--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:27:55 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/ML0049/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -411.72          -417.54
2       -411.70          -415.79
--------------------------------------
TOTAL     -411.71          -417.00
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.838811    0.083508    0.329240    1.409293    0.804947   1340.47   1420.74    1.000
r(A<->C){all}   0.105713    0.010935    0.000027    0.330031    0.073202    275.05    279.75    1.001
r(A<->G){all}   0.221933    0.024432    0.000287    0.522663    0.193656    360.31    372.17    1.000
r(A<->T){all}   0.127218    0.013256    0.000010    0.365199    0.093152    307.98    309.68    1.000
r(C<->G){all}   0.132990    0.014589    0.000035    0.376066    0.095357    334.91    343.21    1.000
r(C<->T){all}   0.226804    0.026222    0.000001    0.533311    0.194314     96.56    131.32    1.000
r(G<->T){all}   0.185342    0.025216    0.000131    0.510086    0.142326    148.73    237.22    1.002
pi(A){all}      0.280476    0.000695    0.230082    0.331382    0.279646   1192.50   1247.37    1.000
pi(C){all}      0.273819    0.000709    0.217919    0.322453    0.273286   1131.61   1234.99    1.000
pi(G){all}      0.268870    0.000668    0.219204    0.318395    0.268811   1407.31   1434.24    1.001
pi(T){all}      0.176835    0.000513    0.133223    0.220172    0.175524   1247.66   1363.54    1.000
alpha{1,2}      0.265678    0.056270    0.033468    0.707130    0.197346   1349.85   1385.22    1.000
alpha{3}        0.336165    0.182527    0.000106    1.172549    0.176505   1066.48   1210.65    1.000
pinvar{all}     0.978618    0.000196    0.952469    0.997675    0.981675   1218.03   1299.95    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-393.062599
Model 2: PositiveSelection	-392.240556
Model 0: one-ratio	-392.240556
Model 7: beta	-393.062599
Model 8: beta&w>1	-392.240556


Model 0 vs 1	1.644085999999902

Model 2 vs 1	1.644085999999902

Model 8 vs 7	1.644085999999902
>C1
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C2
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG
>C3
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C4
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C5
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C6
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=95 

C1              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C2              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C3              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C4              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C5              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C6              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
                **************************************************

C1              SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C2              SSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG
C3              SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C4              SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C5              SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C6              SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
                ****:********************************** *****




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   95 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   95 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2850]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2850]--->[2850]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.437 Mb, Max= 30.603 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C2              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C3              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C4              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C5              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
C6              MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
                **************************************************

C1              SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C2              SSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG
C3              SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C4              SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C5              SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
C6              SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
                ****:********************************** *****




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 97.89 C1	 C2	 97.89
TOP	    1    0	 97.89 C2	 C1	 97.89
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 97.89 C2	 C3	 97.89
TOP	    2    1	 97.89 C3	 C2	 97.89
BOT	    1    3	 97.89 C2	 C4	 97.89
TOP	    3    1	 97.89 C4	 C2	 97.89
BOT	    1    4	 97.89 C2	 C5	 97.89
TOP	    4    1	 97.89 C5	 C2	 97.89
BOT	    1    5	 97.89 C2	 C6	 97.89
TOP	    5    1	 97.89 C6	 C2	 97.89
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 99.58
AVG	 1	 C2	  *	 97.89
AVG	 2	 C3	  *	 99.58
AVG	 3	 C4	  *	 99.58
AVG	 4	 C5	  *	 99.58
AVG	 5	 C6	  *	 99.58
TOT	 TOT	  *	 99.30
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
C2              ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
C3              ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
C4              ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
C5              ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
C6              ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
                **************************************************

C1              GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
C2              GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
C3              GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
C4              GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
C5              GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
C6              GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
                **************************************************

C1              CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
C2              CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
C3              CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
C4              CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
C5              CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
C6              CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
                **************************************************

C1              TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
C2              TCGTCAGTCCAACGACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
C3              TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
C4              TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
C5              TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
C6              TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
                *************.************************************

C1              ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
C2              ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
C3              ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
C4              ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
C5              ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
C6              ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
                **************************************************

C1              AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
C2              AGACCGAGGCAGGCGTCATGAGTATGTTCACCGGG
C3              AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
C4              AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
C5              AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
C6              AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
                ****************** ****************



