) -- 0:00:16
743500 -- (-412.948) (-413.656) [-412.694] (-411.545) * (-411.681) (-417.581) [-418.149] (-413.425) -- 0:00:16
744000 -- [-413.192] (-412.465) (-413.048) (-411.882) * (-411.801) (-419.521) [-415.112] (-413.428) -- 0:00:16
744500 -- (-412.590) (-410.410) [-410.424] (-412.891) * (-413.780) (-415.781) (-411.092) [-413.778] -- 0:00:16
745000 -- (-413.445) (-412.948) [-414.266] (-410.593) * (-412.822) (-417.320) (-414.078) [-413.512] -- 0:00:16
Average standard deviation of split frequencies: 0.011888
745500 -- (-412.841) [-410.765] (-414.555) (-412.556) * (-412.166) (-414.542) [-414.973] (-412.819) -- 0:00:16
746000 -- (-412.749) (-411.884) [-418.851] (-416.529) * [-413.452] (-415.828) (-415.597) (-416.015) -- 0:00:16
746500 -- [-411.876] (-411.313) (-416.970) (-417.845) * (-413.362) (-413.533) (-413.544) [-410.485] -- 0:00:16
747000 -- (-418.795) (-412.162) (-414.455) [-413.972] * [-411.917] (-415.106) (-416.482) (-412.197) -- 0:00:16
747500 -- [-414.017] (-414.272) (-414.780) (-421.614) * (-412.612) (-417.834) [-418.326] (-411.584) -- 0:00:16
748000 -- [-412.018] (-414.128) (-415.689) (-415.316) * (-411.686) (-414.664) (-418.816) [-411.547] -- 0:00:16
748500 -- (-412.231) (-411.715) (-413.611) [-412.840] * (-414.556) (-416.861) [-411.838] (-423.008) -- 0:00:16
749000 -- [-411.383] (-412.075) (-413.801) (-415.617) * [-411.121] (-414.288) (-412.812) (-413.204) -- 0:00:16
749500 -- (-409.220) (-416.550) [-415.070] (-415.418) * (-413.085) [-415.176] (-414.861) (-414.035) -- 0:00:16
750000 -- [-411.977] (-415.189) (-412.551) (-413.215) * (-411.542) (-414.533) (-412.397) [-412.614] -- 0:00:16
Average standard deviation of split frequencies: 0.011892
750500 -- (-418.430) (-415.148) [-411.176] (-412.038) * (-420.304) (-415.236) (-413.935) [-413.558] -- 0:00:16
751000 -- (-415.375) (-411.619) (-412.990) [-412.707] * (-417.193) (-415.635) [-414.149] (-413.604) -- 0:00:16
751500 -- [-413.501] (-411.177) (-416.392) (-415.335) * (-413.674) (-419.111) (-413.491) [-415.270] -- 0:00:16
752000 -- (-410.215) (-410.031) [-412.768] (-409.993) * (-411.934) (-413.030) (-418.474) [-412.870] -- 0:00:16
752500 -- (-414.842) [-410.276] (-416.042) (-412.083) * (-418.214) (-416.584) (-415.121) [-413.862] -- 0:00:16
753000 -- [-412.846] (-413.211) (-411.152) (-411.498) * (-416.652) (-412.819) [-410.568] (-410.286) -- 0:00:16
753500 -- (-413.469) (-412.096) [-413.938] (-416.177) * [-411.287] (-413.150) (-411.438) (-412.321) -- 0:00:16
754000 -- [-412.246] (-414.276) (-413.972) (-410.748) * (-413.136) [-410.173] (-419.960) (-419.066) -- 0:00:15
754500 -- [-412.388] (-410.579) (-412.771) (-411.208) * (-412.399) (-416.556) (-415.277) [-411.638] -- 0:00:15
755000 -- [-412.981] (-413.313) (-416.942) (-416.026) * [-411.310] (-416.581) (-411.998) (-416.799) -- 0:00:15
Average standard deviation of split frequencies: 0.012120
755500 -- (-412.360) (-413.251) (-420.487) [-412.386] * (-410.918) (-411.647) (-414.545) [-412.955] -- 0:00:15
756000 -- (-412.028) [-413.866] (-422.313) (-416.807) * (-411.781) [-412.216] (-412.723) (-412.716) -- 0:00:15
756500 -- (-412.697) (-414.803) (-411.486) [-410.695] * (-412.524) (-414.027) [-412.675] (-414.101) -- 0:00:15
757000 -- (-413.907) [-414.840] (-412.010) (-418.135) * (-413.801) [-410.633] (-413.342) (-413.143) -- 0:00:15
757500 -- (-413.763) (-411.053) [-411.766] (-412.687) * (-412.773) (-417.777) [-412.475] (-413.372) -- 0:00:15
758000 -- (-414.238) (-414.470) (-411.068) [-410.911] * (-413.175) [-411.515] (-411.956) (-413.392) -- 0:00:15
758500 -- (-412.025) (-413.356) [-411.301] (-413.606) * (-410.218) [-413.860] (-415.032) (-413.340) -- 0:00:15
759000 -- (-416.130) (-414.494) (-412.738) [-414.256] * (-414.506) [-414.959] (-414.462) (-414.967) -- 0:00:15
759500 -- [-414.143] (-413.144) (-411.737) (-411.263) * [-415.061] (-409.512) (-412.310) (-411.283) -- 0:00:15
760000 -- (-413.230) (-414.476) (-419.186) [-413.430] * (-419.342) (-411.019) [-411.426] (-414.251) -- 0:00:15
Average standard deviation of split frequencies: 0.011775
760500 -- (-411.611) (-423.190) [-413.161] (-411.863) * [-414.977] (-413.885) (-417.054) (-416.300) -- 0:00:15
761000 -- (-412.762) (-411.225) (-411.049) [-412.868] * [-417.394] (-410.629) (-417.414) (-410.796) -- 0:00:15
761500 -- (-414.909) [-413.849] (-415.762) (-412.366) * (-411.488) (-413.400) [-413.332] (-412.577) -- 0:00:15
762000 -- (-416.096) (-414.742) [-417.267] (-413.474) * (-415.137) (-420.361) [-414.931] (-414.116) -- 0:00:15
762500 -- (-413.150) [-411.275] (-413.527) (-413.901) * (-414.979) (-417.483) [-413.292] (-412.580) -- 0:00:15
763000 -- (-414.722) [-410.142] (-416.355) (-416.518) * (-412.066) (-416.428) [-414.008] (-414.761) -- 0:00:15
763500 -- (-413.758) (-411.738) (-414.267) [-417.864] * (-412.990) [-414.576] (-414.779) (-417.801) -- 0:00:15
764000 -- (-415.259) [-411.769] (-419.748) (-412.481) * (-413.078) [-413.137] (-414.859) (-414.540) -- 0:00:15
764500 -- [-412.883] (-413.526) (-414.847) (-411.610) * [-410.387] (-412.222) (-413.780) (-415.746) -- 0:00:15
765000 -- [-417.848] (-412.168) (-414.729) (-411.507) * (-412.837) [-412.374] (-411.338) (-413.909) -- 0:00:15
Average standard deviation of split frequencies: 0.011801
765500 -- [-411.544] (-413.224) (-415.763) (-414.626) * (-412.531) (-413.921) [-416.550] (-413.562) -- 0:00:15
766000 -- [-411.041] (-414.158) (-415.751) (-414.121) * (-419.421) (-412.651) [-418.656] (-414.076) -- 0:00:15
766500 -- [-415.587] (-417.625) (-413.286) (-416.046) * (-411.774) [-411.357] (-414.696) (-415.591) -- 0:00:15
767000 -- (-410.265) [-414.045] (-417.368) (-412.280) * [-412.810] (-414.772) (-414.940) (-413.442) -- 0:00:15
767500 -- (-413.551) (-412.003) (-418.242) [-412.053] * [-416.472] (-417.062) (-415.692) (-413.647) -- 0:00:15
768000 -- (-411.949) (-410.512) (-422.556) [-410.082] * [-413.265] (-414.417) (-419.435) (-412.302) -- 0:00:15
768500 -- (-414.498) (-413.486) (-420.887) [-412.566] * (-412.241) [-415.422] (-417.111) (-417.653) -- 0:00:15
769000 -- [-414.360] (-414.756) (-413.184) (-412.148) * [-412.868] (-415.350) (-415.526) (-411.548) -- 0:00:15
769500 -- [-412.075] (-418.424) (-416.308) (-413.320) * (-416.886) [-415.671] (-415.535) (-411.303) -- 0:00:14
770000 -- (-412.539) [-412.380] (-414.298) (-419.917) * [-413.422] (-413.483) (-415.841) (-411.928) -- 0:00:14
Average standard deviation of split frequencies: 0.011478
770500 -- (-412.563) [-412.163] (-412.380) (-410.692) * (-414.976) [-415.064] (-412.539) (-412.873) -- 0:00:14
771000 -- [-413.166] (-421.561) (-417.538) (-410.724) * [-412.158] (-415.467) (-413.044) (-413.899) -- 0:00:14
771500 -- (-414.645) (-412.501) [-415.607] (-413.327) * (-410.553) (-413.773) (-415.507) [-412.339] -- 0:00:14
772000 -- (-412.780) (-412.646) [-414.420] (-415.025) * (-413.977) (-417.057) (-412.715) [-413.293] -- 0:00:14
772500 -- [-410.513] (-415.341) (-415.540) (-412.317) * (-411.365) [-411.917] (-414.434) (-413.608) -- 0:00:14
773000 -- [-411.976] (-410.962) (-414.046) (-417.187) * [-415.473] (-411.596) (-418.217) (-414.786) -- 0:00:14
773500 -- (-410.620) [-411.525] (-416.728) (-412.380) * (-413.675) [-412.521] (-417.018) (-418.602) -- 0:00:14
774000 -- [-409.904] (-415.039) (-410.033) (-410.314) * (-414.046) (-410.144) [-412.061] (-415.609) -- 0:00:14
774500 -- [-409.072] (-416.569) (-413.633) (-414.556) * [-414.266] (-413.290) (-413.248) (-413.141) -- 0:00:14
775000 -- [-411.328] (-415.302) (-413.930) (-413.936) * (-417.118) [-414.845] (-417.033) (-412.867) -- 0:00:14
Average standard deviation of split frequencies: 0.011471
775500 -- (-412.834) (-413.580) [-412.478] (-411.664) * (-417.631) (-415.236) (-414.846) [-411.451] -- 0:00:14
776000 -- (-412.689) (-417.762) [-416.137] (-411.845) * (-412.324) (-416.786) [-417.511] (-411.847) -- 0:00:14
776500 -- (-415.056) (-419.239) (-414.587) [-415.422] * (-414.746) (-412.490) [-414.106] (-410.712) -- 0:00:14
777000 -- (-416.782) [-417.641] (-413.582) (-412.735) * (-414.970) [-413.926] (-413.193) (-415.763) -- 0:00:14
777500 -- (-413.673) [-418.387] (-411.956) (-417.566) * [-412.738] (-417.495) (-411.176) (-416.561) -- 0:00:14
778000 -- (-412.403) (-415.365) [-409.900] (-413.876) * (-409.432) (-415.680) (-414.825) [-416.505] -- 0:00:14
778500 -- (-411.675) (-416.995) (-413.992) [-412.437] * (-411.146) (-414.614) (-413.987) [-413.132] -- 0:00:14
779000 -- (-415.519) (-416.981) (-417.393) [-414.186] * [-411.636] (-417.718) (-416.997) (-413.681) -- 0:00:14
779500 -- (-411.580) (-417.428) (-414.330) [-412.006] * [-414.998] (-417.837) (-414.953) (-411.751) -- 0:00:14
780000 -- (-411.419) (-418.408) [-411.444] (-416.497) * (-412.299) (-414.579) (-414.138) [-414.111] -- 0:00:14
Average standard deviation of split frequencies: 0.011864
780500 -- (-412.006) [-422.751] (-417.876) (-412.709) * (-414.076) (-418.458) [-412.917] (-418.899) -- 0:00:14
781000 -- [-409.889] (-420.423) (-412.225) (-412.592) * [-415.978] (-416.903) (-415.176) (-414.690) -- 0:00:14
781500 -- (-414.042) (-417.614) [-409.527] (-411.161) * (-413.475) [-415.820] (-412.669) (-412.296) -- 0:00:14
782000 -- [-418.334] (-415.069) (-416.095) (-414.783) * (-414.141) (-413.958) (-413.122) [-415.032] -- 0:00:14
782500 -- [-414.002] (-422.323) (-414.790) (-412.778) * (-416.043) [-416.850] (-422.600) (-416.831) -- 0:00:14
783000 -- [-414.190] (-417.008) (-412.928) (-410.904) * (-412.075) [-418.486] (-411.832) (-416.239) -- 0:00:14
783500 -- [-412.483] (-413.722) (-412.490) (-418.503) * [-412.759] (-415.040) (-417.618) (-411.886) -- 0:00:14
784000 -- [-414.929] (-415.005) (-410.026) (-413.990) * (-412.457) [-415.732] (-415.665) (-416.330) -- 0:00:14
784500 -- (-417.566) (-415.739) [-416.153] (-415.510) * [-413.120] (-420.218) (-415.757) (-415.406) -- 0:00:14
785000 -- (-419.883) [-413.083] (-413.388) (-413.820) * (-410.890) (-415.119) (-411.608) [-414.103] -- 0:00:13
Average standard deviation of split frequencies: 0.011678
785500 -- [-414.152] (-417.888) (-413.771) (-413.135) * (-412.580) (-423.335) (-413.640) [-413.797] -- 0:00:13
786000 -- (-414.328) [-415.407] (-415.208) (-413.979) * [-411.706] (-416.157) (-411.937) (-416.296) -- 0:00:13
786500 -- [-412.250] (-414.649) (-415.716) (-414.423) * (-411.101) [-416.499] (-417.697) (-413.274) -- 0:00:13
787000 -- [-412.794] (-415.193) (-413.418) (-413.402) * [-412.431] (-416.912) (-416.810) (-412.549) -- 0:00:13
787500 -- [-412.204] (-420.184) (-418.943) (-419.401) * (-415.286) (-415.823) (-415.695) [-413.358] -- 0:00:13
788000 -- (-414.301) (-419.998) (-414.863) [-411.570] * (-414.687) (-413.353) (-416.192) [-412.124] -- 0:00:13
788500 -- (-414.333) (-412.274) [-414.809] (-412.481) * (-414.522) [-414.352] (-416.062) (-414.198) -- 0:00:13
789000 -- (-415.490) (-411.687) [-417.855] (-414.513) * [-415.668] (-421.739) (-415.299) (-414.807) -- 0:00:13
789500 -- [-412.798] (-416.940) (-414.627) (-414.588) * (-412.218) (-415.905) (-417.836) [-411.013] -- 0:00:13
790000 -- (-414.198) (-414.278) [-411.949] (-413.533) * (-410.700) (-415.884) (-420.429) [-410.503] -- 0:00:13
Average standard deviation of split frequencies: 0.011468
790500 -- (-411.930) (-416.133) [-412.869] (-412.434) * [-415.046] (-413.512) (-415.175) (-413.523) -- 0:00:13
791000 -- (-415.463) [-410.800] (-413.646) (-412.940) * (-413.883) (-416.640) (-414.637) [-411.089] -- 0:00:13
791500 -- [-415.311] (-413.746) (-413.099) (-409.384) * (-415.297) (-417.916) (-418.507) [-410.952] -- 0:00:13
792000 -- (-411.770) (-414.622) [-409.857] (-415.381) * (-413.505) (-413.598) (-416.375) [-411.382] -- 0:00:13
792500 -- (-414.208) [-410.981] (-417.483) (-410.325) * (-412.753) (-412.954) [-413.426] (-411.437) -- 0:00:13
793000 -- (-413.712) (-412.469) [-412.210] (-413.875) * (-411.878) (-415.117) (-413.636) [-414.778] -- 0:00:13
793500 -- (-413.942) [-411.901] (-409.771) (-413.154) * (-412.566) (-415.275) (-412.817) [-413.856] -- 0:00:13
794000 -- (-416.696) (-420.727) [-414.679] (-415.450) * (-414.122) [-413.197] (-415.597) (-412.139) -- 0:00:13
794500 -- (-415.714) [-416.628] (-412.666) (-410.120) * (-411.977) (-417.584) [-411.990] (-417.694) -- 0:00:13
795000 -- (-412.615) (-416.783) [-414.150] (-412.329) * (-413.970) [-412.247] (-414.452) (-414.534) -- 0:00:13
Average standard deviation of split frequencies: 0.010834
795500 -- (-413.098) (-412.756) (-414.899) [-412.254] * (-416.431) (-412.215) [-412.435] (-409.730) -- 0:00:13
796000 -- (-416.509) (-411.488) [-409.804] (-413.991) * (-418.128) (-413.130) [-413.551] (-413.777) -- 0:00:13
796500 -- (-411.587) (-413.840) [-413.049] (-411.873) * (-412.860) [-411.375] (-411.816) (-415.664) -- 0:00:13
797000 -- [-412.064] (-413.110) (-411.728) (-422.188) * [-416.824] (-421.249) (-416.445) (-413.179) -- 0:00:13