>C1
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
>C2
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACGACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCATGAGTATGTTCACCGGG
>C3
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
>C4
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
>C5
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
>C6
ATGATACAGGCGTGGCACTTTCCTGCCCTACAGGGTGCCGTCAACGAACT
GCAAGGAAGCCAGAGCAGAATCGATGCGTTGCTCGAGCAATGCCAAGAAT
CGCTCACAAAGCTGCAGAGCTCGTGGCATGGTTCCGGTAACGAGTCCTAT
TCGTCAGTCCAACAACGTTTCAACCAGAACACCGAGGGAATAAACCATGC
ACTGGGCGACCTGGTGCAAGCAATCAATCACTCGGCTGAAACGATGCAAC
AGACCGAGGCAGGCGTCACGAGTATGTTCACCGGG
>C1
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C2
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQRRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVMSMFTG
>C3
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C4
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C5
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG
>C6
MIQAWHFPALQGAVNELQGSQSRIDALLEQCQESLTKLQSSWHGSGNESY
SSVQQRFNQNTEGINHALGDLVQAINHSAETMQQTEAGVTSMFTG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 285 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789581
      Setting output file names to "/data/3res/ML0049/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 328940857
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0237725634
      Seed = 816195308
      Swapseed = 1579789581
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 6 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -644.649390 -- -24.965149
         Chain 2 -- -644.649390 -- -24.965149
         Chain 3 -- -644.649354 -- -24.965149
         Chain 4 -- -644.649390 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -644.649390 -- -24.965149
         Chain 2 -- -644.649390 -- -24.965149
         Chain 3 -- -644.649390 -- -24.965149
         Chain 4 -- -644.646291 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-644.649] (-644.649) (-644.649) (-644.649) * [-644.649] (-644.649) (-644.649) (-644.646) 
        500 -- [-419.197] (-421.472) (-408.838) (-417.932) * (-414.834) [-413.616] (-419.467) (-417.417) -- 0:00:00
       1000 -- [-418.222] (-411.712) (-422.122) (-416.651) * (-414.774) (-418.242) [-413.640] (-418.988) -- 0:00:00
       1500 -- [-415.525] (-418.587) (-413.837) (-422.868) * (-415.402) (-413.897) (-420.007) [-414.286] -- 0:00:00
       2000 -- [-417.673] (-410.633) (-410.940) (-419.978) * (-418.852) (-412.857) [-418.131] (-418.046) -- 0:00:00
       2500 -- [-412.067] (-419.032) (-412.427) (-420.109) * (-414.825) (-415.056) [-419.471] (-415.738) -- 0:00:00
       3000 -- (-414.669) [-415.358] (-425.439) (-418.891) * (-413.228) (-414.075) [-423.708] (-419.737) -- 0:00:00
       3500 -- (-422.948) (-414.328) [-416.181] (-416.270) * [-413.158] (-416.995) (-419.375) (-417.267) -- 0:00:00
       4000 -- [-415.562] (-414.868) (-418.484) (-419.369) * [-413.164] (-411.246) (-421.595) (-416.465) -- 0:00:00
       4500 -- (-420.596) [-408.463] (-421.574) (-417.289) * (-413.436) (-420.050) (-419.792) [-416.893] -- 0:00:00
       5000 -- (-419.109) (-412.455) (-414.059) [-413.019] * (-418.374) (-414.990) [-415.328] (-420.912) -- 0:00:00

      Average standard deviation of split frequencies: 0.064282

       5500 -- (-419.074) (-414.942) (-421.495) [-411.916] * (-426.403) [-409.326] (-415.652) (-418.958) -- 0:00:00
       6000 -- (-420.991) (-420.906) [-417.739] (-414.048) * (-422.680) [-409.897] (-426.081) (-413.876) -- 0:00:00
       6500 -- [-408.516] (-416.366) (-417.123) (-411.896) * (-412.491) [-414.172] (-421.707) (-417.099) -- 0:00:00
       7000 -- (-411.259) (-423.515) [-411.285] (-416.441) * (-420.718) [-421.068] (-427.345) (-412.485) -- 0:00:00
       7500 -- [-413.596] (-417.844) (-411.088) (-418.431) * (-412.731) (-422.137) (-424.445) [-413.647] -- 0:00:00
       8000 -- [-414.494] (-418.935) (-420.116) (-416.855) * [-416.783] (-427.729) (-416.071) (-419.712) -- 0:00:00
       8500 -- [-409.142] (-414.119) (-412.057) (-415.596) * [-414.528] (-413.649) (-417.827) (-415.810) -- 0:00:00
       9000 -- (-414.583) (-414.248) (-413.481) [-413.771] * (-417.645) [-420.479] (-419.070) (-425.422) -- 0:00:00
       9500 -- (-419.493) [-414.167] (-414.614) (-414.753) * (-414.956) (-418.126) (-417.789) [-412.764] -- 0:01:44
      10000 -- [-413.117] (-418.096) (-413.796) (-413.131) * [-416.344] (-418.381) (-416.356) (-416.987) -- 0:01:39