797500 -- (-418.895) (-416.122) [-410.371] (-416.321) * (-418.253) (-411.951) (-413.317) [-417.719] -- 0:00:13
798000 -- (-428.348) (-414.247) [-411.615] (-414.994) * (-418.181) [-413.255] (-421.821) (-413.697) -- 0:00:13
798500 -- (-418.698) (-416.616) [-413.335] (-416.159) * [-416.792] (-417.679) (-417.331) (-413.470) -- 0:00:13
799000 -- (-412.613) (-414.886) (-419.104) [-411.320] * [-415.941] (-412.529) (-418.646) (-414.615) -- 0:00:13
799500 -- [-416.301] (-414.180) (-413.630) (-417.111) * [-413.989] (-411.121) (-411.734) (-415.738) -- 0:00:13
800000 -- (-418.566) [-413.977] (-410.574) (-417.177) * (-414.530) [-412.349] (-415.331) (-418.030) -- 0:00:12
Average standard deviation of split frequencies: 0.010909
800500 -- (-415.089) (-412.528) [-411.296] (-410.984) * (-412.858) (-412.242) (-416.120) [-415.036] -- 0:00:12
801000 -- [-416.249] (-415.076) (-412.355) (-412.569) * (-416.416) (-411.974) (-417.085) [-411.850] -- 0:00:12
801500 -- [-413.679] (-410.991) (-411.424) (-414.393) * (-412.729) [-409.102] (-412.227) (-415.528) -- 0:00:12
802000 -- (-410.985) (-412.744) (-414.960) [-414.245] * (-413.208) [-411.602] (-413.173) (-416.569) -- 0:00:12
802500 -- [-414.664] (-413.275) (-416.535) (-413.259) * (-412.568) (-410.922) (-414.369) [-414.629] -- 0:00:12
803000 -- (-412.897) (-415.612) (-412.516) [-410.482] * (-412.713) [-413.710] (-418.299) (-414.125) -- 0:00:12
803500 -- [-412.365] (-412.849) (-414.966) (-411.884) * (-413.428) (-412.597) [-412.793] (-413.748) -- 0:00:12
804000 -- (-415.500) (-412.224) [-413.853] (-412.500) * (-414.268) [-412.674] (-411.593) (-411.168) -- 0:00:12
804500 -- (-413.435) (-415.093) [-410.743] (-413.016) * (-412.431) [-413.932] (-414.040) (-414.399) -- 0:00:12
805000 -- [-414.014] (-413.252) (-414.343) (-413.880) * (-413.679) (-412.651) (-414.775) [-416.618] -- 0:00:12
Average standard deviation of split frequencies: 0.010975
805500 -- [-415.029] (-411.983) (-414.751) (-414.078) * [-411.360] (-413.011) (-411.518) (-411.646) -- 0:00:12
806000 -- (-414.771) [-414.116] (-415.576) (-412.160) * (-414.868) (-415.531) (-412.737) [-415.030] -- 0:00:12
806500 -- (-415.175) (-409.102) (-414.391) [-413.913] * [-412.493] (-415.433) (-413.635) (-415.046) -- 0:00:12
807000 -- (-416.618) [-414.738] (-411.748) (-411.468) * [-411.083] (-418.606) (-412.071) (-413.430) -- 0:00:12
807500 -- (-417.789) (-410.807) (-413.173) [-413.310] * (-413.567) [-413.047] (-413.946) (-416.231) -- 0:00:12
808000 -- (-413.900) (-414.250) (-417.227) [-417.467] * (-411.673) [-413.843] (-414.094) (-415.199) -- 0:00:12
808500 -- (-413.975) (-412.296) (-413.277) [-413.333] * [-411.705] (-417.946) (-410.728) (-412.660) -- 0:00:12
809000 -- [-414.081] (-421.967) (-411.682) (-416.355) * (-411.757) [-414.812] (-414.593) (-415.491) -- 0:00:12
809500 -- [-412.528] (-412.583) (-413.898) (-418.052) * (-410.665) [-409.615] (-413.474) (-417.447) -- 0:00:12
810000 -- (-416.175) (-415.500) (-410.922) [-416.197] * (-415.786) (-410.810) [-416.984] (-412.749) -- 0:00:12
Average standard deviation of split frequencies: 0.010809
810500 -- (-412.771) (-416.191) [-414.753] (-414.771) * [-417.125] (-416.744) (-413.939) (-412.148) -- 0:00:12
811000 -- [-412.137] (-414.549) (-413.887) (-411.912) * [-416.027] (-411.486) (-414.289) (-418.192) -- 0:00:12
811500 -- (-415.200) (-416.261) [-417.078] (-414.620) * [-419.611] (-413.486) (-413.868) (-414.992) -- 0:00:12
812000 -- (-417.498) [-413.543] (-412.192) (-413.152) * (-414.139) [-413.638] (-412.346) (-411.892) -- 0:00:12
812500 -- (-413.220) (-413.645) [-411.871] (-413.393) * (-410.457) [-411.189] (-413.273) (-411.763) -- 0:00:12
813000 -- [-413.504] (-420.388) (-413.767) (-412.387) * [-411.330] (-412.816) (-411.197) (-413.853) -- 0:00:12
813500 -- (-412.860) (-417.377) (-412.246) [-411.074] * (-412.270) (-412.186) (-410.797) [-414.628] -- 0:00:12
814000 -- (-411.768) (-419.477) (-410.198) [-411.844] * (-411.186) (-415.238) [-412.691] (-414.757) -- 0:00:12
814500 -- (-412.257) [-410.526] (-412.301) (-413.420) * (-411.310) (-412.647) [-413.574] (-414.877) -- 0:00:12
815000 -- (-413.192) (-413.391) [-409.663] (-416.201) * [-411.537] (-412.294) (-415.518) (-413.393) -- 0:00:12
Average standard deviation of split frequencies: 0.010942
815500 -- (-417.251) (-412.544) [-412.495] (-413.109) * (-413.695) (-411.883) [-413.089] (-415.984) -- 0:00:11
816000 -- [-411.570] (-414.365) (-414.634) (-414.929) * (-416.007) (-412.978) [-413.248] (-417.381) -- 0:00:11
816500 -- (-411.383) (-411.537) [-409.971] (-416.586) * [-414.316] (-412.918) (-415.441) (-411.457) -- 0:00:11
817000 -- (-411.818) [-411.334] (-414.125) (-415.323) * (-414.050) [-409.153] (-412.963) (-413.472) -- 0:00:11
817500 -- [-414.697] (-409.778) (-412.803) (-413.571) * [-412.612] (-410.129) (-415.839) (-415.098) -- 0:00:11
818000 -- (-414.790) [-414.117] (-412.571) (-415.870) * [-415.584] (-411.026) (-413.243) (-414.399) -- 0:00:11
818500 -- [-415.904] (-415.115) (-417.431) (-412.745) * (-416.773) (-414.636) [-416.595] (-416.334) -- 0:00:11
819000 -- (-413.269) (-407.714) [-413.602] (-416.197) * [-411.655] (-414.941) (-415.331) (-418.647) -- 0:00:11
819500 -- (-416.853) [-409.852] (-410.510) (-414.249) * (-412.891) [-414.751] (-414.208) (-413.364) -- 0:00:11
820000 -- (-412.978) (-413.202) (-415.705) [-410.573] * [-412.826] (-419.716) (-411.989) (-413.348) -- 0:00:11
Average standard deviation of split frequencies: 0.010542
820500 -- [-411.579] (-411.494) (-411.798) (-412.004) * [-414.747] (-414.944) (-418.063) (-410.609) -- 0:00:11
821000 -- (-414.767) (-411.090) [-410.573] (-411.547) * (-418.452) (-424.301) [-410.713] (-411.440) -- 0:00:11
821500 -- (-413.918) (-410.110) (-416.166) [-412.319] * (-414.902) (-414.395) (-413.644) [-415.600] -- 0:00:11
822000 -- [-412.182] (-412.677) (-413.797) (-414.122) * (-413.742) (-419.188) (-413.974) [-414.102] -- 0:00:11
822500 -- [-409.948] (-417.073) (-413.110) (-411.581) * (-410.948) (-415.330) [-413.428] (-411.293) -- 0:00:11
823000 -- [-411.394] (-411.032) (-417.352) (-412.361) * [-413.156] (-416.160) (-418.506) (-417.724) -- 0:00:11
823500 -- (-409.528) (-416.518) (-416.019) [-411.516] * (-414.198) [-410.365] (-413.473) (-414.586) -- 0:00:11
824000 -- (-416.479) (-412.614) (-411.243) [-411.876] * (-409.903) [-417.237] (-411.714) (-413.222) -- 0:00:11
824500 -- (-418.348) [-412.068] (-412.553) (-414.315) * (-414.160) [-414.001] (-415.024) (-413.033) -- 0:00:11
825000 -- (-416.589) (-417.593) [-413.781] (-417.036) * (-411.470) (-411.269) (-414.383) [-412.568] -- 0:00:11
Average standard deviation of split frequencies: 0.010676
825500 -- (-413.435) (-413.013) [-412.480] (-412.205) * (-410.928) (-410.979) [-415.164] (-412.027) -- 0:00:11
826000 -- (-411.415) (-411.365) (-417.440) [-411.646] * (-411.372) (-412.846) [-411.423] (-412.351) -- 0:00:11
826500 -- (-414.722) (-413.040) [-414.214] (-414.318) * (-413.824) (-409.943) [-412.451] (-415.414) -- 0:00:11
827000 -- (-410.401) (-415.217) [-410.812] (-412.466) * (-414.736) (-413.638) [-411.616] (-414.512) -- 0:00:11
827500 -- (-410.255) (-416.821) (-413.906) [-417.762] * [-416.868] (-414.619) (-413.677) (-415.062) -- 0:00:11
828000 -- (-411.506) (-415.678) (-417.262) [-410.304] * (-414.225) (-416.695) [-410.979] (-412.929) -- 0:00:11
828500 -- (-412.506) (-412.125) [-412.939] (-411.803) * (-418.333) [-411.031] (-412.059) (-411.961) -- 0:00:11
829000 -- (-413.270) [-411.897] (-411.800) (-412.329) * (-413.481) (-411.580) (-414.819) [-415.296] -- 0:00:11
829500 -- (-411.731) (-417.556) [-414.779] (-414.258) * [-411.845] (-413.939) (-411.879) (-415.785) -- 0:00:11
830000 -- [-412.993] (-413.207) (-414.958) (-416.077) * (-415.598) (-412.765) (-415.019) [-413.171] -- 0:00:11
Average standard deviation of split frequencies: 0.010482
830500 -- (-417.420) [-412.051] (-415.793) (-413.836) * (-418.571) (-413.347) [-410.782] (-413.283) -- 0:00:11
831000 -- (-416.605) [-411.394] (-416.389) (-414.079) * [-412.926] (-412.220) (-426.144) (-411.398) -- 0:00:10
831500 -- (-413.696) [-411.527] (-412.622) (-413.323) * (-416.161) (-420.322) (-410.282) [-413.194] -- 0:00:10
832000 -- [-410.301] (-414.332) (-413.481) (-413.499) * (-416.492) (-418.646) (-411.020) [-412.210] -- 0:00:10
832500 -- (-416.692) (-415.164) [-413.171] (-412.491) * (-411.135) (-411.868) [-410.463] (-411.303) -- 0:00:10
833000 -- (-419.171) (-410.113) [-411.604] (-414.866) * (-414.254) (-416.444) (-412.356) [-413.572] -- 0:00:10
833500 -- (-412.774) (-414.033) [-413.385] (-413.778) * (-416.495) (-412.996) (-413.278) [-416.971] -- 0:00:10
834000 -- (-412.884) (-410.164) (-413.934) [-412.893] * [-414.070] (-411.446) (-415.092) (-414.953) -- 0:00:10
834500 -- (-417.216) (-418.202) [-413.473] (-410.614) * (-411.308) [-409.751] (-417.694) (-424.457) -- 0:00:10
835000 -- (-416.696) [-411.735] (-415.707) (-414.118) * (-408.955) (-413.864) [-412.658] (-418.499) -- 0:00:10
Average standard deviation of split frequencies: 0.010415
835500 -- (-419.165) (-411.905) (-411.406) [-413.896] * [-409.822] (-413.008) (-411.536) (-412.277) -- 0:00:10
836000 -- (-413.194) (-413.884) [-410.252] (-411.606) * (-412.253) [-413.502] (-413.942) (-415.083) -- 0:00:10
836500 -- (-414.056) [-414.578] (-415.335) (-416.004) * (-417.026) (-413.290) (-415.230) [-413.592] -- 0:00:10
837000 -- [-418.159] (-414.083) (-414.871) (-414.017) * (-412.372) [-413.458] (-415.904) (-416.244) -- 0:00:10
837500 -- (-418.149) (-412.263) [-414.245] (-415.632) * (-411.966) (-409.363) (-413.834) [-414.515] -- 0:00:10
838000 -- (-416.854) (-415.060) [-412.275] (-411.303) * (-416.032) [-409.968] (-415.184) (-415.647) -- 0:00:10
838500 -- (-414.730) (-416.868) (-411.558) [-409.534] * (-410.129) [-410.912] (-414.000) (-416.335) -- 0:00:10
839000 -- (-416.865) (-416.129) [-413.097] (-412.496) * (-417.305) [-411.929] (-414.115) (-414.605) -- 0:00:10
839500 -- (-415.594) [-411.505] (-413.094) (-408.162) * (-410.758) [-410.853] (-415.228) (-414.440) -- 0:00:10
840000 -- (-410.853) (-415.035) (-418.022) [-410.172] * (-412.894) (-408.542) (-417.640) [-413.154] -- 0:00:10
Average standard deviation of split frequencies: 0.009673
840500 -- (-412.445) (-411.419) (-416.687) [-409.975] * (-413.770) (-413.630) (-419.419) [-415.663] -- 0:00:10
841000 -- (-412.168) (-412.581) (-412.935) [-415.241] * (-409.976) (-414.034) (-418.365) [-415.784] -- 0:00:10
841500 -- (-413.468) (-413.277) [-409.193] (-416.663) * [-413.480] (-413.353) (-414.121) (-415.072) -- 0:00:10
842000 -- (-417.597) (-414.667) [-414.251] (-411.184) * (-411.495) [-412.044] (-413.037) (-413.700) -- 0:00:10
842500 -- (-413.611) [-416.295] (-410.963) (-411.428) * [-411.685] (-411.571) (-412.077) (-414.430) -- 0:00:10
843000 -- (-414.140) (-411.859) [-413.114] (-412.138) * (-414.614) [-410.684] (-415.941) (-416.827) -- 0:00:10
843500 -- (-412.286) (-417.718) (-413.228) [-411.003] * (-412.874) [-411.932] (-411.656) (-411.699) -- 0:00:10
844000 -- (-419.062) (-418.345) (-412.164) [-410.182] * (-412.616) (-413.640) (-414.067) [-413.208] -- 0:00:10
844500 -- (-421.022) (-414.699) (-412.262) [-413.665] * (-410.690) (-415.406) (-410.972) [-414.690] -- 0:00:10
845000 -- [-411.712] (-412.431) (-413.850) (-414.691) * (-411.750) (-413.585) [-408.380] (-418.077) -- 0:00:10
Average standard deviation of split frequencies: 0.009612
845500 -- (-415.982) [-414.748] (-411.217) (-415.585) * (-411.799) (-417.771) (-412.113) [-412.521] -- 0:00:10
846000 -- (-415.955) (-412.763) [-410.203] (-414.131) * (-410.281) (-416.448) [-413.986] (-411.993) -- 0:00:10
846500 -- (-414.470) (-413.105) (-412.479) [-411.122] * [-410.192] (-413.483) (-414.711) (-420.076) -- 0:00:09
847000 -- (-411.349) (-415.062) [-412.316] (-416.714) * (-413.325) [-412.670] (-414.519) (-412.502) -- 0:00:09
847500 -- (-412.875) [-417.292] (-413.149) (-414.940) * (-416.261) (-413.439) [-411.556] (-415.593) -- 0:00:09
848000 -- [-411.784] (-415.397) (-415.101) (-417.570) * [-414.082] (-411.733) (-413.722) (-412.471) -- 0:00:09
848500 -- [-412.335] (-414.974) (-412.632) (-414.984) * (-410.972) (-414.639) [-415.815] (-411.721) -- 0:00:09
849000 -- [-417.436] (-414.082) (-411.086) (-412.337) * [-413.960] (-412.190) (-412.166) (-414.685) -- 0:00:09
849500 -- (-412.995) [-410.488] (-416.692) (-413.034) * (-421.171) (-414.999) (-412.436) [-413.742] -- 0:00:09
850000 -- [-418.359] (-414.221) (-415.674) (-416.068) * (-410.473) [-414.758] (-415.938) (-411.620) -- 0:00:09
Average standard deviation of split frequencies: 0.010044
850500 -- (-412.363) (-414.321) [-414.462] (-417.507) * [-412.235] (-412.081) (-416.139) (-410.292) -- 0:00:09
851000 -- (-415.065) (-413.443) [-413.125] (-414.045) * (-411.052) [-412.688] (-410.621) (-412.972) -- 0:00:09
851500 -- (-413.132) (-414.615) [-414.727] (-413.273) * (-411.455) (-412.342) (-413.588) [-418.688] -- 0:00:09
852000 -- (-417.166) [-413.063] (-414.995) (-416.521) * (-416.449) (-413.531) (-412.837) [-419.310] -- 0:00:09
852500 -- [-413.140] (-413.588) (-414.008) (-417.566) * [-417.514] (-413.284) (-415.069) (-414.825) -- 0:00:09
853000 -- (-414.205) (-412.152) (-414.454) [-415.152] * (-416.983) [-413.822] (-414.859) (-416.705) -- 0:00:09
853500 -- [-411.949] (-415.313) (-412.871) (-411.907) * (-412.131) (-416.951) [-414.864] (-415.426) -- 0:00:09
854000 -- [-411.867] (-413.686) (-412.452) (-413.003) * (-414.200) (-414.172) [-414.162] (-414.682) -- 0:00:09
854500 -- (-414.386) (-413.265) (-413.757) [-414.142] * (-413.899) [-409.579] (-416.214) (-415.151) -- 0:00:09
855000 -- (-413.244) (-414.152) (-417.034) [-412.614] * [-412.068] (-411.886) (-414.453) (-421.171) -- 0:00:09
Average standard deviation of split frequencies: 0.009692
855500 -- (-413.463) (-413.158) (-414.092) [-412.704] * (-408.523) [-410.731] (-415.018) (-415.496) -- 0:00:09
856000 -- [-411.889] (-417.786) (-410.779) (-414.723) * (-409.901) [-412.115] (-418.209) (-414.669) -- 0:00:09
856500 -- (-413.197) [-415.816] (-419.030) (-414.249) * (-412.379) (-411.748) [-415.019] (-415.847) -- 0:00:09
857000 -- (-415.500) (-415.889) [-413.687] (-412.094) * [-414.351] (-412.082) (-416.261) (-415.100) -- 0:00:09
857500 -- [-416.757] (-416.343) (-417.503) (-417.689) * (-410.626) (-412.122) [-411.989] (-409.914) -- 0:00:09
858000 -- [-411.988] (-417.802) (-411.967) (-418.993) * [-414.359] (-415.409) (-411.711) (-415.137) -- 0:00:09
858500 -- (-415.534) (-416.376) (-412.248) [-412.865] * (-412.847) (-416.255) (-410.567) [-413.763] -- 0:00:09
859000 -- [-411.965] (-413.167) (-415.412) (-415.354) * (-413.923) (-412.674) [-414.849] (-412.571) -- 0:00:09
859500 -- (-412.661) (-412.837) [-413.245] (-412.096) * [-410.216] (-410.220) (-414.994) (-410.982) -- 0:00:08
860000 -- (-412.379) (-413.066) [-412.366] (-410.387) * (-412.811) (-413.236) (-412.364) [-411.032] -- 0:00:09
Average standard deviation of split frequencies: 0.009275
860500 -- (-410.189) (-411.858) [-412.727] (-416.282) * (-413.200) (-416.428) (-414.749) [-412.154] -- 0:00:09
861000 -- [-413.233] (-412.188) (-410.962) (-417.123) * (-412.436) (-413.931) (-410.621) [-414.807] -- 0:00:09
861500 -- (-412.328) (-412.064) [-412.607] (-414.926) * (-412.356) (-415.271) [-411.876] (-414.781) -- 0:00:09
862000 -- [-411.896] (-411.675) (-414.198) (-413.679) * [-412.153] (-412.083) (-415.568) (-413.649) -- 0:00:08
862500 -- (-417.241) [-411.506] (-411.928) (-416.738) * [-410.594] (-415.929) (-414.707) (-415.177) -- 0:00:08
863000 -- (-414.832) (-412.309) (-414.737) [-410.971] * [-409.878] (-415.175) (-415.129) (-411.244) -- 0:00:08
863500 -- (-417.505) [-413.389] (-413.622) (-412.793) * (-409.002) (-414.796) [-410.699] (-413.753) -- 0:00:08
864000 -- [-413.235] (-416.870) (-413.168) (-414.946) * (-411.823) (-414.548) (-413.894) [-416.461] -- 0:00:08
864500 -- (-415.486) (-411.109) [-412.620] (-416.808) * [-415.562] (-412.991) (-411.315) (-415.644) -- 0:00:08
865000 -- (-414.345) (-411.972) [-414.160] (-416.834) * (-412.266) (-418.401) [-412.168] (-413.827) -- 0:00:08
Average standard deviation of split frequencies: 0.009145
865500 -- (-416.477) (-414.429) [-412.161] (-414.427) * (-415.770) [-417.778] (-410.849) (-413.105) -- 0:00:08
866000 -- (-411.334) [-414.851] (-410.983) (-414.788) * (-412.526) (-414.196) (-414.260) [-413.358] -- 0:00:08
866500 -- (-415.262) [-414.232] (-415.385) (-417.412) * [-410.991] (-414.842) (-414.703) (-418.767) -- 0:00:08
867000 -- (-412.051) (-414.892) [-411.285] (-414.164) * (-411.246) (-413.743) (-416.870) [-414.858] -- 0:00:08
867500 -- (-412.700) (-411.717) [-409.656] (-414.070) * [-411.755] (-418.223) (-411.152) (-413.002) -- 0:00:08
868000 -- (-414.505) [-415.909] (-411.142) (-415.863) * (-413.264) [-411.372] (-413.462) (-415.658) -- 0:00:08
868500 -- (-413.624) (-411.272) (-409.957) [-412.774] * (-413.651) [-413.668] (-411.442) (-414.030) -- 0:00:08
869000 -- (-411.586) (-415.478) (-412.210) [-418.303] * (-412.545) (-416.045) [-415.635] (-414.554) -- 0:00:08
869500 -- (-415.656) [-411.435] (-415.289) (-419.797) * (-413.377) [-416.146] (-412.287) (-420.516) -- 0:00:08
870000 -- (-412.513) (-420.533) [-412.595] (-417.622) * (-412.077) (-412.663) [-409.954] (-417.338) -- 0:00:08
Average standard deviation of split frequencies: 0.008988
870500 -- [-413.319] (-414.452) (-414.474) (-418.152) * (-412.099) [-411.816] (-415.027) (-411.461) -- 0:00:08
871000 -- (-413.563) (-414.086) (-414.041) [-418.884] * (-414.340) [-414.167] (-417.967) (-417.319) -- 0:00:08
871500 -- (-409.379) (-412.953) [-414.575] (-416.955) * (-412.450) (-411.893) [-415.297] (-416.906) -- 0:00:08
872000 -- (-410.486) [-410.667] (-414.245) (-417.790) * (-414.283) [-413.257] (-413.335) (-418.929) -- 0:00:08
872500 -- (-413.532) [-412.574] (-412.977) (-414.669) * [-413.452] (-412.900) (-417.091) (-417.671) -- 0:00:08
873000 -- (-416.618) (-419.246) [-413.297] (-421.466) * (-417.545) (-415.012) [-417.052] (-415.063) -- 0:00:08
873500 -- (-411.108) [-412.695] (-409.722) (-419.703) * (-412.746) [-413.214] (-412.695) (-414.530) -- 0:00:08
874000 -- (-412.550) [-413.938] (-416.214) (-413.726) * (-418.730) (-411.420) (-415.800) [-413.467] -- 0:00:08
874500 -- [-413.238] (-421.442) (-415.241) (-414.014) * (-417.464) (-414.300) (-413.797) [-413.391] -- 0:00:08
875000 -- (-414.863) [-413.078] (-416.701) (-413.432) * (-415.536) (-413.198) (-416.161) [-410.932] -- 0:00:08
Average standard deviation of split frequencies: 0.008646
875500 -- (-410.560) [-412.032] (-414.853) (-412.448) * (-416.936) (-414.310) [-418.449] (-411.850) -- 0:00:08
876000 -- [-414.057] (-410.462) (-416.640) (-413.321) * [-410.816] (-415.009) (-412.591) (-414.520) -- 0:00:08
876500 -- (-413.237) [-409.792] (-416.116) (-412.418) * (-412.589) (-413.148) [-411.861] (-414.793) -- 0:00:08
877000 -- (-417.029) (-412.717) [-417.038] (-415.999) * (-414.142) [-410.131] (-416.276) (-416.356) -- 0:00:07
877500 -- (-413.586) (-413.755) (-417.359) [-413.557] * (-412.555) (-410.800) (-416.406) [-413.496] -- 0:00:07
878000 -- (-413.591) (-414.221) (-414.796) [-409.037] * (-411.741) (-412.970) (-413.362) [-410.924] -- 0:00:07
878500 -- (-414.967) (-413.063) [-415.103] (-411.305) * [-413.617] (-411.742) (-420.756) (-416.775) -- 0:00:07
879000 -- (-414.577) [-413.164] (-414.800) (-411.602) * (-413.129) [-408.362] (-420.897) (-414.429) -- 0:00:07
879500 -- (-411.528) (-418.447) (-414.432) [-413.115] * (-412.249) [-410.779] (-411.243) (-413.344) -- 0:00:07
880000 -- (-413.656) (-417.021) (-415.468) [-409.235] * [-412.932] (-410.538) (-418.684) (-412.522) -- 0:00:07
Average standard deviation of split frequencies: 0.008600
880500 -- (-415.018) (-415.559) (-415.256) [-412.686] * (-413.093) (-410.246) (-408.747) [-412.817] -- 0:00:07
881000 -- (-412.935) (-412.615) [-414.080] (-409.381) * (-422.161) [-411.858] (-409.680) (-415.120) -- 0:00:07
881500 -- (-412.975) (-413.728) [-416.452] (-411.023) * [-412.636] (-415.650) (-410.623) (-415.012) -- 0:00:07
882000 -- (-415.936) (-415.703) (-414.161) [-411.519] * (-415.570) (-413.359) (-411.160) [-410.912] -- 0:00:07
882500 -- (-416.717) [-412.070] (-413.761) (-412.449) * (-413.729) (-416.944) (-410.632) [-417.641] -- 0:00:07
883000 -- (-419.679) (-415.976) (-411.090) [-413.543] * (-416.374) [-417.533] (-415.711) (-413.645) -- 0:00:07
883500 -- (-416.977) [-418.045] (-410.376) (-411.967) * (-412.268) [-410.212] (-414.814) (-412.739) -- 0:00:07
884000 -- (-413.684) [-415.659] (-412.694) (-409.802) * (-415.482) (-415.753) (-413.983) [-411.597] -- 0:00:07
884500 -- (-415.434) [-412.939] (-416.329) (-413.069) * (-416.462) (-415.107) (-412.700) [-412.329] -- 0:00:07
885000 -- [-414.863] (-413.828) (-414.807) (-414.692) * (-418.899) (-413.079) [-416.895] (-414.344) -- 0:00:07
Average standard deviation of split frequencies: 0.008939
885500 -- (-415.418) (-412.672) [-415.904] (-411.874) * (-412.738) (-414.014) (-412.295) [-411.865] -- 0:00:07
886000 -- [-413.311] (-414.800) (-418.043) (-417.131) * (-411.903) (-414.142) (-417.197) [-411.016] -- 0:00:07
886500 -- (-413.829) (-417.026) [-416.505] (-415.881) * [-413.367] (-414.189) (-417.766) (-413.399) -- 0:00:07
887000 -- (-409.033) (-411.748) (-415.642) [-412.503] * [-412.918] (-414.506) (-414.620) (-416.474) -- 0:00:07
887500 -- (-412.667) (-414.351) (-414.290) [-411.448] * (-415.594) (-415.555) [-412.752] (-418.192) -- 0:00:07
888000 -- (-414.218) [-412.325] (-415.244) (-412.514) * (-414.673) (-410.565) [-411.962] (-417.515) -- 0:00:07
888500 -- [-417.011] (-412.849) (-411.355) (-421.143) * (-416.436) (-414.992) (-410.536) [-413.933] -- 0:00:07
889000 -- (-414.085) [-411.874] (-412.895) (-414.814) * [-409.571] (-418.103) (-416.273) (-412.981) -- 0:00:07
889500 -- (-413.855) [-413.987] (-417.677) (-424.400) * [-410.740] (-415.310) (-416.906) (-417.239) -- 0:00:07
890000 -- (-412.901) (-416.523) [-415.788] (-413.382) * [-411.364] (-413.723) (-414.620) (-415.998) -- 0:00:07
Average standard deviation of split frequencies: 0.008821
890500 -- (-411.396) [-412.414] (-415.459) (-412.695) * (-413.145) (-415.422) [-411.306] (-416.337) -- 0:00:07
891000 -- [-411.555] (-411.261) (-417.913) (-413.809) * (-417.837) (-416.751) [-413.496] (-415.484) -- 0:00:06
891500 -- (-415.914) (-412.145) (-412.296) [-416.684] * [-418.134] (-413.027) (-411.251) (-414.823) -- 0:00:07
892000 -- (-413.520) (-412.509) (-413.388) [-415.718] * [-411.916] (-423.882) (-412.178) (-412.473) -- 0:00:07
892500 -- (-409.870) (-413.352) (-416.520) [-409.183] * (-417.122) (-410.186) (-414.311) [-412.907] -- 0:00:06
893000 -- (-414.335) [-411.788] (-413.295) (-412.561) * (-419.200) [-409.140] (-419.588) (-412.696) -- 0:00:06
893500 -- (-414.418) (-412.903) (-411.916) [-414.188] * (-416.444) (-418.338) [-414.153] (-427.572) -- 0:00:06
894000 -- (-412.307) (-411.892) [-416.085] (-411.029) * [-414.581] (-413.151) (-411.959) (-418.982) -- 0:00:06
894500 -- (-411.418) [-409.965] (-414.114) (-412.744) * (-412.296) (-414.562) [-412.090] (-414.570) -- 0:00:06
895000 -- (-415.479) (-409.912) [-417.040] (-415.823) * (-413.090) [-412.551] (-411.036) (-412.072) -- 0:00:06
Average standard deviation of split frequencies: 0.008207
895500 -- [-414.117] (-410.424) (-414.813) (-418.058) * [-410.922] (-413.463) (-408.945) (-418.071) -- 0:00:06
896000 -- (-417.844) (-414.912) [-414.048] (-415.670) * (-415.326) (-411.354) (-413.776) [-412.838] -- 0:00:06
896500 -- (-412.848) (-412.836) (-416.623) [-412.774] * (-415.411) [-414.711] (-411.557) (-416.883) -- 0:00:06
897000 -- (-412.337) (-412.282) (-413.214) [-412.514] * (-413.835) [-413.908] (-410.692) (-413.905) -- 0:00:06
897500 -- (-411.409) (-414.436) (-416.913) [-414.911] * [-413.766] (-414.580) (-411.842) (-413.440) -- 0:00:06
898000 -- (-410.378) (-425.046) (-414.455) [-411.365] * (-417.116) (-414.139) (-414.085) [-412.809] -- 0:00:06
898500 -- [-411.535] (-413.266) (-416.133) (-412.668) * (-414.210) (-417.646) (-410.748) [-413.952] -- 0:00:06
899000 -- [-409.372] (-415.411) (-415.271) (-412.733) * (-412.959) (-412.884) [-413.492] (-413.152) -- 0:00:06
899500 -- [-414.482] (-416.637) (-415.724) (-412.890) * (-412.596) [-413.880] (-414.753) (-414.492) -- 0:00:06
900000 -- (-414.485) (-413.139) [-413.594] (-418.790) * [-413.731] (-413.325) (-416.293) (-413.302) -- 0:00:06
Average standard deviation of split frequencies: 0.008339
900500 -- [-417.583] (-418.198) (-415.637) (-412.015) * (-413.608) (-411.929) (-418.165) [-412.670] -- 0:00:06
901000 -- (-412.539) [-413.440] (-412.834) (-415.108) * [-410.276] (-413.869) (-415.017) (-415.769) -- 0:00:06
901500 -- (-415.328) (-414.125) [-412.857] (-411.680) * (-415.260) (-415.196) [-412.821] (-413.834) -- 0:00:06
902000 -- (-412.903) [-413.920] (-412.858) (-413.567) * (-411.230) (-417.041) [-412.346] (-415.213) -- 0:00:06
902500 -- (-417.362) (-411.019) (-415.054) [-411.707] * (-409.120) (-410.496) (-413.875) [-412.340] -- 0:00:06
903000 -- (-415.510) (-410.339) (-417.182) [-414.297] * [-411.516] (-417.207) (-411.136) (-414.088) -- 0:00:06
903500 -- (-415.836) (-411.123) (-418.171) [-413.665] * [-410.611] (-413.197) (-414.520) (-411.870) -- 0:00:06
904000 -- (-409.503) [-409.858] (-412.432) (-411.179) * [-409.025] (-410.864) (-413.491) (-411.677) -- 0:00:06
904500 -- (-410.880) (-413.511) (-412.589) [-410.989] * (-411.695) [-413.965] (-415.475) (-416.215) -- 0:00:06
905000 -- (-412.625) (-409.523) [-411.584] (-413.427) * (-417.681) [-416.938] (-413.455) (-416.515) -- 0:00:06
Average standard deviation of split frequencies: 0.008498
905500 -- [-411.236] (-413.124) (-412.527) (-411.845) * (-412.883) [-412.488] (-413.799) (-410.010) -- 0:00:06