      Average standard deviation of split frequencies: 0.066291

      10500 -- (-413.153) [-421.591] (-415.603) (-413.391) * (-416.002) [-416.552] (-419.927) (-419.070) -- 0:01:34
      11000 -- [-413.077] (-424.378) (-421.502) (-411.636) * (-419.955) (-420.809) [-416.473] (-415.222) -- 0:01:29
      11500 -- (-412.478) [-418.250] (-421.010) (-412.368) * (-419.232) [-414.203] (-417.271) (-419.633) -- 0:01:25
      12000 -- [-412.724] (-420.824) (-422.302) (-414.717) * [-416.776] (-414.900) (-416.782) (-414.076) -- 0:01:22
      12500 -- (-412.066) (-423.835) [-413.030] (-417.416) * [-411.449] (-426.661) (-415.577) (-415.396) -- 0:01:19
      13000 -- [-414.230] (-412.823) (-414.659) (-414.372) * (-414.150) [-420.801] (-414.439) (-418.461) -- 0:01:15
      13500 -- [-417.567] (-411.867) (-418.295) (-411.878) * [-414.419] (-415.265) (-412.285) (-423.725) -- 0:01:13
      14000 -- (-414.713) [-415.618] (-413.794) (-413.103) * (-412.539) [-412.853] (-410.829) (-415.630) -- 0:01:10
      14500 -- [-415.250] (-415.766) (-411.949) (-412.814) * [-416.067] (-411.790) (-416.733) (-414.539) -- 0:01:07
      15000 -- (-417.865) (-418.133) (-426.630) [-416.400] * [-415.406] (-411.398) (-413.314) (-414.228) -- 0:01:05

      Average standard deviation of split frequencies: 0.065128

      15500 -- [-414.559] (-414.893) (-412.022) (-413.311) * (-427.521) [-413.048] (-414.462) (-429.778) -- 0:01:03
      16000 -- [-417.499] (-410.530) (-414.324) (-410.916) * [-414.355] (-415.798) (-417.330) (-417.859) -- 0:01:01
      16500 -- (-414.893) (-414.316) [-419.345] (-413.131) * [-409.235] (-416.304) (-415.893) (-417.549) -- 0:00:59
      17000 -- [-417.495] (-415.711) (-416.281) (-412.095) * [-412.546] (-413.027) (-413.802) (-413.834) -- 0:00:57
      17500 -- (-419.163) [-409.856] (-417.421) (-414.609) * (-410.717) [-412.207] (-415.257) (-416.461) -- 0:00:56
      18000 -- [-413.221] (-416.620) (-412.761) (-414.200) * [-411.477] (-411.403) (-416.348) (-416.880) -- 0:00:54
      18500 -- (-412.211) [-411.537] (-415.741) (-414.486) * [-422.245] (-413.213) (-414.750) (-419.466) -- 0:00:53
      19000 -- (-416.903) (-415.774) [-414.030] (-413.297) * [-422.553] (-415.157) (-414.334) (-413.872) -- 0:00:51
      19500 -- [-413.102] (-413.327) (-420.744) (-415.575) * [-414.871] (-414.152) (-414.389) (-414.265) -- 0:00:50
      20000 -- [-416.106] (-417.009) (-417.760) (-409.656) * (-413.449) (-411.657) (-412.227) [-414.586] -- 0:00:49

      Average standard deviation of split frequencies: 0.064628

      20500 -- [-428.895] (-416.131) (-411.813) (-412.028) * [-420.665] (-413.046) (-415.548) (-421.441) -- 0:00:47
      21000 -- [-424.676] (-412.872) (-418.974) (-412.131) * [-420.426] (-411.863) (-413.233) (-416.542) -- 0:00:46
      21500 -- (-412.649) (-413.975) [-418.445] (-410.536) * [-414.714] (-412.182) (-415.993) (-417.348) -- 0:00:45
      22000 -- (-411.541) (-410.149) (-416.329) [-412.621] * [-414.134] (-411.828) (-412.685) (-416.021) -- 0:00:44
      22500 -- (-411.849) (-416.891) (-414.005) [-410.331] * [-414.025] (-415.848) (-411.910) (-417.459) -- 0:00:43
      23000 -- [-409.996] (-419.049) (-425.891) (-411.695) * (-415.638) (-415.074) (-414.448) [-418.254] -- 0:00:42
      23500 -- (-408.722) (-411.892) [-416.976] (-409.320) * (-425.383) (-416.250) [-417.412] (-418.808) -- 0:00:41
      24000 -- [-413.172] (-416.768) (-415.787) (-410.665) * (-425.481) [-415.604] (-416.049) (-416.442) -- 0:00:40
      24500 -- (-413.648) (-415.389) [-414.245] (-414.223) * (-423.270) [-413.407] (-415.566) (-415.692) -- 0:01:19
      25000 -- (-411.529) (-415.801) (-416.920) [-413.882] * [-414.144] (-412.635) (-414.857) (-413.989) -- 0:01:18