906000 -- (-411.097) [-410.635] (-414.957) (-414.229) * (-415.610) (-413.061) (-417.086) [-410.827] -- 0:00:06
906500 -- [-410.728] (-410.226) (-417.919) (-411.416) * (-416.197) (-414.735) [-419.683] (-412.652) -- 0:00:05
907000 -- (-411.061) (-410.778) (-413.892) [-413.467] * (-415.901) [-413.165] (-414.891) (-417.298) -- 0:00:06
907500 -- (-410.106) (-413.151) (-414.047) [-418.584] * (-412.901) (-413.872) (-414.320) [-411.584] -- 0:00:06
908000 -- [-415.389] (-413.169) (-413.503) (-412.920) * (-410.825) (-411.483) (-411.324) [-416.655] -- 0:00:05
908500 -- [-411.082] (-413.288) (-420.744) (-417.534) * (-420.487) (-409.014) (-412.150) [-414.695] -- 0:00:05
909000 -- (-413.988) (-410.149) [-421.239] (-415.169) * (-415.546) (-411.787) [-411.516] (-415.148) -- 0:00:05
909500 -- (-415.749) [-413.129] (-412.241) (-415.672) * (-412.236) [-410.973] (-412.421) (-417.589) -- 0:00:05
910000 -- (-414.003) (-414.918) [-414.977] (-419.042) * (-417.646) [-413.107] (-418.779) (-420.713) -- 0:00:05
Average standard deviation of split frequencies: 0.008768
910500 -- [-413.350] (-411.263) (-411.324) (-417.977) * (-415.010) (-418.454) (-412.694) [-415.192] -- 0:00:05
911000 -- (-408.941) (-413.922) (-418.257) [-413.966] * (-419.077) (-417.304) (-417.171) [-415.347] -- 0:00:05
911500 -- [-409.788] (-413.537) (-414.838) (-415.588) * (-416.831) [-410.467] (-410.413) (-412.465) -- 0:00:05
912000 -- (-413.160) (-412.903) [-414.220] (-416.884) * (-414.842) (-409.328) [-411.491] (-410.518) -- 0:00:05
912500 -- [-411.317] (-413.560) (-417.047) (-418.157) * (-412.563) (-416.630) [-409.829] (-410.275) -- 0:00:05
913000 -- (-413.644) [-411.793] (-413.138) (-414.920) * (-414.512) (-412.733) (-410.080) [-411.438] -- 0:00:05
913500 -- (-410.872) (-414.265) [-413.166] (-412.856) * (-415.763) (-412.539) [-414.650] (-412.258) -- 0:00:05
914000 -- [-420.717] (-416.894) (-411.491) (-412.058) * (-415.432) (-410.459) [-414.533] (-413.542) -- 0:00:05
914500 -- (-417.951) [-413.301] (-414.193) (-415.382) * (-417.901) (-413.381) [-413.541] (-411.890) -- 0:00:05
915000 -- [-412.184] (-409.777) (-414.950) (-409.837) * (-412.798) [-417.512] (-413.756) (-418.713) -- 0:00:05
Average standard deviation of split frequencies: 0.008371
915500 -- (-417.803) (-416.972) [-412.331] (-414.694) * (-415.848) [-411.770] (-415.716) (-414.153) -- 0:00:05
916000 -- (-415.344) (-412.769) [-411.657] (-412.221) * [-415.330] (-413.264) (-415.662) (-413.585) -- 0:00:05
916500 -- [-414.363] (-411.481) (-413.791) (-414.115) * [-412.701] (-416.324) (-416.421) (-413.787) -- 0:00:05
917000 -- (-414.629) (-413.542) [-411.904] (-416.371) * (-417.934) (-413.963) (-413.970) [-415.856] -- 0:00:05
917500 -- (-413.009) (-413.579) [-412.290] (-424.961) * (-412.875) (-411.224) (-414.831) [-411.187] -- 0:00:05
918000 -- (-413.087) (-414.046) [-413.919] (-413.388) * (-415.290) (-410.265) (-415.967) [-416.381] -- 0:00:05
918500 -- (-411.357) (-415.194) [-413.778] (-411.895) * [-409.819] (-413.516) (-416.569) (-417.248) -- 0:00:05
919000 -- (-414.539) [-414.037] (-416.880) (-414.995) * (-418.130) (-412.427) [-413.148] (-419.168) -- 0:00:05
919500 -- (-413.488) (-410.901) (-416.787) [-417.630] * (-413.317) (-411.267) [-413.709] (-416.427) -- 0:00:05
920000 -- (-418.723) [-412.281] (-412.638) (-418.692) * (-414.069) [-413.379] (-412.668) (-413.946) -- 0:00:05
Average standard deviation of split frequencies: 0.008192
920500 -- (-416.975) [-412.195] (-410.617) (-411.012) * (-416.095) (-413.316) (-412.952) [-410.070] -- 0:00:05
921000 -- (-415.911) [-413.365] (-415.740) (-417.224) * (-412.130) (-415.427) (-412.968) [-413.651] -- 0:00:05
921500 -- (-412.930) [-412.761] (-416.847) (-418.148) * [-417.268] (-414.742) (-410.536) (-417.826) -- 0:00:05
922000 -- (-413.952) [-410.243] (-420.086) (-418.395) * [-414.191] (-416.862) (-411.379) (-413.235) -- 0:00:04
922500 -- (-412.596) (-417.024) [-417.656] (-412.982) * (-413.542) [-417.510] (-413.229) (-414.670) -- 0:00:05
923000 -- [-413.555] (-411.115) (-417.894) (-415.627) * (-414.251) [-418.393] (-415.456) (-411.981) -- 0:00:05
923500 -- (-413.468) (-413.213) (-414.070) [-412.679] * (-414.391) (-412.806) (-413.253) [-410.578] -- 0:00:04
924000 -- (-411.252) (-410.563) (-416.171) [-416.045] * (-411.128) (-413.306) [-413.587] (-414.783) -- 0:00:04
924500 -- (-410.412) (-412.561) (-416.601) [-413.695] * (-410.531) [-418.233] (-415.728) (-410.623) -- 0:00:04
925000 -- [-417.420] (-412.045) (-415.648) (-416.487) * [-413.995] (-415.044) (-411.308) (-412.055) -- 0:00:04
Average standard deviation of split frequencies: 0.008463
925500 -- (-416.872) (-411.045) [-418.167] (-412.747) * (-415.854) (-412.915) [-411.065] (-411.152) -- 0:00:04
926000 -- [-416.897] (-413.391) (-417.367) (-413.875) * (-413.029) (-412.080) (-414.336) [-410.645] -- 0:00:04
926500 -- (-414.417) (-411.873) (-417.417) [-410.293] * (-410.255) [-413.877] (-413.661) (-413.029) -- 0:00:04
927000 -- (-415.742) [-411.524] (-414.373) (-414.966) * (-411.050) (-413.317) (-413.016) [-409.985] -- 0:00:04
927500 -- (-413.465) [-411.284] (-417.557) (-412.361) * (-412.954) (-412.645) [-409.896] (-413.147) -- 0:00:04
928000 -- (-415.035) [-409.854] (-416.746) (-411.776) * (-411.773) (-411.135) [-411.679] (-411.540) -- 0:00:04
928500 -- (-413.819) [-417.099] (-417.746) (-414.732) * (-410.641) (-417.964) [-419.221] (-410.280) -- 0:00:04
929000 -- (-415.567) (-411.953) (-417.030) [-414.447] * [-414.048] (-413.360) (-412.065) (-413.447) -- 0:00:04
929500 -- (-412.884) [-412.245] (-413.446) (-416.505) * [-412.764] (-418.103) (-411.642) (-413.739) -- 0:00:04
930000 -- (-413.385) [-411.739] (-416.867) (-416.281) * [-411.284] (-411.183) (-414.788) (-413.277) -- 0:00:04
Average standard deviation of split frequencies: 0.008168
930500 -- [-416.221] (-415.185) (-415.504) (-420.183) * (-414.676) [-412.771] (-417.324) (-411.882) -- 0:00:04
931000 -- (-416.111) (-416.292) (-415.858) [-414.580] * (-414.957) (-413.656) [-411.767] (-410.920) -- 0:00:04
931500 -- [-413.337] (-417.240) (-412.969) (-420.219) * [-411.483] (-414.343) (-413.743) (-412.612) -- 0:00:04
932000 -- (-416.416) (-412.615) [-411.815] (-414.487) * [-412.128] (-416.797) (-415.004) (-415.306) -- 0:00:04
932500 -- (-413.039) (-411.746) [-414.822] (-411.709) * [-414.848] (-414.870) (-413.611) (-409.533) -- 0:00:04
933000 -- (-413.410) [-413.225] (-413.215) (-411.115) * (-414.456) (-418.068) [-411.593] (-410.785) -- 0:00:04
933500 -- [-415.735] (-410.165) (-418.508) (-412.717) * (-413.124) (-414.305) (-413.775) [-413.514] -- 0:00:04
934000 -- (-412.216) [-411.915] (-411.072) (-412.599) * (-415.042) (-416.986) [-412.003] (-412.867) -- 0:00:04
934500 -- (-420.488) (-411.452) (-413.729) [-414.114] * [-411.033] (-413.947) (-413.792) (-410.910) -- 0:00:04
935000 -- (-414.080) (-411.048) [-409.727] (-414.205) * (-411.807) (-420.042) [-412.920] (-413.665) -- 0:00:04
Average standard deviation of split frequencies: 0.007932
935500 -- (-417.024) (-408.754) (-411.847) [-413.973] * (-413.218) (-412.196) [-411.615] (-413.335) -- 0:00:04
936000 -- [-412.860] (-411.533) (-413.328) (-417.816) * (-410.563) (-413.534) [-414.361] (-411.277) -- 0:00:04
936500 -- [-412.967] (-410.530) (-414.256) (-415.047) * [-417.595] (-418.614) (-413.958) (-416.594) -- 0:00:04
937000 -- (-413.591) [-412.937] (-411.727) (-414.081) * (-415.274) (-417.991) [-410.881] (-412.992) -- 0:00:04
937500 -- (-414.033) [-410.741] (-414.171) (-417.461) * [-414.276] (-417.567) (-411.948) (-415.416) -- 0:00:04
938000 -- (-414.699) [-410.224] (-415.629) (-419.248) * [-416.560] (-414.611) (-410.025) (-412.290) -- 0:00:03
938500 -- (-412.666) (-414.472) [-413.782] (-415.721) * (-412.729) (-413.800) (-416.783) [-414.897] -- 0:00:03
939000 -- (-411.822) [-418.071] (-419.130) (-413.886) * (-419.349) (-413.473) [-415.441] (-414.161) -- 0:00:03
939500 -- (-414.710) [-412.726] (-414.485) (-413.717) * (-420.476) (-416.783) [-412.231] (-411.673) -- 0:00:03
940000 -- (-415.880) (-414.927) [-414.118] (-412.627) * (-413.884) (-417.024) (-412.868) [-413.026] -- 0:00:03
Average standard deviation of split frequencies: 0.008175
940500 -- (-413.009) (-412.019) [-411.837] (-415.168) * (-415.816) (-416.786) (-413.075) [-412.672] -- 0:00:03
941000 -- (-410.277) (-410.338) [-413.268] (-417.206) * (-413.532) (-412.330) [-410.322] (-412.784) -- 0:00:03
941500 -- (-412.171) (-415.040) (-410.689) [-414.146] * (-413.799) (-411.675) (-411.527) [-414.270] -- 0:00:03
942000 -- (-412.530) [-413.603] (-415.394) (-417.222) * (-413.967) [-414.254] (-412.501) (-412.589) -- 0:00:03
942500 -- (-414.938) (-412.597) (-413.518) [-417.946] * [-414.001] (-415.333) (-410.692) (-416.334) -- 0:00:03
943000 -- [-412.112] (-410.942) (-417.406) (-416.898) * [-415.827] (-415.219) (-415.957) (-416.583) -- 0:00:03
943500 -- (-411.058) [-409.484] (-416.848) (-419.319) * (-413.814) (-417.153) (-413.392) [-415.268] -- 0:00:03
944000 -- [-412.260] (-411.386) (-409.784) (-416.121) * (-417.134) (-415.782) (-416.669) [-411.856] -- 0:00:03
944500 -- (-411.957) (-412.551) (-412.039) [-415.542] * (-415.996) (-414.447) [-410.407] (-414.232) -- 0:00:03
945000 -- (-412.514) (-411.024) (-417.917) [-416.365] * (-413.721) (-416.968) [-411.047] (-412.550) -- 0:00:03
Average standard deviation of split frequencies: 0.008035
945500 -- (-412.758) (-415.699) [-410.489] (-412.437) * (-416.021) (-417.057) (-414.394) [-412.608] -- 0:00:03
946000 -- (-412.244) [-411.131] (-417.028) (-415.506) * (-416.092) (-418.643) (-417.482) [-417.973] -- 0:00:03
946500 -- (-413.199) (-412.310) [-411.704] (-416.679) * (-414.883) (-418.393) (-413.488) [-415.902] -- 0:00:03
947000 -- (-416.131) [-409.675] (-413.274) (-412.253) * (-411.141) (-414.656) [-409.152] (-411.409) -- 0:00:03
947500 -- (-412.589) [-414.060] (-411.605) (-415.205) * (-412.677) (-414.271) (-412.083) [-415.042] -- 0:00:03
948000 -- (-415.195) (-412.194) [-410.662] (-418.349) * (-412.640) [-413.235] (-415.125) (-415.454) -- 0:00:03
948500 -- (-411.978) (-412.810) (-412.703) [-415.238] * (-413.285) (-415.986) (-415.892) [-415.664] -- 0:00:03
949000 -- (-411.908) (-410.810) [-414.279] (-414.226) * [-413.423] (-414.112) (-413.301) (-416.690) -- 0:00:03
949500 -- (-413.686) [-414.100] (-414.462) (-414.119) * (-411.070) (-412.363) [-412.055] (-415.569) -- 0:00:03
950000 -- (-412.612) (-413.205) [-411.189] (-414.035) * [-414.151] (-415.980) (-413.090) (-414.888) -- 0:00:03
Average standard deviation of split frequencies: 0.008027
950500 -- (-413.563) [-414.019] (-410.989) (-417.634) * (-412.837) [-416.026] (-412.700) (-417.128) -- 0:00:03
951000 -- [-412.847] (-413.682) (-421.195) (-413.012) * (-418.069) (-416.211) (-413.775) [-415.774] -- 0:00:03
951500 -- (-413.784) [-410.364] (-418.273) (-410.896) * [-413.814] (-415.761) (-411.028) (-418.288) -- 0:00:03
952000 -- (-413.377) (-411.306) [-412.371] (-414.191) * (-412.263) [-414.517] (-417.424) (-412.913) -- 0:00:03
952500 -- (-412.282) (-417.674) (-413.447) [-415.136] * (-414.215) [-411.522] (-415.516) (-417.099) -- 0:00:03
953000 -- (-410.978) [-410.958] (-417.562) (-415.381) * (-411.851) (-411.939) (-416.334) [-413.325] -- 0:00:03
953500 -- (-412.588) (-412.516) [-413.180] (-416.944) * (-412.215) [-411.194] (-413.697) (-415.110) -- 0:00:02
954000 -- (-412.383) (-413.120) (-415.650) [-415.386] * (-413.656) (-413.998) [-410.875] (-415.066) -- 0:00:02
954500 -- (-413.585) (-413.259) (-414.613) [-418.514] * (-416.879) [-410.724] (-413.081) (-416.839) -- 0:00:02
955000 -- [-412.109] (-414.620) (-410.076) (-415.467) * (-416.928) (-417.114) [-410.751] (-413.711) -- 0:00:02
Average standard deviation of split frequencies: 0.008229
955500 -- (-413.110) (-412.578) [-410.229] (-415.498) * (-417.483) (-414.493) [-412.080] (-414.785) -- 0:00:02
956000 -- (-413.579) (-412.282) [-412.747] (-415.434) * [-411.272] (-413.529) (-412.340) (-413.100) -- 0:00:02
956500 -- (-411.837) (-416.401) (-411.925) [-415.142] * (-411.898) [-411.749] (-415.647) (-414.498) -- 0:00:02
957000 -- (-411.533) (-414.506) (-413.560) [-415.431] * (-413.299) [-412.497] (-411.735) (-414.767) -- 0:00:02
957500 -- [-417.780] (-416.390) (-415.256) (-414.809) * (-411.346) (-413.613) (-413.590) [-411.561] -- 0:00:02
958000 -- [-413.957] (-411.156) (-414.002) (-412.189) * (-410.885) [-413.797] (-413.669) (-419.403) -- 0:00:02
958500 -- (-411.003) [-412.201] (-411.944) (-412.135) * (-414.199) (-413.855) (-410.214) [-416.846] -- 0:00:02
959000 -- (-418.090) (-412.478) [-410.012] (-410.672) * [-411.651] (-410.075) (-412.616) (-414.056) -- 0:00:02
959500 -- (-416.911) (-414.950) (-412.330) [-413.572] * [-411.046] (-417.074) (-414.893) (-417.015) -- 0:00:02
960000 -- (-415.947) [-412.294] (-414.597) (-416.995) * (-414.277) (-417.256) (-419.406) [-416.007] -- 0:00:02
Average standard deviation of split frequencies: 0.007851
960500 -- [-416.513] (-415.124) (-413.356) (-413.729) * (-428.709) (-417.577) [-417.054] (-417.353) -- 0:00:02
961000 -- (-417.630) (-416.304) [-415.070] (-414.783) * [-419.048] (-414.050) (-414.973) (-412.403) -- 0:00:02
961500 -- (-417.095) (-415.407) (-412.930) [-412.622] * (-414.963) (-418.045) [-411.045] (-413.033) -- 0:00:02
962000 -- (-414.903) (-416.691) [-412.831] (-413.326) * [-412.326] (-411.846) (-417.126) (-415.091) -- 0:00:02
962500 -- [-413.299] (-416.287) (-412.519) (-414.238) * (-415.378) [-411.548] (-416.573) (-415.223) -- 0:00:02
963000 -- [-423.975] (-412.277) (-411.363) (-411.829) * [-411.696] (-413.949) (-416.601) (-415.826) -- 0:00:02
963500 -- (-420.421) (-414.856) [-412.855] (-416.960) * (-415.783) (-413.115) [-412.985] (-418.029) -- 0:00:02
964000 -- (-421.153) (-411.957) [-409.698] (-417.768) * (-418.758) (-412.745) [-413.769] (-412.398) -- 0:00:02
964500 -- [-417.521] (-413.304) (-413.775) (-416.226) * (-413.203) (-418.558) [-413.720] (-414.543) -- 0:00:02
965000 -- (-413.102) (-412.658) [-414.398] (-413.439) * [-411.333] (-417.618) (-414.828) (-417.767) -- 0:00:02
Average standard deviation of split frequencies: 0.008235
965500 -- (-417.257) (-415.974) (-412.972) [-414.622] * (-413.569) (-413.603) (-416.946) [-416.176] -- 0:00:02
966000 -- (-419.885) (-417.998) (-413.667) [-411.076] * [-413.121] (-414.866) (-415.283) (-413.519) -- 0:00:02
966500 -- (-414.441) (-414.153) [-411.886] (-413.683) * (-411.557) (-413.344) (-416.742) [-410.453] -- 0:00:02
967000 -- (-411.150) [-412.975] (-410.381) (-412.884) * [-412.399] (-411.993) (-418.783) (-412.546) -- 0:00:02
967500 -- (-413.807) (-414.446) [-412.065] (-412.638) * [-414.946] (-423.912) (-413.888) (-410.830) -- 0:00:02
968000 -- (-414.944) (-415.784) (-419.142) [-413.550] * (-411.119) (-421.346) [-416.945] (-412.746) -- 0:00:02
968500 -- (-418.423) (-413.063) [-409.985] (-413.074) * (-415.808) [-414.183] (-413.204) (-414.345) -- 0:00:02
969000 -- (-411.617) [-409.001] (-412.215) (-414.857) * (-411.246) (-412.837) (-415.516) [-410.421] -- 0:00:01
969500 -- (-416.940) (-410.584) [-412.767] (-415.624) * [-411.585] (-413.575) (-416.965) (-417.275) -- 0:00:01
970000 -- (-417.088) (-411.396) (-410.789) [-412.842] * (-413.724) (-414.800) (-413.703) [-415.188] -- 0:00:01
Average standard deviation of split frequencies: 0.008438
970500 -- (-413.587) (-413.495) (-412.021) [-417.530] * (-413.002) (-412.942) [-410.585] (-413.855) -- 0:00:01
971000 -- [-418.703] (-417.392) (-410.052) (-420.746) * (-412.422) (-414.470) [-411.389] (-411.399) -- 0:00:01
971500 -- (-412.604) [-413.730] (-414.681) (-413.712) * (-413.395) [-418.383] (-417.263) (-411.619) -- 0:00:01
972000 -- (-413.616) (-412.185) [-413.337] (-416.494) * (-413.336) (-412.038) (-415.746) [-413.878] -- 0:00:01
972500 -- (-413.287) [-415.215] (-410.634) (-416.164) * (-415.983) (-414.571) [-414.206] (-411.598) -- 0:00:01
973000 -- (-415.752) [-411.676] (-416.797) (-414.793) * [-412.611] (-415.618) (-416.065) (-418.191) -- 0:00:01
973500 -- (-416.893) [-412.153] (-416.861) (-416.940) * (-411.624) [-414.340] (-410.144) (-416.484) -- 0:00:01
974000 -- (-415.608) (-415.855) [-413.363] (-418.000) * [-412.991] (-413.863) (-414.259) (-417.275) -- 0:00:01
974500 -- (-414.655) (-414.562) [-413.316] (-414.199) * (-411.806) (-414.912) [-410.407] (-417.482) -- 0:00:01
975000 -- (-413.962) (-417.438) [-415.633] (-416.926) * (-413.339) [-413.126] (-413.890) (-416.856) -- 0:00:01
Average standard deviation of split frequencies: 0.008302
975500 -- (-415.550) [-416.633] (-420.780) (-415.888) * [-410.015] (-410.714) (-411.071) (-414.373) -- 0:00:01
976000 -- (-416.736) (-413.209) [-413.033] (-416.039) * (-411.954) (-413.985) [-413.729] (-414.843) -- 0:00:01
976500 -- (-413.612) (-413.242) [-411.840] (-413.652) * [-411.389] (-412.744) (-415.000) (-414.694) -- 0:00:01
977000 -- (-417.700) [-414.761] (-414.586) (-415.367) * (-416.999) (-414.506) [-412.039] (-413.987) -- 0:00:01
977500 -- (-414.338) (-412.565) (-411.084) [-411.555] * (-413.411) (-417.844) [-410.425] (-415.719) -- 0:00:01
978000 -- [-415.492] (-417.364) (-413.207) (-414.351) * (-412.936) [-414.727] (-412.816) (-410.067) -- 0:00:01
978500 -- (-416.155) [-412.616] (-415.619) (-415.361) * [-416.340] (-415.945) (-415.388) (-414.350) -- 0:00:01
979000 -- [-416.169] (-414.408) (-414.830) (-416.678) * (-417.986) (-415.749) (-419.118) [-414.451] -- 0:00:01
979500 -- (-413.354) (-413.610) (-413.851) [-413.275] * (-415.721) [-414.061] (-416.387) (-414.696) -- 0:00:01
980000 -- [-418.678] (-415.607) (-412.257) (-414.667) * (-416.715) [-414.499] (-417.214) (-414.047) -- 0:00:01
Average standard deviation of split frequencies: 0.008142
980500 -- (-415.495) [-411.372] (-411.119) (-413.458) * [-411.409] (-414.628) (-416.238) (-418.203) -- 0:00:01
981000 -- [-413.461] (-415.262) (-418.702) (-412.671) * (-410.945) (-415.385) (-417.096) [-412.782] -- 0:00:01
981500 -- (-416.914) (-410.392) (-409.517) [-412.612] * (-417.374) (-410.197) [-411.513] (-414.406) -- 0:00:01
982000 -- [-411.916] (-413.269) (-412.026) (-413.523) * [-415.708] (-414.493) (-416.302) (-413.613) -- 0:00:01
982500 -- (-411.977) (-413.151) (-415.882) [-413.472] * (-416.438) (-414.642) [-412.147] (-413.297) -- 0:00:01
983000 -- (-415.032) (-418.659) [-413.427] (-411.456) * (-416.041) (-419.039) (-413.153) [-416.513] -- 0:00:01
983500 -- (-411.561) (-412.062) (-413.451) [-414.263] * (-419.331) [-413.241] (-417.549) (-415.342) -- 0:00:01
984000 -- (-410.477) (-421.367) (-410.767) [-413.299] * [-417.061] (-412.735) (-411.267) (-411.002) -- 0:00:01
984500 -- (-415.111) (-415.642) [-414.070] (-414.948) * (-418.407) (-411.824) (-413.267) [-414.253] -- 0:00:00
985000 -- (-414.082) (-414.411) [-414.018] (-412.572) * (-416.813) [-412.774] (-410.649) (-415.837) -- 0:00:00
Average standard deviation of split frequencies: 0.008277
985500 -- (-412.862) (-415.785) [-411.566] (-417.518) * [-414.218] (-416.071) (-411.410) (-411.750) -- 0:00:00
986000 -- (-416.741) (-414.809) [-411.715] (-414.578) * [-415.974] (-415.881) (-410.541) (-414.692) -- 0:00:00
986500 -- (-418.593) (-414.718) (-415.822) [-414.040] * (-416.229) [-419.229] (-416.947) (-413.688) -- 0:00:00
987000 -- (-421.460) (-412.769) [-412.998] (-411.930) * (-412.734) (-418.470) [-413.584] (-413.426) -- 0:00:00
987500 -- (-414.457) (-416.826) (-413.874) [-413.753] * [-415.726] (-416.456) (-413.434) (-411.344) -- 0:00:00
988000 -- (-413.641) (-412.213) [-411.487] (-415.783) * [-415.676] (-415.257) (-412.997) (-419.094) -- 0:00:00
988500 -- (-414.577) (-410.653) [-416.612] (-412.173) * (-412.388) (-418.347) (-414.560) [-413.056] -- 0:00:00
989000 -- (-414.357) (-414.001) [-412.326] (-414.195) * (-414.842) (-417.710) [-414.847] (-416.346) -- 0:00:00
989500 -- (-413.272) [-411.392] (-413.575) (-414.074) * (-416.637) (-415.781) (-416.557) [-419.163] -- 0:00:00
990000 -- (-413.283) [-412.285] (-413.259) (-414.620) * (-414.901) (-414.225) (-414.151) [-409.330] -- 0:00:00
Average standard deviation of split frequencies: 0.008208
990500 -- (-415.134) (-415.036) (-412.730) [-414.044] * (-417.839) [-413.443] (-414.002) (-417.408) -- 0:00:00
991000 -- (-414.571) (-410.450) [-414.130] (-416.112) * (-419.959) (-415.456) (-418.666) [-413.263] -- 0:00:00
991500 -- (-414.819) (-416.043) (-415.849) [-416.076] * [-412.601] (-417.042) (-418.157) (-412.409) -- 0:00:00
992000 -- (-411.970) (-416.158) (-411.982) [-412.863] * (-416.708) (-414.187) [-412.413] (-415.310) -- 0:00:00
992500 -- (-417.536) (-418.184) (-412.538) [-417.108] * (-416.692) (-415.580) (-412.393) [-415.484] -- 0:00:00
993000 -- (-416.884) [-412.823] (-414.426) (-413.711) * (-416.210) (-412.091) (-414.325) [-412.856] -- 0:00:00
993500 -- [-415.325] (-411.003) (-413.706) (-414.467) * [-413.843] (-411.895) (-414.467) (-411.764) -- 0:00:00
994000 -- (-413.833) (-418.961) [-414.941] (-414.290) * (-413.394) (-417.802) [-410.997] (-411.368) -- 0:00:00
994500 -- (-413.522) [-410.829] (-414.271) (-411.393) * [-413.903] (-419.373) (-412.376) (-413.157) -- 0:00:00
995000 -- [-412.382] (-411.771) (-410.063) (-411.615) * (-414.633) (-416.439) (-414.040) [-410.000] -- 0:00:00
Average standard deviation of split frequencies: 0.008224
995500 -- (-413.058) (-412.084) (-413.732) [-413.445] * (-418.801) (-414.726) [-415.181] (-414.320) -- 0:00:00
996000 -- [-414.171] (-411.281) (-414.279) (-411.203) * (-417.011) (-418.287) (-412.280) [-414.939] -- 0:00:00
996500 -- (-413.549) (-411.908) (-418.840) [-410.510] * (-415.889) [-417.605] (-414.490) (-424.181) -- 0:00:00
997000 -- (-414.940) (-412.866) (-415.905) [-413.904] * (-423.843) (-414.981) [-412.429] (-414.078) -- 0:00:00
997500 -- (-415.947) (-412.704) (-413.237) [-410.656] * [-414.773] (-415.590) (-415.401) (-417.037) -- 0:00:00
998000 -- (-423.242) (-416.447) [-414.096] (-411.871) * (-410.797) [-412.773] (-414.696) (-416.147) -- 0:00:00
998500 -- (-414.377) (-410.525) (-415.013) [-411.857] * [-410.691] (-411.993) (-413.562) (-415.363) -- 0:00:00
999000 -- (-417.090) [-413.113] (-421.888) (-414.156) * (-414.374) (-411.916) [-411.906] (-411.766) -- 0:00:00
999500 -- (-413.292) (-412.246) (-415.163) [-412.165] * (-412.274) (-413.416) (-411.416) [-412.316] -- 0:00:00
1000000 -- (-415.074) [-413.257] (-416.956) (-412.467) * (-412.332) (-411.643) (-415.511) [-412.888] -- 0:00:00
Average standard deviation of split frequencies: 0.007891
Analysis completed in 1 mins 4 seconds
Analysis used 63.41 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -406.52
Likelihood of best state for "cold" chain of run 2 was -407.00
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 62 %) Dirichlet(Revmat{all})
95.9 % ( 95 %) Slider(Revmat{all})
40.3 % ( 27 %) Dirichlet(Pi{all})
39.4 % ( 22 %) Slider(Pi{all})
63.1 % ( 37 %) Multiplier(Alpha{1,2})
80.3 % ( 60 %) Multiplier(Alpha{3})
33.3 % ( 23 %) Slider(Pinvar{all})
96.2 % ( 98 %) ExtSPR(Tau{all},V{all})
68.0 % ( 62 %) ExtTBR(Tau{all},V{all})
96.9 % ( 97 %) NNI(Tau{all},V{all})
86.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
91.7 % ( 91 %) Nodeslider(V{all})
30.9 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 75 %) Dirichlet(Revmat{all})
96.0 % ( 95 %) Slider(Revmat{all})
39.3 % ( 31 %) Dirichlet(Pi{all})
39.7 % ( 40 %) Slider(Pi{all})
63.0 % ( 36 %) Multiplier(Alpha{1,2})
79.6 % ( 49 %) Multiplier(Alpha{3})
32.9 % ( 26 %) Slider(Pinvar{all})
96.2 % ( 96 %) ExtSPR(Tau{all},V{all})
68.0 % ( 68 %) ExtTBR(Tau{all},V{all})
96.9 % ( 96 %) NNI(Tau{all},V{all})
86.6 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
91.8 % ( 95 %) Nodeslider(V{all})
30.7 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.79 0.61 0.46
2 | 166396 0.81 0.64
3 | 167084 167531 0.82
4 | 165882 166752 166355
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.79 0.62 0.47
2 | 166933 0.81 0.64
3 | 166789 165837 0.83
4 | 166678 166595 167168
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -411.84
| 1 |
| 2 |
| |
| 2 2 1 |
| 1 1 1 2 2 2 |
|2 2 1 2 2 * 2 2 2 1 1 * 22 |
| 1 2 2 11 11 222 2 2 2 1 |
|1 211 2 1 2 2 1 1 * 112 2211 2 1 1 22 1|
| 2 1 2 222 1 2 2 11 2 2 12 1 1 |
| 1 2 1 2 2 1 112 2 2 1 112 112|
| 21 1 1 21 1 2 2 |
| 1 1 2 |
| 1 1 |
| 1 2 |
| 1 11 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -414.64
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -411.72 -417.54
2 -411.70 -415.79
--------------------------------------
TOTAL -411.71 -417.00
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.838811 0.083508 0.329240 1.409293 0.804947 1340.47 1420.74 1.000
r(A<->C){all} 0.105713 0.010935 0.000027 0.330031 0.073202 275.05 279.75 1.001
r(A<->G){all} 0.221933 0.024432 0.000287 0.522663 0.193656 360.31 372.17 1.000
r(A<->T){all} 0.127218 0.013256 0.000010 0.365199 0.093152 307.98 309.68 1.000
r(C<->G){all} 0.132990 0.014589 0.000035 0.376066 0.095357 334.91 343.21 1.000
r(C<->T){all} 0.226804 0.026222 0.000001 0.533311 0.194314 96.56 131.32 1.000
r(G<->T){all} 0.185342 0.025216 0.000131 0.510086 0.142326 148.73 237.22 1.002
pi(A){all} 0.280476 0.000695 0.230082 0.331382 0.279646 1192.50 1247.37 1.000
pi(C){all} 0.273819 0.000709 0.217919 0.322453 0.273286 1131.61 1234.99 1.000
pi(G){all} 0.268870 0.000668 0.219204 0.318395 0.268811 1407.31 1434.24 1.001
pi(T){all} 0.176835 0.000513 0.133223 0.220172 0.175524 1247.66 1363.54 1.000
alpha{1,2} 0.265678 0.056270 0.033468 0.707130 0.197346 1349.85 1385.22 1.000
alpha{3} 0.336165 0.182527 0.000106 1.172549 0.176505 1066.48 1210.65 1.000
pinvar{all} 0.978618 0.000196 0.952469 0.997675 0.981675 1218.03 1299.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- ..*..*
9 -- .****.
10 -- ..****
11 -- .**...
12 -- .**.**
13 -- .*..*.
14 -- .*...*
15 -- .*.*..
16 -- ....**
17 -- ..*.*.
18 -- .***.*
19 -- ..**..