      Average standard deviation of split frequencies: 0.048667

      25500 -- (-410.589) (-419.482) (-418.096) [-412.304] * (-421.741) [-413.943] (-415.112) (-415.395) -- 0:01:16
      26000 -- (-411.048) (-419.846) (-417.652) [-411.081] * (-414.791) [-411.413] (-416.988) (-416.991) -- 0:01:14
      26500 -- (-414.434) (-418.146) [-416.057] (-410.813) * (-424.789) [-412.567] (-416.280) (-416.453) -- 0:01:13
      27000 -- [-410.727] (-421.053) (-419.650) (-408.929) * (-420.627) (-413.856) (-413.766) [-413.667] -- 0:01:12
      27500 -- (-412.572) (-415.761) (-414.979) [-409.204] * [-427.964] (-414.208) (-418.896) (-414.051) -- 0:01:10
      28000 -- (-412.955) (-414.929) [-425.104] (-410.036) * (-426.954) [-416.197] (-416.692) (-417.035) -- 0:01:09
      28500 -- (-409.470) (-422.057) [-419.951] (-411.108) * (-417.527) (-413.916) (-415.794) [-412.314] -- 0:01:08
      29000 -- [-408.912] (-418.967) (-423.060) (-412.165) * (-415.001) (-413.282) (-414.355) [-412.673] -- 0:01:06
      29500 -- (-409.136) (-418.858) [-411.147] (-412.432) * (-414.216) (-412.163) (-414.608) [-410.864] -- 0:01:05
      30000 -- (-414.394) (-411.157) [-411.976] (-411.728) * [-416.917] (-412.917) (-412.389) (-414.955) -- 0:01:04

      Average standard deviation of split frequencies: 0.037576

      30500 -- (-416.235) (-416.162) [-412.966] (-411.342) * (-417.535) (-412.106) [-410.476] (-417.609) -- 0:01:03
      31000 -- (-412.619) (-413.969) [-412.035] (-411.543) * (-414.671) (-413.784) [-413.809] (-412.917) -- 0:01:02
      31500 -- (-411.408) (-411.996) [-416.103] (-416.199) * (-415.146) [-414.307] (-416.601) (-412.908) -- 0:01:01
      32000 -- (-411.662) (-413.844) [-417.021] (-412.152) * (-413.219) [-413.711] (-411.105) (-414.377) -- 0:01:00
      32500 -- (-418.449) (-415.921) [-415.906] (-412.155) * (-416.680) (-411.713) (-411.342) [-410.924] -- 0:00:59
      33000 -- (-414.704) (-412.249) [-422.384] (-410.257) * (-415.762) (-413.462) (-411.926) [-412.920] -- 0:00:58
      33500 -- (-413.014) (-411.400) [-421.821] (-410.917) * [-414.389] (-417.287) (-413.132) (-416.999) -- 0:00:57
      34000 -- [-411.890] (-409.845) (-420.609) (-411.529) * (-411.782) (-417.370) [-411.024] (-412.571) -- 0:00:56
      34500 -- [-410.148] (-412.981) (-417.974) (-413.623) * [-412.222] (-413.492) (-414.221) (-414.319) -- 0:00:55
      35000 -- (-409.971) [-412.954] (-412.933) (-412.968) * (-413.353) (-415.690) [-412.972] (-414.971) -- 0:00:55

      Average standard deviation of split frequencies: 0.036665

      35500 -- [-411.553] (-412.819) (-416.605) (-415.906) * (-414.335) (-411.816) (-412.853) [-412.909] -- 0:00:54
      36000 -- [-411.336] (-412.283) (-414.229) (-411.995) * (-410.608) (-415.053) [-412.609] (-413.039) -- 0:00:53
      36500 -- (-413.361) (-414.327) [-418.810] (-412.291) * (-412.842) [-413.287] (-411.374) (-412.308) -- 0:00:52
      37000 -- (-411.524) (-413.250) [-416.074] (-416.775) * [-412.531] (-415.505) (-418.480) (-415.383) -- 0:00:52
      37500 -- (-410.003) [-412.187] (-418.404) (-412.448) * (-415.866) [-413.527] (-422.209) (-413.082) -- 0:00:51
      38000 -- (-414.547) (-411.384) (-418.167) [-412.096] * (-412.606) (-420.620) (-411.452) [-409.682] -- 0:00:50
      38500 -- (-415.250) (-414.519) (-421.368) [-412.790] * (-411.541) [-412.723] (-411.930) (-410.270) -- 0:00:49
      39000 -- (-415.560) (-416.927) [-416.026] (-412.604) * (-415.379) [-413.590] (-414.461) (-416.935) -- 0:00:49
      39500 -- (-416.289) (-419.879) [-410.815] (-412.529) * (-415.509) [-412.982] (-413.779) (-412.624) -- 0:00:48
      40000 -- (-410.107) (-418.067) (-412.280) [-416.670] * (-414.356) (-414.723) [-412.834] (-412.835) -- 0:01:12