20 -- ...*.*
21 -- .*.***
22 -- .**.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 465 0.154897 0.007066 0.149900 0.159893 2
8 452 0.150566 0.012248 0.141905 0.159227 2
9 448 0.149234 0.006595 0.144570 0.153897 2
10 444 0.147901 0.014133 0.137908 0.157895 2
11 436 0.145237 0.006595 0.140573 0.149900 2
12 435 0.144903 0.009893 0.137908 0.151899 2
13 434 0.144570 0.002827 0.142572 0.146569 2
14 434 0.144570 0.004711 0.141239 0.147901 2
15 432 0.143904 0.008480 0.137908 0.149900 2
16 431 0.143571 0.001413 0.142572 0.144570 2
17 429 0.142905 0.000471 0.142572 0.143238 2
18 425 0.141572 0.005182 0.137908 0.145237 2
19 408 0.135909 0.013191 0.126582 0.145237 2
20 403 0.134244 0.008009 0.128581 0.139907 2
21 395 0.131579 0.010835 0.123917 0.139241 2
22 281 0.093604 0.014604 0.083278 0.103931 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.077010 0.006184 0.000054 0.235432 0.051804 1.000 2
length{all}[2] 0.207021 0.019535 0.000509 0.472630 0.180996 1.001 2
length{all}[3] 0.079156 0.006598 0.000076 0.246676 0.052590 1.001 2
length{all}[4] 0.077657 0.006476 0.000002 0.239806 0.052399 1.000 2
length{all}[5] 0.078073 0.006424 0.000032 0.236175 0.053838 1.000 2
length{all}[6] 0.077911 0.007043 0.000006 0.248974 0.051738 1.000 2
length{all}[7] 0.078710 0.007957 0.000080 0.249048 0.047524 0.999 2
length{all}[8] 0.084638 0.007721 0.000020 0.255228 0.059902 1.019 2
length{all}[9] 0.082128 0.008427 0.000017 0.237807 0.055201 0.998 2
length{all}[10] 0.084474 0.007648 0.000115 0.253523 0.058514 0.998 2
length{all}[11] 0.084133 0.006849 0.000410 0.259677 0.060805 1.006 2
length{all}[12] 0.076116 0.006074 0.000123 0.247931 0.051365 0.998 2
length{all}[13] 0.079291 0.006015 0.000035 0.244124 0.056812 1.001 2
length{all}[14] 0.087343 0.007882 0.000523 0.255915 0.059369 1.002 2
length{all}[15] 0.079410 0.006226 0.000072 0.234193 0.053509 0.998 2
length{all}[16] 0.081144 0.007477 0.000010 0.268980 0.054900 0.998 2
length{all}[17] 0.071619 0.004473 0.000038 0.211508 0.050102 0.999 2
length{all}[18] 0.080337 0.007320 0.000059 0.254379 0.052037 0.998 2
length{all}[19] 0.085195 0.007225 0.001137 0.234466 0.056765 0.999 2
length{all}[20] 0.079153 0.007066 0.000228 0.236701 0.050838 0.998 2
length{all}[21] 0.078057 0.007315 0.000001 0.242544 0.050523 1.003 2
length{all}[22] 0.085909 0.008280 0.000036 0.244689 0.060849 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007891
Maximum standard deviation of split frequencies = 0.014604
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.019
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|--------------------- C3 (3)
+
|--------------------- C4 (4)
|
|--------------------- C5 (5)
|
\--------------------- C6 (6)
|------------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 285
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 46 patterns at 95 / 95 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 46 patterns at 95 / 95 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
44896 bytes for conP
4048 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.060719 0.034321 0.109812 0.036485 0.016659 0.073495 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -425.513849
Iterating by ming2
Initial: fx= 425.513849
x= 0.06072 0.03432 0.10981 0.03649 0.01666 0.07350 0.30000 1.30000
1 h-m-p 0.0000 0.0002 213.6856 +++ 417.527108 m 0.0002 14 | 1/8
2 h-m-p 0.0000 0.0000 9437.4028 ++ 410.015300 m 0.0000 25 | 2/8
3 h-m-p 0.0003 0.0015 59.5846 ++ 402.917963 m 0.0015 36 | 3/8
4 h-m-p 0.0001 0.0004 57.4295 ++ 400.414039 m 0.0004 47 | 4/8
5 h-m-p 0.0001 0.0004 140.1393 ++ 396.887030 m 0.0004 58 | 5/8
6 h-m-p 0.0614 5.1291 0.7878 +++YCCCC 394.684350 4 2.5880 79 | 5/8
7 h-m-p 1.4878 8.0000 1.3704 +YCC 393.618460 2 4.3465 97 | 5/8
8 h-m-p 1.6000 8.0000 0.3794 CYCCC 393.451138 4 1.0443 116 | 5/8
9 h-m-p 1.0132 8.0000 0.3911 ++ 393.164935 m 8.0000 130 | 5/8
10 h-m-p 0.7262 8.0000 4.3085 ++ 392.555540 m 8.0000 144 | 5/8
11 h-m-p 1.6000 8.0000 2.6621 CYCC 392.480264 3 1.3886 160 | 5/8
12 h-m-p 1.2894 8.0000 2.8668 ++ 392.404134 m 8.0000 171 | 5/8
13 h-m-p 1.0834 8.0000 21.1682 ++ 392.291722 m 8.0000 182 | 5/8
14 h-m-p 1.6000 8.0000 16.6614 CYC 392.281453 2 1.6600 196 | 5/8
15 h-m-p 1.4678 8.0000 18.8433 ++ 392.264128 m 8.0000 207 | 5/8
16 h-m-p 1.3791 6.8955 104.8291 ++ 392.245212 m 6.8955 218 | 6/8
17 h-m-p 1.6000 8.0000 54.7123 YC 392.243123 1 3.4655 230 | 6/8
18 h-m-p 0.5334 2.6668 95.5847 ++ 392.240565 m 2.6668 241 | 7/8
19 h-m-p 1.6000 8.0000 0.0001 Y 392.240556 0 1.0167 252 | 7/8
20 h-m-p 1.6000 8.0000 0.0000 C 392.240556 0 1.3419 264
Out..
lnL = -392.240556
265 lfun, 265 eigenQcodon, 1590 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.069255 0.089785 0.075157 0.044061 0.067039 0.102943 999.000000 0.729679 0.213047
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.032891
np = 9
lnL0 = -428.530276
Iterating by ming2
Initial: fx= 428.530276
x= 0.06925 0.08978 0.07516 0.04406 0.06704 0.10294 951.42857 0.72968 0.21305
1 h-m-p 0.0000 0.0005 197.5594 +++ 407.961480 m 0.0005 15 | 1/9
2 h-m-p 0.0000 0.0001 582.0741 ++ 399.962871 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0001 79.7170 ++ 399.352289 m 0.0001 39 | 3/9
4 h-m-p 0.0004 0.0029 12.0418 ++ 398.200535 m 0.0029 51 | 4/9
5 h-m-p 0.0001 0.0004 52.3194 ++ 396.211008 m 0.0004 63 | 5/9
6 h-m-p 0.0007 0.1965 5.1757 +++++ 393.983862 m 0.1965 78 | 6/9
7 h-m-p 1.3362 6.6808 0.1313 +YCC 393.062814 2 5.8417 94 | 6/9
8 h-m-p 1.6000 8.0000 0.0000 Y 393.062814 0 3.2491 109 | 6/9
9 h-m-p 1.6000 8.0000 0.0000 C 393.062814 0 2.2686 124 | 6/9
10 h-m-p 0.5689 8.0000 0.0000 ++ 393.062814 m 8.0000 139 | 6/9
11 h-m-p 1.1804 8.0000 0.0001 ++ 393.062814 m 8.0000 154 | 6/9
12 h-m-p 0.0160 8.0000 0.1422 +++Y 393.062813 0 2.0201 172 | 6/9
13 h-m-p 1.6000 8.0000 0.1418 ++ 393.062808 m 8.0000 187 | 6/9
14 h-m-p 0.0024 0.0973 474.2595 +++ 393.062600 m 0.0973 203 | 7/9
15 h-m-p 0.0558 8.0000 0.0012 ++C 393.062599 0 0.8493 217 | 7/9
16 h-m-p 1.6000 8.0000 0.0000 --C 393.062599 0 0.0250 233
Out..
lnL = -393.062599
234 lfun, 702 eigenQcodon, 2808 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.018239 0.056463 0.038234 0.073272 0.071405 0.065337 999.000000 1.218408 0.117924 0.470670 1118.986412
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000172
np = 11
lnL0 = -404.589546
Iterating by ming2
Initial: fx= 404.589546
x= 0.01824 0.05646 0.03823 0.07327 0.07140 0.06534 951.42857 1.21841 0.11792 0.47067 951.42857
1 h-m-p 0.0000 0.0007 56.3138 ++++ 402.219602 m 0.0007 18 | 1/11
2 h-m-p 0.0003 0.0015 55.7965 ++ 399.986348 m 0.0015 32 | 2/11
3 h-m-p 0.0003 0.0013 48.5296 ++ 396.726319 m 0.0013 46 | 3/11
4 h-m-p 0.0043 0.0214 5.9754 ++ 396.213228 m 0.0214 60 | 4/11
5 h-m-p 0.0000 0.0001 26.1145 ++ 396.146047 m 0.0001 74 | 5/11
6 h-m-p 0.0004 0.2076 9.5473 ++++YCYYYYCYCY 392.448690 10 0.1728 104 | 5/11
7 h-m-p 1.6000 8.0000 0.0474 ----------------.. | 5/11
8 h-m-p 0.0000 0.0142 2.3591 +++YCC 392.444920 2 0.0013 158 | 5/11
9 h-m-p 0.0160 8.0000 0.2513 ++++CCCC 392.322149 3 4.2684 182 | 5/11
10 h-m-p 1.6000 8.0000 0.5018 CYC 392.293269 2 0.4866 205 | 5/11
11 h-m-p 0.7985 8.0000 0.3058 +CCC 392.264476 2 4.0768 230 | 5/11
12 h-m-p 1.6000 8.0000 0.2887 CYC 392.256838 2 1.7402 253 | 5/11
13 h-m-p 1.0039 8.0000 0.5003 +YC 392.250284 1 2.8256 275 | 5/11
14 h-m-p 1.6000 8.0000 0.4482 YCC 392.247143 2 2.7548 298 | 5/11
15 h-m-p 0.9553 4.7764 0.7882 +YC 392.244724 1 2.9894 320 | 5/11
16 h-m-p 0.2699 1.3497 1.0392 ++ 392.243510 m 1.3497 340 | 6/11
17 h-m-p 0.4474 8.0000 3.1299 +YCYC 392.241407 3 3.6573 359 | 6/11
18 h-m-p 1.6000 8.0000 1.1930 CC 392.241078 1 1.3786 375 | 6/11
19 h-m-p 1.6000 8.0000 0.9665 ++ 392.240929 m 8.0000 389 | 6/11
20 h-m-p 1.6000 8.0000 2.1105 +YC 392.240900 1 4.1345 410 | 6/11
21 h-m-p 1.6000 8.0000 1.3950 C 392.240893 0 1.4479 424 | 6/11
22 h-m-p 1.4512 8.0000 1.3918 +Y 392.240889 0 6.4716 439 | 6/11
23 h-m-p 1.6000 8.0000 1.4979 C 392.240888 0 1.4635 453 | 6/11
24 h-m-p 1.5112 8.0000 1.4507 +C 392.240888 0 6.0448 468 | 6/11
25 h-m-p 1.6000 8.0000 1.8904 C 392.240888 0 1.6000 482 | 6/11
26 h-m-p 1.6000 8.0000 1.3685 Y 392.240888 0 3.7835 496 | 6/11
27 h-m-p 1.6000 8.0000 2.4028 Y 392.240888 0 3.1529 510 | 6/11
28 h-m-p 1.6000 8.0000 1.2774 C 392.240888 0 0.5971 524 | 6/11
29 h-m-p 0.4127 8.0000 1.8481 C 392.240888 0 0.4349 538 | 6/11
30 h-m-p 1.6000 8.0000 0.3033 ++ 392.240888 m 8.0000 552 | 6/11
31 h-m-p 0.0767 0.7812 31.6319 C 392.240888 0 0.1100 571 | 6/11
32 h-m-p 1.6000 8.0000 0.1966 Y 392.240888 0 3.7180 585 | 6/11
33 h-m-p 0.1794 5.0335 4.0727 +++ 392.240888 m 5.0335 605 | 6/11
34 h-m-p 0.6469 6.3761 31.6873 --------C 392.240888 0 0.0000 627 | 6/11
35 h-m-p 0.3544 8.0000 0.0002 +Y 392.240888 0 2.9345 642 | 6/11
36 h-m-p 1.6000 8.0000 0.0002 C 392.240888 0 1.2917 661 | 6/11
37 h-m-p 0.5474 8.0000 0.0006 ++ 392.240888 m 8.0000 680 | 6/11
38 h-m-p 0.2011 8.0000 0.0228 ++C 392.240888 0 2.9288 701 | 6/11
39 h-m-p 1.6000 8.0000 0.0378 ++ 392.240888 m 8.0000 720 | 6/11
40 h-m-p 0.0027 1.3438 150.5774 +++YY 392.240875 1 0.1720 743 | 6/11
41 h-m-p 0.0649 0.4423 398.9775 YY 392.240863 1 0.0649 758 | 6/11
42 h-m-p 0.3500 2.0346 73.9932 Y 392.240862 0 0.0875 772 | 6/11
43 h-m-p 1.6000 8.0000 2.3196 Y 392.240860 0 1.6000 786 | 6/11
44 h-m-p 1.0904 8.0000 3.4038 Y 392.240860 0 0.7902 800 | 6/11
45 h-m-p 1.6000 8.0000 0.3344 ----------Y 392.240860 0 0.0000 824 | 6/11
46 h-m-p 0.0160 8.0000 2.4952 +Y 392.240860 0 0.0428 844 | 6/11
47 h-m-p 1.6000 8.0000 0.0358 ++ 392.240859 m 8.0000 858 | 6/11
48 h-m-p 0.3929 8.0000 0.7284 +C 392.240859 0 2.2335 878 | 6/11
49 h-m-p 1.6000 8.0000 0.1861 ++ 392.240857 m 8.0000 897 | 6/11
50 h-m-p 0.1723 8.0000 8.6410 +C 392.240843 0 0.7218 917 | 6/11
51 h-m-p 0.4889 3.3756 12.7563 +YY 392.240789 1 1.4529 933 | 6/11
52 h-m-p 0.1034 0.5170 43.0595 ++ 392.240658 m 0.5170 947 | 7/11
53 h-m-p 0.3319 4.1003 12.0995 ++ 392.240580 m 4.1003 961 | 8/11
54 h-m-p 1.6000 8.0000 0.2722 YC 392.240556 1 0.9358 976 | 8/11
55 h-m-p 1.6000 8.0000 0.0701 ++ 392.240556 m 8.0000 993 | 8/11
56 h-m-p 0.1677 8.0000 3.3432 ++C 392.240556 0 2.6830 1012 | 8/11
57 h-m-p 1.6000 8.0000 1.0578 C 392.240556 0 2.1355 1026 | 8/11
58 h-m-p 1.6000 8.0000 0.8415 C 392.240556 0 2.4240 1040 | 8/11
59 h-m-p 0.8566 8.0000 2.3814 ++ 392.240556 m 8.0000 1057 | 8/11
60 h-m-p 1.6000 8.0000 0.0028 Y 392.240556 0 0.7358 1071 | 8/11
61 h-m-p 0.0160 8.0000 0.7738 +++++ 392.240556 m 8.0000 1091 | 8/11
62 h-m-p 0.2860 1.4301 3.8547 ++ 392.240556 m 1.4301 1108 | 8/11
63 h-m-p -0.0000 -0.0000 3.8125
h-m-p: -0.00000000e+00 -0.00000000e+00 3.81251254e+00 392.240556
.. | 8/11
64 h-m-p 0.0160 8.0000 0.0011 ---Y 392.240556 0 0.0000 1136 | 8/11
65 h-m-p 1.6000 8.0000 0.0000 -Y 392.240556 0 0.0781 1154
Out..
lnL = -392.240556
1155 lfun, 4620 eigenQcodon, 20790 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -401.834847 S = -399.337651 -4.734418
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:07
did 20 / 46 patterns 0:07
did 30 / 46 patterns 0:07
did 40 / 46 patterns 0:07
did 46 / 46 patterns 0:07
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.028579 0.061499 0.021083 0.104854 0.091971 0.049493 999.000000 0.623881 1.066726
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.035110
np = 9
lnL0 = -421.835707
Iterating by ming2
Initial: fx= 421.835707
x= 0.02858 0.06150 0.02108 0.10485 0.09197 0.04949 951.42857 0.62388 1.06673
1 h-m-p 0.0000 0.0002 200.4594 +++ 412.171349 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0000 1977.2589 ++ 409.113677 m 0.0000 27 | 2/9
3 h-m-p 0.0001 0.0006 62.4418 ++ 403.340105 m 0.0006 39 | 3/9
4 h-m-p 0.0002 0.0012 55.2653 ++ 395.640236 m 0.0012 51 | 4/9
5 h-m-p 0.0001 0.0003 50.5108 ++ 394.430835 m 0.0003 63 | 5/9
6 h-m-p 0.0025 1.2424 1.7549 ++++
QuantileBeta(0.85, 2.52065, 0.00500) = 1.000000e+00 2000 rounds
+ 393.079311 m 1.2424 78
QuantileBeta(0.85, 2.52065, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52065, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52065, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52065, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52065, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52065, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52065, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52065, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.52065, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
7 h-m-p 1.6000 8.0000 0.0488
QuantileBeta(0.85, 2.44257, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.20833, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35998, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 2.35723, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.28278, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35379, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 2.31829, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
C 393.062815 3 3.4223 95
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35377, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35351, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
8 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.35358, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35340, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35360, 0.00500) = 1.000000e+00 2000 rounds
Y 393.062815 0 0.9648 110
QuantileBeta(0.85, 2.35360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35348, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35360, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
9 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35362, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
C 393.062815 0 2.3115 125
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35348, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
10 h-m-p 0.6034 8.0000 0.0000
QuantileBeta(0.85, 2.35361, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35362, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
+ 393.062815 m 8.0000 140
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35377, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35352, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35364, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
11 h-m-p 1.0925 8.0000 0.0002
QuantileBeta(0.85, 2.35366, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35370, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
+ 393.062815 m 8.0000 155
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35387, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35362, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35374, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
12 h-m-p 0.0293 8.0000 0.0416
QuantileBeta(0.85, 2.35384, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.35412, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.35523, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.35969, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.37752, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36041, 0.00500) = 1.000000e+00 2000 rounds
C 393.062814 0 2.0996 173
QuantileBeta(0.85, 2.36041, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36041, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36041, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36041, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36041, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36041, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36041, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36041, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36041, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36053, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36028, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.36041, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
13 h-m-p 1.6000 8.0000 0.0434
QuantileBeta(0.85, 2.36527, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37987, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.38473, 0.00500) = 1.000000e+00 2000 rounds
+ 393.062813 m 8.0000 188
QuantileBeta(0.85, 2.38473, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38473, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38473, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38473, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38473, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38473, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38473, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38473, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38473, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38486, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38461, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.38473, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
14 h-m-p 0.0009 0.1293 365.5266
QuantileBeta(0.85, 2.40905, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.48199, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 2.77375, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.94080, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 5.69684, 0.00500) = 1.000000e+00 2000 rounds
+ 393.062600 m 0.1293 205
QuantileBeta(0.85, 5.69684, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.69684, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.69684, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.69684, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.69684, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.69684, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.69684, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.69685, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.69684, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
15 h-m-p 1.6000 8.0000 0.3485
QuantileBeta(0.85, 5.13929, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.46665, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.17612, 0.00500) = 1.000000e+00 2000 rounds
C 393.062599 0 1.4943 217
QuantileBeta(0.85, 5.17612, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.17612, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.17612, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.17612, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.17612, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.17612, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.17612, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.17612, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.17630, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.17593, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.17612, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
16 h-m-p 0.9514 8.0000 0.5473
QuantileBeta(0.85, 5.69684, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.25903, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 9.55457, 0.00500) = 1.000000e+00 2000 rounds
+ 393.062599 m 8.0000 231
QuantileBeta(0.85, 9.55457, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.55457, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.55457, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.55457, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.55457, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.55457, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.55457, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.55457, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.55485, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.55430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.55457, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
17 h-m-p 1.6000 8.0000 1.6277
QuantileBeta(0.85, 12.15890, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 19.97187, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 22.57620, 0.00500) = 1.000000e+00 2000 rounds
+ 393.062599 m 8.0000 245
QuantileBeta(0.85, 22.57620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.57620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.57620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.57620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.57620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.57620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.57620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.57621, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 22.57620, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
18 h-m-p 0.5607 3.2907 23.2245
QuantileBeta(0.85, 35.59782, 0.00500) = 1.000000e+00 2000 rounds
++ 393.062599 m 3.2907 257 | 7/9
19 h-m-p 1.6000 8.0000 8.0476 -------C 393.062599 0 0.0000 276 | 7/9
20 h-m-p 0.1023 0.5117 0.0004 ++ 393.062599 m 0.5117 288 | 8/9
21 h-m-p 0.6761 8.0000 0.0000 ----Y 393.062599 0 0.0007 306
Out..