      Average standard deviation of split frequencies: 0.035996

      40500 -- (-411.777) (-417.673) [-415.101] (-415.975) * (-411.382) (-414.988) [-412.086] (-415.054) -- 0:01:11
      41000 -- (-410.815) (-417.103) (-413.896) [-414.524] * (-413.348) (-418.234) [-413.426] (-414.411) -- 0:01:10
      41500 -- [-410.929] (-418.506) (-412.059) (-411.905) * [-412.573] (-411.636) (-417.498) (-416.368) -- 0:01:09
      42000 -- (-413.558) (-418.782) [-413.910] (-413.649) * (-417.095) (-412.495) [-413.322] (-413.986) -- 0:01:08
      42500 -- (-412.335) (-417.293) (-417.143) [-410.703] * [-415.232] (-415.263) (-413.114) (-414.480) -- 0:01:07
      43000 -- [-410.378] (-417.416) (-415.320) (-415.405) * (-416.602) (-421.568) (-417.842) [-415.289] -- 0:01:06
      43500 -- (-413.311) (-416.921) (-411.270) [-417.255] * (-415.219) (-414.254) (-417.642) [-413.707] -- 0:01:05
      44000 -- (-409.104) (-424.100) (-408.756) [-411.207] * (-414.714) (-411.659) [-415.838] (-412.283) -- 0:01:05
      44500 -- (-411.974) (-413.629) [-414.787] (-412.971) * (-413.942) [-417.002] (-416.944) (-413.187) -- 0:01:04
      45000 -- (-415.367) (-414.183) [-412.600] (-413.994) * (-415.000) (-411.741) [-414.798] (-412.607) -- 0:01:03

      Average standard deviation of split frequencies: 0.026132

      45500 -- (-412.836) (-418.885) [-411.286] (-411.861) * [-411.405] (-411.706) (-416.655) (-412.949) -- 0:01:02
      46000 -- (-410.971) [-417.652] (-427.494) (-414.227) * (-412.162) (-413.770) (-411.732) [-411.825] -- 0:01:02
      46500 -- (-418.043) [-414.740] (-414.279) (-412.566) * (-413.628) [-412.098] (-415.810) (-417.136) -- 0:01:01
      47000 -- (-420.218) (-419.451) [-411.739] (-411.672) * (-411.628) (-411.481) [-411.704] (-418.176) -- 0:01:00
      47500 -- [-409.709] (-418.786) (-412.312) (-413.248) * (-412.890) (-414.788) (-413.272) [-413.130] -- 0:01:00
      48000 -- (-415.194) (-415.832) [-415.696] (-412.189) * (-415.812) [-414.145] (-415.970) (-411.309) -- 0:00:59
      48500 -- (-410.031) [-415.220] (-411.762) (-410.664) * (-413.505) (-415.029) [-416.963] (-413.087) -- 0:00:58
      49000 -- (-412.300) (-412.523) [-413.928] (-415.512) * (-413.822) (-413.529) (-416.011) [-411.850] -- 0:00:58
      49500 -- (-412.066) (-415.913) [-413.354] (-410.795) * (-414.851) (-412.815) (-413.533) [-412.253] -- 0:00:57
      50000 -- (-414.026) (-411.964) [-416.871] (-413.619) * (-412.810) (-413.511) (-412.495) [-415.416] -- 0:00:57

      Average standard deviation of split frequencies: 0.028891

      50500 -- (-413.358) (-414.101) [-416.464] (-416.607) * [-413.130] (-414.944) (-418.022) (-415.996) -- 0:00:56
      51000 -- (-414.115) (-418.229) [-415.930] (-413.716) * (-411.346) (-412.872) [-414.443] (-414.818) -- 0:00:55
      51500 -- (-415.354) (-417.899) [-413.156] (-411.272) * [-412.862] (-410.862) (-418.654) (-414.302) -- 0:00:55
      52000 -- (-414.017) (-418.124) [-420.329] (-413.879) * [-412.659] (-412.566) (-411.245) (-413.425) -- 0:00:54
      52500 -- (-408.772) (-415.996) [-414.391] (-410.046) * (-415.258) [-411.515] (-412.189) (-414.825) -- 0:00:54
      53000 -- (-412.377) (-417.434) [-416.301] (-411.512) * (-415.317) [-410.307] (-419.749) (-414.580) -- 0:00:53
      53500 -- (-413.358) (-414.458) [-415.583] (-409.372) * (-413.065) [-412.923] (-414.630) (-412.686) -- 0:00:53
      54000 -- (-415.164) (-415.185) [-420.671] (-409.974) * [-412.132] (-417.642) (-411.818) (-412.305) -- 0:00:52
      54500 -- (-411.807) [-416.675] (-410.773) (-410.994) * (-414.527) (-416.213) (-415.069) [-414.126] -- 0:00:52
      55000 -- (-411.987) [-414.891] (-419.261) (-410.467) * (-417.513) (-414.973) (-412.519) [-414.806] -- 0:00:51