lnL = -393.062599
307 lfun, 3377 eigenQcodon, 18420 P(t)
Time used: 0:13
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.080947 0.026698 0.043366 0.083194 0.056897 0.065001 999.000000 0.900000 1.140037 1.434754 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000312
np = 11
lnL0 = -403.351203
Iterating by ming2
Initial: fx= 403.351203
x= 0.08095 0.02670 0.04337 0.08319 0.05690 0.06500 951.42857 0.90000 1.14004 1.43475 951.42857
1 h-m-p 0.0000 0.0024 72.7737 +++CYYYCYYYCC 396.193699 10 0.0022 33 | 0/11
2 h-m-p 0.0002 0.0008 30.4147 ++ 396.105423 m 0.0008 47 | 1/11
3 h-m-p 0.0002 0.0010 27.6397 ++ 395.498350 m 0.0010 61 | 2/11
4 h-m-p 0.0023 0.0115 4.6986 ++ 394.502573 m 0.0115 75 | 3/11
5 h-m-p 0.0011 0.0053 3.7003 ++ 394.017197 m 0.0053 89 | 4/11
6 h-m-p 0.0143 0.0716 0.8659 +YYYCCC 393.753412 5 0.0536 111 | 4/11
7 h-m-p 0.0882 4.2256 0.5260 --------------.. | 4/11
8 h-m-p 0.0000 0.0001 61.9634 ++ 393.293216 m 0.0001 165 | 5/11
9 h-m-p 0.0059 0.1899 0.8864 ++YYYYYYYYYC 393.228654 9 0.0945 190 | 5/11
10 h-m-p 0.0519 0.2597 0.4002 +YCYYC 393.038439 4 0.1682 217 | 5/11
11 h-m-p 0.1879 0.9397 0.0910 CYCCC 392.827568 4 0.3369 244 | 5/11
12 h-m-p 0.0499 3.8168 0.6141 +CYCCC 392.529435 4 0.1470 273 | 5/11
13 h-m-p 1.6000 8.0000 0.0099 ++ 392.378640 m 8.0000 293 | 5/11
14 h-m-p 1.6000 8.0000 0.0104 CYC 392.353585 2 1.8181 316 | 5/11
15 h-m-p 0.7387 8.0000 0.0255 +YCCC 392.309836 3 2.0358 342 | 5/11
16 h-m-p 1.6000 8.0000 0.0148 CYC 392.289278 2 2.2273 365 | 5/11
17 h-m-p 1.0248 8.0000 0.0322 YCCC 392.272262 3 1.9574 390 | 5/11
18 h-m-p 1.6000 8.0000 0.0269 +YCCC 392.257784 3 4.9584 416 | 5/11
19 h-m-p 1.6000 8.0000 0.0685 YYC 392.251202 2 1.3269 438 | 5/11
20 h-m-p 1.6000 8.0000 0.0495 ++ 392.242858 m 8.0000 458 | 5/11
21 h-m-p 0.3324 1.6618 0.1426 ++ 392.241229 m 1.6618 478 | 6/11
22 h-m-p 1.5547 8.0000 0.0537 YC 392.240888 1 0.8489 499 | 6/11
23 h-m-p 1.6000 8.0000 0.0002 Y 392.240888 0 1.0445 518 | 6/11
24 h-m-p 1.6000 8.0000 0.0000 +Y 392.240888 0 4.3562 538 | 6/11
25 h-m-p 0.7955 8.0000 0.0000 ++ 392.240888 m 8.0000 557 | 6/11
26 h-m-p 0.2200 8.0000 0.0015 ++C 392.240888 0 3.1042 578 | 6/11
27 h-m-p 1.6000 8.0000 0.0027 ++ 392.240888 m 8.0000 597 | 6/11
28 h-m-p 0.0023 0.5810 9.2567 ++++ 392.240860 m 0.5810 618 | 6/11
29 h-m-p 0.0000 0.0000 21.6445
h-m-p: 2.59549437e-19 1.29774718e-18 2.16444932e+01 392.240860
.. | 6/11
30 h-m-p 0.0002 0.1099 0.2044 C 392.240854 0 0.0003 643 | 6/11
31 h-m-p 1.6000 8.0000 0.0000 +Y 392.240854 0 4.6275 663 | 6/11
32 h-m-p 1.5539 8.0000 0.0000 ++ 392.240854 m 8.0000 682 | 6/11
33 h-m-p 0.2631 8.0000 0.0006 ++C 392.240854 0 4.2871 703 | 6/11
34 h-m-p 1.3287 8.0000 0.0018 ++ 392.240854 m 8.0000 722 | 6/11
35 h-m-p 0.0160 8.0000 4.1698 +++YC 392.240829 1 2.0275 745 | 6/11
36 h-m-p 1.6000 8.0000 4.0664 ++ 392.240631 m 8.0000 759 | 6/11
37 h-m-p 0.0008 0.0041 495.4059 ++ 392.240619 m 0.0041 773 | 7/11
38 h-m-p 0.0009 0.0951 407.5208 ++++ 392.240568 m 0.0951 789 | 8/11
39 h-m-p 0.3213 8.0000 0.0400 +Y 392.240556 0 0.9914 804 | 8/11
40 h-m-p 1.6000 8.0000 0.0001 C 392.240556 0 1.3889 821 | 8/11
41 h-m-p 1.6000 8.0000 0.0000 --C 392.240556 0 0.0250 840
Out..
lnL = -392.240556
841 lfun, 10092 eigenQcodon, 55506 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -401.291201 S = -399.337631 -3.962008
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:27
did 20 / 46 patterns 0:28
did 30 / 46 patterns 0:28
did 40 / 46 patterns 0:28
did 46 / 46 patterns 0:28
Time used: 0:28
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=95
NC_011896_1_WP_012634408_1_45_MLBR_RS00235 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
NC_002677_1_NP_301162_1_34_ML0049 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
**************************************************
NC_011896_1_WP_012634408_1_45_MLBR_RS00235 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
NC_002677_1_NP_301162_1_34_ML0049 SSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG
NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240 SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
****:********************************** *****
>NC_011896_1_WP_012634408_1_45_MLBR_RS00235 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG >NC_002677_1_NP_301162_1_34_ML0049 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT TCGTCAGTCCAACGACGTTTCAACCAGAACACCGAGGGAATAAACCATGC ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC AGACCGAGGCAGGCGTCATGAGTATGTTCACCGGG >NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG >NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG >NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG >NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240 ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
>NC_011896_1_WP_012634408_1_45_MLBR_RS00235 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG >NC_002677_1_NP_301162_1_34_ML0049 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY SSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG >NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG >NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG >NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG >NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240 MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
#NEXUS
[ID: 0237725634]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_012634408_1_45_MLBR_RS00235
NC_002677_1_NP_301162_1_34_ML0049
NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540
NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970
NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230
NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240
;
end;
begin trees;
translate
1 NC_011896_1_WP_012634408_1_45_MLBR_RS00235,
2 NC_002677_1_NP_301162_1_34_ML0049,
3 NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540,
4 NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970,
5 NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230,
6 NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05180413,2:0.1809956,3:0.0525901,4:0.05239917,5:0.05383773,6:0.05173789);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05180413,2:0.1809956,3:0.0525901,4:0.05239917,5:0.05383773,6:0.05173789);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -411.72 -417.54
2 -411.70 -415.79
--------------------------------------
TOTAL -411.71 -417.00
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.838811 0.083508 0.329240 1.409293 0.804947 1340.47 1420.74 1.000
r(A<->C){all} 0.105713 0.010935 0.000027 0.330031 0.073202 275.05 279.75 1.001
r(A<->G){all} 0.221933 0.024432 0.000287 0.522663 0.193656 360.31 372.17 1.000
r(A<->T){all} 0.127218 0.013256 0.000010 0.365199 0.093152 307.98 309.68 1.000
r(C<->G){all} 0.132990 0.014589 0.000035 0.376066 0.095357 334.91 343.21 1.000
r(C<->T){all} 0.226804 0.026222 0.000001 0.533311 0.194314 96.56 131.32 1.000
r(G<->T){all} 0.185342 0.025216 0.000131 0.510086 0.142326 148.73 237.22 1.002
pi(A){all} 0.280476 0.000695 0.230082 0.331382 0.279646 1192.50 1247.37 1.000
pi(C){all} 0.273819 0.000709 0.217919 0.322453 0.273286 1131.61 1234.99 1.000
pi(G){all} 0.268870 0.000668 0.219204 0.318395 0.268811 1407.31 1434.24 1.001
pi(T){all} 0.176835 0.000513 0.133223 0.220172 0.175524 1247.66 1363.54 1.000
alpha{1,2} 0.265678 0.056270 0.033468 0.707130 0.197346 1349.85 1385.22 1.000
alpha{3} 0.336165 0.182527 0.000106 1.172549 0.176505 1066.48 1210.65 1.000
pinvar{all} 0.978618 0.000196 0.952469 0.997675 0.981675 1218.03 1299.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/ML0049/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 95
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 2 2 2 2 2 2 | TAC 0 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 0 0 0 0 0 0 | CAC 2 2 2 2 2 2 | CGC 0 0 0 0 0 0
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 7 6 7 7 7 7 | CGA 0 1 0 0 0 0
CTG 4 4 4 4 4 4 | CCG 0 0 0 0 0 0 | CAG 6 6 6 6 6 6 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 2 2 2 2 2 2 | ACC 3 3 3 3 3 3 | AAC 5 5 5 5 5 5 | AGC 3 3 3 3 3 3
ATA 2 2 2 2 2 2 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 3 4 3 3 3 3 | ACG 2 1 2 2 2 2 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 1 1 1 1 1 1 | Asp GAT 1 1 1 1 1 1 | Gly GGT 3 3 3 3 3 3
GTC 3 3 3 3 3 3 | GCC 2 2 2 2 2 2 | GAC 1 1 1 1 1 1 | GGC 2 2 2 2 2 2
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 3 3 3 3 3 3 | GGA 2 2 2 2 2 2
GTG 1 1 1 1 1 1 | GCG 2 2 2 2 2 2 | GAG 4 4 4 4 4 4 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_012634408_1_45_MLBR_RS00235
position 1: T:0.15789 C:0.27368 A:0.26316 G:0.30526
position 2: T:0.23158 C:0.23158 A:0.35789 G:0.17895
position 3: T:0.13684 C:0.31579 A:0.22105 G:0.32632
Average T:0.17544 C:0.27368 A:0.28070 G:0.27018
#2: NC_002677_1_NP_301162_1_34_ML0049
position 1: T:0.15789 C:0.27368 A:0.26316 G:0.30526
position 2: T:0.24211 C:0.22105 A:0.34737 G:0.18947
position 3: T:0.13684 C:0.31579 A:0.22105 G:0.32632
Average T:0.17895 C:0.27018 A:0.27719 G:0.27368
#3: NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540
position 1: T:0.15789 C:0.27368 A:0.26316 G:0.30526
position 2: T:0.23158 C:0.23158 A:0.35789 G:0.17895
position 3: T:0.13684 C:0.31579 A:0.22105 G:0.32632
Average T:0.17544 C:0.27368 A:0.28070 G:0.27018
#4: NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970
position 1: T:0.15789 C:0.27368 A:0.26316 G:0.30526
position 2: T:0.23158 C:0.23158 A:0.35789 G:0.17895
position 3: T:0.13684 C:0.31579 A:0.22105 G:0.32632
Average T:0.17544 C:0.27368 A:0.28070 G:0.27018
#5: NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230
position 1: T:0.15789 C:0.27368 A:0.26316 G:0.30526
position 2: T:0.23158 C:0.23158 A:0.35789 G:0.17895
position 3: T:0.13684 C:0.31579 A:0.22105 G:0.32632
Average T:0.17544 C:0.27368 A:0.28070 G:0.27018
#6: NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240
position 1: T:0.15789 C:0.27368 A:0.26316 G:0.30526
position 2: T:0.23158 C:0.23158 A:0.35789 G:0.17895
position 3: T:0.13684 C:0.31579 A:0.22105 G:0.32632
Average T:0.17544 C:0.27368 A:0.28070 G:0.27018
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 12 | TCC 12 | TAC 0 | TGC 6
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 24 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 12 | Arg R CGT 6
CTC 12 | CCC 0 | CAC 12 | CGC 0
CTA 6 | CCA 0 | Gln Q CAA 41 | CGA 1
CTG 24 | CCG 0 | CAG 36 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 6
ATC 12 | ACC 18 | AAC 30 | AGC 18
ATA 12 | ACA 6 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 19 | ACG 11 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 6 | Asp D GAT 6 | Gly G GGT 18
GTC 18 | GCC 12 | GAC 6 | GGC 12
GTA 0 | GCA 18 | Glu E GAA 18 | GGA 12
GTG 6 | GCG 12 | GAG 24 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.15789 C:0.27368 A:0.26316 G:0.30526
position 2: T:0.23333 C:0.22982 A:0.35614 G:0.18070
position 3: T:0.13684 C:0.31579 A:0.22105 G:0.32632
Average T:0.17602 C:0.27310 A:0.28012 G:0.27076
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 8): -392.240556 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.022418 0.000004 0.000004 0.000004 0.000004 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.022438
(1: 0.000004, 2: 0.022418, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634408_1_45_MLBR_RS00235: 0.000004, NC_002677_1_NP_301162_1_34_ML0049: 0.022418, NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540: 0.000004, NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970: 0.000004, NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230: 0.000004, NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 192.0 93.0 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.022 192.0 93.0 999.0000 0.0111 0.0000 2.1 0.0
7..3 0.000 192.0 93.0 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 192.0 93.0 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 192.0 93.0 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 192.0 93.0 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0111
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -393.062599 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.022003 0.000004 0.000004 0.000004 0.000004 999.000000 0.889620 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.022023
(1: 0.000004, 2: 0.022003, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634408_1_45_MLBR_RS00235: 0.000004, NC_002677_1_NP_301162_1_34_ML0049: 0.022003, NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540: 0.000004, NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970: 0.000004, NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230: 0.000004, NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
MLEs of dN/dS (w) for site classes (K=2)
p: 0.88962 0.11038
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 192.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.022 192.0 93.0 1.0000 0.0073 0.0073 1.4 0.7
7..3 0.000 192.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 192.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 192.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 192.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 11): -392.240556 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.022418 0.000004 0.000004 0.000004 0.000004 999.000000 0.000000 0.000000 1.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.022438
(1: 0.000004, 2: 0.022418, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634408_1_45_MLBR_RS00235: 0.000004, NC_002677_1_NP_301162_1_34_ML0049: 0.022418, NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540: 0.000004, NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970: 0.000004, NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230: 0.000004, NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 192.0 93.0 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.022 192.0 93.0 999.0000 0.0111 0.0000 2.1 0.0