      Average standard deviation of split frequencies: 0.024811

      55500 -- (-413.271) (-414.578) (-417.502) [-410.215] * [-413.261] (-413.259) (-417.649) (-413.495) -- 0:00:51
      56000 -- (-412.165) (-414.287) [-410.646] (-412.160) * (-414.637) (-414.561) [-415.931] (-415.264) -- 0:01:07
      56500 -- (-411.184) (-418.657) [-414.587] (-413.044) * (-415.390) (-413.156) [-415.000] (-414.890) -- 0:01:06
      57000 -- (-409.532) (-415.204) [-412.592] (-412.312) * (-413.411) (-416.055) (-412.756) [-412.441] -- 0:01:06
      57500 -- (-411.735) (-417.287) (-412.989) [-410.849] * (-414.372) [-418.993] (-416.139) (-414.830) -- 0:01:05
      58000 -- (-415.893) (-415.727) [-410.256] (-411.791) * [-411.948] (-415.992) (-414.961) (-419.662) -- 0:01:04
      58500 -- (-414.863) [-413.073] (-410.085) (-416.274) * (-411.446) (-413.708) [-414.065] (-414.183) -- 0:01:04
      59000 -- (-410.987) (-416.209) [-413.825] (-411.991) * (-411.391) [-413.476] (-416.141) (-413.028) -- 0:01:03
      59500 -- (-414.353) (-419.823) [-412.058] (-414.656) * (-415.094) [-413.524] (-412.756) (-415.069) -- 0:01:03
      60000 -- (-413.691) (-414.879) [-408.838] (-413.132) * (-412.704) (-417.347) [-415.121] (-415.044) -- 0:01:02

      Average standard deviation of split frequencies: 0.023700

      60500 -- (-412.666) (-415.487) [-412.966] (-412.826) * (-414.678) [-413.934] (-411.394) (-414.611) -- 0:01:02
      61000 -- (-410.183) (-421.157) (-411.787) [-414.335] * [-413.488] (-413.541) (-417.913) (-413.661) -- 0:01:01
      61500 -- (-414.383) (-412.223) [-409.892] (-417.772) * (-415.304) (-420.368) [-412.325] (-413.071) -- 0:01:01
      62000 -- (-408.391) [-418.953] (-414.247) (-415.887) * (-416.449) (-414.480) [-415.879] (-414.212) -- 0:01:00
      62500 -- [-410.338] (-416.822) (-414.328) (-415.020) * (-416.831) (-413.130) [-413.176] (-413.388) -- 0:01:00
      63000 -- (-413.160) (-418.328) (-411.938) [-411.906] * (-415.043) (-413.831) (-415.614) [-413.113] -- 0:00:59
      63500 -- (-414.331) (-418.297) (-413.931) [-410.512] * [-413.031] (-413.346) (-416.166) (-422.832) -- 0:00:58
      64000 -- (-410.738) (-414.084) (-417.201) [-419.360] * [-411.791] (-414.824) (-418.154) (-415.606) -- 0:00:58
      64500 -- (-410.373) (-418.038) (-414.586) [-410.140] * (-412.479) (-412.368) [-412.126] (-418.385) -- 0:00:58
      65000 -- (-412.545) [-415.248] (-412.962) (-411.100) * (-413.017) (-415.509) (-417.504) [-411.811] -- 0:00:57

      Average standard deviation of split frequencies: 0.021070

      65500 -- (-413.465) [-417.543] (-415.097) (-416.116) * (-414.764) (-415.192) [-414.327] (-411.911) -- 0:00:57
      66000 -- [-411.245] (-413.647) (-412.956) (-414.465) * (-411.145) (-414.801) (-417.222) [-413.768] -- 0:00:56
      66500 -- (-410.075) [-411.652] (-412.799) (-413.505) * (-410.968) (-413.209) (-415.134) [-413.071] -- 0:00:56
      67000 -- (-411.623) [-416.167] (-413.921) (-411.822) * (-412.722) [-416.882] (-411.725) (-413.974) -- 0:00:55
      67500 -- (-415.226) [-414.087] (-413.541) (-416.352) * (-411.669) [-413.486] (-414.609) (-411.758) -- 0:00:55
      68000 -- [-416.619] (-416.711) (-411.557) (-413.793) * [-414.707] (-413.859) (-413.328) (-413.094) -- 0:00:54
      68500 -- (-410.231) (-413.458) (-412.525) [-413.114] * (-414.601) (-416.236) [-413.574] (-410.554) -- 0:00:54
      69000 -- [-411.662] (-415.421) (-418.700) (-413.873) * (-413.763) (-417.346) [-413.248] (-413.344) -- 0:00:53
      69500 -- (-412.095) (-415.616) [-412.949] (-413.500) * [-411.942] (-414.319) (-416.495) (-418.907) -- 0:00:53
      70000 -- [-412.478] (-417.116) (-412.752) (-416.098) * (-417.228) (-415.482) [-413.282] (-415.268) -- 0:00:53

      Average standard deviation of split frequencies: 0.022821

      70500 -- (-412.220) [-416.147] (-412.486) (-414.094) * [-411.500] (-416.367) (-418.099) (-414.835) -- 0:00:52
      71000 -- [-414.588] (-417.288) (-412.884) (-411.573) * (-413.409) [-414.730] (-413.566) (-414.441) -- 0:00:52
      71500 -- (-410.830) [-415.002] (-416.536) (-414.636) * (-413.687) [-412.119] (-413.482) (-419.089) -- 0:01:04
      72000 -- (-414.053) (-414.872) (-412.746) [-414.891] * (-418.473) [-413.724] (-410.276) (-417.412) -- 0:01:04
      72500 -- (-412.647) [-413.269] (-415.327) (-415.814) * (-411.545) [-415.228] (-415.482) (-412.872) -- 0:01:03
      73000 -- (-413.582) (-417.741) (-415.527) [-413.156] * (-411.367) [-412.762] (-415.165) (-411.088) -- 0:01:03
      73500 -- (-412.055) (-418.031) (-410.030) [-412.839] * (-413.879) (-412.248) (-416.673) [-410.587] -- 0:01:03
      74000 -- (-410.835) [-415.286] (-413.197) (-412.103) * (-412.051) (-417.044) [-417.690] (-412.475) -- 0:01:02
      74500 -- [-414.985] (-414.479) (-414.334) (-415.662) * (-414.079) (-416.695) [-415.948] (-415.910) -- 0:01:02
      75000 -- (-411.167) (-413.368) [-415.204] (-414.331) * [-412.282] (-420.897) (-416.091) (-411.464) -- 0:01:01

      Average standard deviation of split frequencies: 0.022872

      75500 -- [-414.566] (-414.315) (-410.727) (-414.813) * (-410.590) (-419.124) [-417.536] (-413.284) -- 0:01:01
      76000 -- (-412.593) [-411.144] (-412.783) (-414.753) * (-410.732) [-414.329] (-418.129) (-413.124) -- 0:01:00
      76500 -- (-411.706) [-413.885] (-417.282) (-412.390) * (-411.514) [-414.652] (-416.017) (-410.665) -- 0:01:00
      77000 -- [-412.824] (-415.802) (-411.110) (-411.553) * (-412.205) (-418.804) (-414.107) [-411.153] -- 0:00:59
      77500 -- (-412.770) [-411.682] (-412.234) (-410.507) * (-412.500) (-418.620) (-414.370) [-410.759] -- 0:00:59
      78000 -- [-412.449] (-412.251) (-412.938) (-422.378) * [-412.399] (-417.062) (-414.335) (-412.333) -- 0:00:59
      78500 -- (-416.548) (-414.796) (-414.249) [-417.685] * (-412.818) (-415.722) [-410.304] (-413.982) -- 0:00:58
      79000 -- (-411.169) [-412.510] (-416.139) (-415.907) * (-409.866) [-411.657] (-412.811) (-414.113) -- 0:00:58
      79500 -- (-409.771) (-414.046) [-416.260] (-414.464) * (-413.560) (-412.841) (-414.264) [-411.323] -- 0:00:57
      80000 -- (-407.604) [-413.454] (-416.862) (-413.138) * (-412.145) [-411.362] (-412.715) (-409.861) -- 0:00:57