7..3 0.000 192.0 93.0 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 192.0 93.0 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 192.0 93.0 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 192.0 93.0 999.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634408_1_45_MLBR_RS00235)
Pr(w>1) post mean +- SE for w
1 M 1.000** 999.000
2 I 1.000** 999.000
3 Q 1.000** 999.000
4 A 1.000** 999.000
5 W 1.000** 999.000
6 H 1.000** 999.000
7 F 1.000** 999.000
8 P 1.000** 999.000
9 A 1.000** 999.000
10 L 1.000** 999.000
11 Q 1.000** 999.000
12 G 1.000** 999.000
13 A 1.000** 999.000
14 V 1.000** 999.000
15 N 1.000** 999.000
16 E 1.000** 999.000
17 L 1.000** 999.000
18 Q 1.000** 999.000
19 G 1.000** 999.000
20 S 1.000** 999.000
21 Q 1.000** 999.000
22 S 1.000** 999.000
23 R 1.000** 999.000
24 I 1.000** 999.000
25 D 1.000** 999.000
26 A 1.000** 999.000
27 L 1.000** 999.000
28 L 1.000** 999.000
29 E 1.000** 999.000
30 Q 1.000** 999.000
31 C 1.000** 999.000
32 Q 1.000** 999.000
33 E 1.000** 999.000
34 S 1.000** 999.000
35 L 1.000** 999.000
36 T 1.000** 999.000
37 K 1.000** 999.000
38 L 1.000** 999.000
39 Q 1.000** 999.000
40 S 1.000** 999.000
41 S 1.000** 999.000
42 W 1.000** 999.000
43 H 1.000** 999.000
44 G 1.000** 999.000
45 S 1.000** 999.000
46 G 1.000** 999.000
47 N 1.000** 999.000
48 E 1.000** 999.000
49 S 1.000** 999.000
50 Y 1.000** 999.000
51 S 1.000** 999.000
52 S 1.000** 999.000
53 V 1.000** 999.000
54 Q 1.000** 999.000
55 Q 1.000** 999.000
56 R 1.000** 999.000
57 F 1.000** 999.000
58 N 1.000** 999.000
59 Q 1.000** 999.000
60 N 1.000** 999.000
61 T 1.000** 999.000
62 E 1.000** 999.000
63 G 1.000** 999.000
64 I 1.000** 999.000
65 N 1.000** 999.000
66 H 1.000** 999.000
67 A 1.000** 999.000
68 L 1.000** 999.000
69 G 1.000** 999.000
70 D 1.000** 999.000
71 L 1.000** 999.000
72 V 1.000** 999.000
73 Q 1.000** 999.000
74 A 1.000** 999.000
75 I 1.000** 999.000
76 N 1.000** 999.000
77 H 1.000** 999.000
78 S 1.000** 999.000
79 A 1.000** 999.000
80 E 1.000** 999.000
81 T 1.000** 999.000
82 M 1.000** 999.000
83 Q 1.000** 999.000
84 Q 1.000** 999.000
85 T 1.000** 999.000
86 E 1.000** 999.000
87 A 1.000** 999.000
88 G 1.000** 999.000
89 V 1.000** 999.000
90 T 1.000** 999.000
91 S 1.000** 999.000
92 M 1.000** 999.000
93 F 1.000** 999.000
94 T 1.000** 999.000
95 G 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634408_1_45_MLBR_RS00235)
Pr(w>1) post mean +- SE for w
1 M 0.552 4.815 +- 4.002
2 I 0.552 4.815 +- 4.002
3 Q 0.552 4.816 +- 4.002
4 A 0.552 4.815 +- 4.002
5 W 0.552 4.816 +- 4.002
6 H 0.552 4.815 +- 4.002
7 F 0.552 4.816 +- 4.002
8 P 0.552 4.816 +- 4.002
9 A 0.552 4.815 +- 4.002
10 L 0.552 4.816 +- 4.002
11 Q 0.552 4.816 +- 4.002
12 G 0.552 4.816 +- 4.002
13 A 0.552 4.815 +- 4.002
14 V 0.552 4.815 +- 4.002
15 N 0.552 4.815 +- 4.002
16 E 0.552 4.815 +- 4.002
17 L 0.552 4.816 +- 4.002
18 Q 0.552 4.816 +- 4.002
19 G 0.552 4.815 +- 4.002
20 S 0.552 4.815 +- 4.002
21 Q 0.552 4.816 +- 4.002
22 S 0.552 4.815 +- 4.002
23 R 0.552 4.815 +- 4.002
24 I 0.552 4.815 +- 4.002
25 D 0.552 4.816 +- 4.002
26 A 0.552 4.815 +- 4.002
27 L 0.552 4.816 +- 4.002
28 L 0.552 4.815 +- 4.002
29 E 0.552 4.815 +- 4.002
30 Q 0.552 4.816 +- 4.002
31 C 0.552 4.815 +- 4.002
32 Q 0.552 4.816 +- 4.002
33 E 0.552 4.815 +- 4.002
34 S 0.552 4.815 +- 4.002
35 L 0.552 4.815 +- 4.002
36 T 0.552 4.815 +- 4.002
37 K 0.552 4.815 +- 4.002
38 L 0.552 4.816 +- 4.002
39 Q 0.552 4.816 +- 4.002
40 S 0.552 4.815 +- 4.002
41 S 0.552 4.815 +- 4.002
42 W 0.552 4.816 +- 4.002
43 H 0.552 4.816 +- 4.002
44 G 0.552 4.816 +- 4.002
45 S 0.552 4.815 +- 4.002
46 G 0.552 4.816 +- 4.002
47 N 0.552 4.815 +- 4.002
48 E 0.552 4.815 +- 4.002
49 S 0.552 4.815 +- 4.002
50 Y 0.552 4.816 +- 4.002
51 S 0.552 4.815 +- 4.002
52 S 0.552 4.816 +- 4.002
53 V 0.552 4.815 +- 4.002
54 Q 0.552 4.816 +- 4.002
55 Q 0.884 7.311 +- 3.090
56 R 0.552 4.816 +- 4.002
57 F 0.552 4.815 +- 4.002
58 N 0.552 4.815 +- 4.002
59 Q 0.552 4.816 +- 4.002
60 N 0.552 4.815 +- 4.002
61 T 0.552 4.815 +- 4.002
62 E 0.552 4.815 +- 4.002
63 G 0.552 4.815 +- 4.002
64 I 0.552 4.815 +- 4.002
65 N 0.552 4.815 +- 4.002
66 H 0.552 4.816 +- 4.002
67 A 0.552 4.815 +- 4.002
68 L 0.552 4.816 +- 4.002
69 G 0.552 4.815 +- 4.002
70 D 0.552 4.815 +- 4.002
71 L 0.552 4.816 +- 4.002
72 V 0.552 4.815 +- 4.002
73 Q 0.552 4.816 +- 4.002
74 A 0.552 4.815 +- 4.002
75 I 0.552 4.815 +- 4.002
76 N 0.552 4.816 +- 4.002
77 H 0.552 4.815 +- 4.002
78 S 0.552 4.815 +- 4.002
79 A 0.552 4.816 +- 4.002
80 E 0.552 4.815 +- 4.002
81 T 0.552 4.815 +- 4.002
82 M 0.552 4.815 +- 4.002
83 Q 0.552 4.816 +- 4.002
84 Q 0.552 4.816 +- 4.002
85 T 0.552 4.815 +- 4.002
86 E 0.552 4.815 +- 4.002
87 A 0.552 4.815 +- 4.002
88 G 0.552 4.815 +- 4.002
89 V 0.552 4.815 +- 4.002
90 T 0.884 7.310 +- 3.090
91 S 0.552 4.816 +- 4.002
92 M 0.552 4.815 +- 4.002
93 F 0.552 4.815 +- 4.002
94 T 0.552 4.815 +- 4.002
95 G 0.552 4.815 +- 4.002
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.096 0.098 0.099 0.101 0.102 0.104 0.105 0.107
w2: 0.012 0.022 0.035 0.053 0.073 0.098 0.126 0.158 0.193 0.231
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.001
0.003 0.002 0.001
0.006 0.004 0.003 0.002 0.001
0.009 0.006 0.005 0.004 0.003 0.002 0.001
0.013 0.010 0.008 0.006 0.005 0.003 0.003 0.002 0.001
0.017 0.014 0.012 0.009 0.008 0.006 0.005 0.003 0.002 0.001 0.001
0.022 0.019 0.017 0.014 0.012 0.009 0.008 0.006 0.005 0.003 0.002 0.001 0.001
0.028 0.024 0.022 0.018 0.016 0.013 0.012 0.009 0.008 0.005 0.004 0.003 0.002 0.001 0.001
0.035 0.030 0.028 0.024 0.021 0.018 0.016 0.013 0.011 0.009 0.007 0.005 0.004 0.003 0.002 0.001 0.001
0.042 0.037 0.035 0.030 0.027 0.023 0.021 0.017 0.016 0.012 0.011 0.008 0.007 0.005 0.004 0.003 0.002 0.001 0.001
sum of density on p0-p1 = 1.000000
Time used: 0:07
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -393.062599 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.022002 0.000004 0.000004 0.000004 0.000004 999.000000 99.000000 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.022022
(1: 0.000004, 2: 0.022002, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634408_1_45_MLBR_RS00235: 0.000004, NC_002677_1_NP_301162_1_34_ML0049: 0.022002, NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540: 0.000004, NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970: 0.000004, NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230: 0.000004, NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M7 (beta):
p = 99.00000 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 192.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.022 192.0 93.0 1.0000 0.0073 0.0073 1.4 0.7
7..3 0.000 192.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 192.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 192.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 192.0 93.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:13
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 11): -392.240556 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.022418 0.000004 0.000004 0.000004 0.000004 999.000000 0.000010 0.060227 1.830820 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.022438
(1: 0.000004, 2: 0.022418, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634408_1_45_MLBR_RS00235: 0.000004, NC_002677_1_NP_301162_1_34_ML0049: 0.022418, NZ_LVXE01000042_1_WP_012634408_1_1860_A3216_RS10540: 0.000004, NZ_LYPH01000048_1_WP_012634408_1_1879_A8144_RS08970: 0.000004, NZ_CP029543_1_WP_012634408_1_43_DIJ64_RS00230: 0.000004, NZ_AP014567_1_WP_012634408_1_45_JK2ML_RS00240: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.06023 q = 1.83082
(p1 = 0.99999) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 0.00033 0.00358 0.02920 0.21462 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 192.0 93.0 998.9900 0.0000 0.0000 0.0 0.0
7..2 0.022 192.0 93.0 998.9900 0.0111 0.0000 2.1 0.0
7..3 0.000 192.0 93.0 998.9900 0.0000 0.0000 0.0 0.0
7..4 0.000 192.0 93.0 998.9900 0.0000 0.0000 0.0 0.0
7..5 0.000 192.0 93.0 998.9900 0.0000 0.0000 0.0 0.0
7..6 0.000 192.0 93.0 998.9900 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634408_1_45_MLBR_RS00235)
Pr(w>1) post mean +- SE for w
1 M 1.000** 998.990
2 I 1.000** 998.990
3 Q 1.000** 998.990
4 A 1.000** 998.990
5 W 1.000** 998.990
6 H 1.000** 998.990
7 F 1.000** 998.990
8 P 1.000** 998.990
9 A 1.000** 998.990
10 L 1.000** 998.990
11 Q 1.000** 998.990
12 G 1.000** 998.990
13 A 1.000** 998.990
14 V 1.000** 998.990
15 N 1.000** 998.990
16 E 1.000** 998.990
17 L 1.000** 998.990
18 Q 1.000** 998.990
19 G 1.000** 998.990
20 S 1.000** 998.990
21 Q 1.000** 998.990
22 S 1.000** 998.990
23 R 1.000** 998.990
24 I 1.000** 998.990
25 D 1.000** 998.990
26 A 1.000** 998.990
27 L 1.000** 998.990
28 L 1.000** 998.990
29 E 1.000** 998.990
30 Q 1.000** 998.990
31 C 1.000** 998.990
32 Q 1.000** 998.990
33 E 1.000** 998.990
34 S 1.000** 998.990
35 L 1.000** 998.990
36 T 1.000** 998.990
37 K 1.000** 998.990
38 L 1.000** 998.990
39 Q 1.000** 998.990
40 S 1.000** 998.990
41 S 1.000** 998.990
42 W 1.000** 998.990
43 H 1.000** 998.990
44 G 1.000** 998.990
45 S 1.000** 998.990
46 G 1.000** 998.990
47 N 1.000** 998.990
48 E 1.000** 998.990
49 S 1.000** 998.990
50 Y 1.000** 998.990
51 S 1.000** 998.990
52 S 1.000** 998.990
53 V 1.000** 998.990
54 Q 1.000** 998.990
55 Q 1.000** 999.000
56 R 1.000** 998.990
57 F 1.000** 998.990
58 N 1.000** 998.990
59 Q 1.000** 998.990
60 N 1.000** 998.990
61 T 1.000** 998.990
62 E 1.000** 998.990
63 G 1.000** 998.990
64 I 1.000** 998.990
65 N 1.000** 998.990
66 H 1.000** 998.990
67 A 1.000** 998.990
68 L 1.000** 998.990
69 G 1.000** 998.990
70 D 1.000** 998.990
71 L 1.000** 998.990
72 V 1.000** 998.990
73 Q 1.000** 998.990
74 A 1.000** 998.990
75 I 1.000** 998.990
76 N 1.000** 998.990
77 H 1.000** 998.990
78 S 1.000** 998.990
79 A 1.000** 998.990
80 E 1.000** 998.990
81 T 1.000** 998.990
82 M 1.000** 998.990
83 Q 1.000** 998.990
84 Q 1.000** 998.990
85 T 1.000** 998.990
86 E 1.000** 998.990
87 A 1.000** 998.990
88 G 1.000** 998.990
89 V 1.000** 998.990
90 T 1.000** 999.000
91 S 1.000** 998.990
92 M 1.000** 998.990
93 F 1.000** 998.990
94 T 1.000** 998.990
95 G 1.000** 998.990
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634408_1_45_MLBR_RS00235)
Pr(w>1) post mean +- SE for w
1 M 0.729 6.104 +- 3.875
2 I 0.729 6.104 +- 3.875
3 Q 0.729 6.105 +- 3.875
4 A 0.729 6.104 +- 3.875
5 W 0.729 6.105 +- 3.875
6 H 0.729 6.105 +- 3.875
7 F 0.729 6.105 +- 3.875
8 P 0.729 6.105 +- 3.875
9 A 0.729 6.104 +- 3.875
10 L 0.729 6.105 +- 3.875
11 Q 0.729 6.105 +- 3.875
12 G 0.729 6.105 +- 3.875
13 A 0.729 6.104 +- 3.875
14 V 0.729 6.104 +- 3.875
15 N 0.729 6.104 +- 3.875
16 E 0.729 6.105 +- 3.875
17 L 0.729 6.105 +- 3.875
18 Q 0.729 6.105 +- 3.875
19 G 0.729 6.104 +- 3.875
20 S 0.729 6.104 +- 3.875
21 Q 0.729 6.105 +- 3.875
22 S 0.729 6.104 +- 3.875
23 R 0.729 6.105 +- 3.875
24 I 0.729 6.104 +- 3.875
25 D 0.729 6.105 +- 3.875
26 A 0.729 6.104 +- 3.875
27 L 0.729 6.105 +- 3.875
28 L 0.729 6.105 +- 3.875
29 E 0.729 6.104 +- 3.875
30 Q 0.729 6.105 +- 3.875
31 C 0.729 6.105 +- 3.875
32 Q 0.729 6.105 +- 3.875
33 E 0.729 6.105 +- 3.875
34 S 0.729 6.105 +- 3.875
35 L 0.729 6.105 +- 3.875
36 T 0.729 6.105 +- 3.875
37 K 0.729 6.104 +- 3.875
38 L 0.729 6.105 +- 3.875
39 Q 0.729 6.105 +- 3.875
40 S 0.729 6.104 +- 3.875
41 S 0.729 6.105 +- 3.875
42 W 0.729 6.105 +- 3.875
43 H 0.729 6.105 +- 3.875
44 G 0.729 6.105 +- 3.875
45 S 0.729 6.105 +- 3.875
46 G 0.729 6.105 +- 3.875
47 N 0.729 6.104 +- 3.875
48 E 0.729 6.104 +- 3.875
49 S 0.729 6.105 +- 3.875
50 Y 0.729 6.105 +- 3.875
51 S 0.729 6.105 +- 3.875
52 S 0.729 6.105 +- 3.875
53 V 0.729 6.104 +- 3.875
54 Q 0.729 6.105 +- 3.875
55 Q 0.962* 7.916 +- 2.533
56 R 0.729 6.105 +- 3.875
57 F 0.729 6.105 +- 3.875
58 N 0.729 6.104 +- 3.875
59 Q 0.729 6.105 +- 3.875
60 N 0.729 6.104 +- 3.875
61 T 0.729 6.104 +- 3.875
62 E 0.729 6.104 +- 3.875
63 G 0.729 6.104 +- 3.875
64 I 0.729 6.104 +- 3.875
65 N 0.729 6.104 +- 3.875
66 H 0.729 6.105 +- 3.875
67 A 0.729 6.105 +- 3.875
68 L 0.729 6.105 +- 3.875
69 G 0.729 6.104 +- 3.875
70 D 0.729 6.104 +- 3.875
71 L 0.729 6.105 +- 3.875
72 V 0.729 6.104 +- 3.875
73 Q 0.729 6.105 +- 3.875
74 A 0.729 6.105 +- 3.875
75 I 0.729 6.104 +- 3.875
76 N 0.729 6.105 +- 3.875
77 H 0.729 6.105 +- 3.875
78 S 0.729 6.105 +- 3.875
79 A 0.729 6.105 +- 3.875
80 E 0.729 6.105 +- 3.875
81 T 0.729 6.104 +- 3.875
82 M 0.729 6.104 +- 3.875
83 Q 0.729 6.105 +- 3.875
84 Q 0.729 6.105 +- 3.875
85 T 0.729 6.104 +- 3.875
86 E 0.729 6.104 +- 3.875
87 A 0.729 6.105 +- 3.875
88 G 0.729 6.104 +- 3.875
89 V 0.729 6.104 +- 3.875
90 T 0.962* 7.916 +- 2.533
91 S 0.729 6.105 +- 3.875
92 M 0.729 6.104 +- 3.875
93 F 0.729 6.105 +- 3.875
94 T 0.729 6.104 +- 3.875
95 G 0.729 6.104 +- 3.875
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.253 0.207 0.165 0.127 0.095 0.067 0.044 0.026 0.013 0.004
p : 0.095 0.097 0.099 0.100 0.100 0.101 0.101 0.102 0.102 0.103
q : 0.105 0.103 0.101 0.100 0.100 0.099 0.099 0.098 0.098 0.097
ws: 0.007 0.017 0.030 0.048 0.070 0.097 0.127 0.161 0.200 0.243
Time used: 0:28
Model 1: NearlyNeutral -393.062599 Model 2: PositiveSelection -392.240556 Model 0: one-ratio -392.240556 Model 7: beta -393.062599 Model 8: beta&w>1 -392.240556 Model 0 vs 1 1.644085999999902 Model 2 vs 1 1.644085999999902 Model 8 vs 7 1.644085999999902
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