      Average standard deviation of split frequencies: 0.020625

      80500 -- [-411.215] (-412.614) (-417.037) (-413.883) * (-413.133) [-415.064] (-413.586) (-410.074) -- 0:00:57
      81000 -- [-410.682] (-411.996) (-413.254) (-413.265) * (-412.997) [-410.282] (-422.448) (-412.093) -- 0:00:56
      81500 -- (-414.601) (-411.347) (-420.104) [-411.686] * [-410.345] (-413.306) (-414.831) (-412.789) -- 0:00:56
      82000 -- [-414.786] (-414.285) (-415.923) (-411.148) * (-411.259) (-413.509) [-412.133] (-411.397) -- 0:00:55
      82500 -- (-412.019) (-413.492) [-415.141] (-410.837) * (-408.956) (-411.048) (-413.251) [-410.425] -- 0:00:55
      83000 -- (-417.005) [-416.588] (-410.986) (-411.326) * (-408.520) [-415.809] (-412.505) (-409.638) -- 0:00:55
      83500 -- (-414.603) (-411.016) (-414.763) [-414.410] * (-409.917) (-415.746) [-413.725] (-410.744) -- 0:00:54
      84000 -- (-411.929) (-412.252) (-416.293) [-413.754] * (-412.698) (-413.349) (-412.835) [-410.838] -- 0:00:54
      84500 -- [-411.272] (-420.093) (-412.370) (-415.840) * (-414.246) (-415.201) [-412.224] (-411.791) -- 0:00:54
      85000 -- (-411.909) [-415.824] (-413.273) (-413.678) * (-415.202) (-412.839) (-414.998) [-412.240] -- 0:00:53

      Average standard deviation of split frequencies: 0.020708

      85500 -- (-410.270) [-412.212] (-414.486) (-418.344) * (-411.851) (-415.468) (-415.634) [-412.607] -- 0:00:53
      86000 -- [-412.289] (-411.507) (-412.152) (-413.732) * [-410.520] (-413.558) (-412.525) (-409.631) -- 0:00:53
      86500 -- (-412.686) [-410.385] (-412.464) (-419.108) * [-417.239] (-413.893) (-414.933) (-411.134) -- 0:00:52
      87000 -- (-413.485) [-411.943] (-411.413) (-415.081) * [-411.101] (-417.244) (-418.303) (-412.195) -- 0:00:52
      87500 -- (-411.932) [-417.265] (-417.416) (-416.464) * (-411.715) [-414.779] (-411.188) (-412.330) -- 0:01:02
      88000 -- (-410.030) (-411.550) (-413.673) [-410.580] * (-412.178) (-416.877) (-413.434) [-414.503] -- 0:01:02
      88500 -- (-411.446) (-414.409) (-414.673) [-412.925] * (-411.250) (-417.840) [-412.374] (-416.138) -- 0:01:01
      89000 -- (-413.650) (-415.368) [-410.895] (-416.621) * (-414.659) [-416.843] (-414.682) (-416.667) -- 0:01:01
      89500 -- (-411.355) [-410.026] (-410.913) (-412.984) * (-414.084) (-410.452) (-416.000) [-418.555] -- 0:01:01
      90000 -- [-410.492] (-415.210) (-416.608) (-412.192) * [-410.949] (-413.738) (-411.459) (-416.536) -- 0:01:00

      Average standard deviation of split frequencies: 0.022530

      90500 -- (-413.430) (-413.407) [-411.954] (-411.803) * (-413.240) [-415.663] (-414.882) (-412.777) -- 0:01:00
      91000 -- (-412.462) (-411.253) [-411.768] (-414.040) * (-417.613) (-410.596) [-412.659] (-414.962) -- 0:00:59
      91500 -- [-409.179] (-415.712) (-413.261) (-411.364) * [-413.245] (-410.735) (-412.697) (-414.701) -- 0:00:59
      92000 -- (-410.950) (-412.447) (-409.591) [-414.233] * (-413.913) (-417.402) [-411.345] (-412.869) -- 0:00:59
      92500 -- [-411.040] (-412.756) (-412.889) (-414.034) * (-412.435) [-416.782] (-411.436) (-410.941) -- 0:00:58
      93000 -- (-414.187) (-412.570) (-418.538) [-413.744] * (-415.040) (-411.783) [-413.430] (-412.068) -- 0:00:58
      93500 -- (-409.791) (-412.629) (-413.166) [-414.647] * (-414.300) [-412.329] (-410.275) (-414.639) -- 0:00:58
      94000 -- (-413.958) (-411.743) [-418.998] (-414.722) * (-414.706) [-410.915] (-414.892) (-419.305) -- 0:00:57
      94500 -- [-410.557] (-412.470) (-418.847) (-412.944) * (-413.065) (-414.779) [-414.020] (-415.481) -- 0:00:57
      95000 -- (-412.091) (-414.413) (-413.710) [-414.208] * (-412.012) [-412.617] (-413.242) (-413.093) -- 0:00:57

      Average standard deviation of split frequencies: 0.023686

      95500 -- (-410.306) (-411.613) [-415.680] (-418.717) * (-412.048) (-413.074) [-413.022] (-412.365) -- 0:00:56
      96000 -- [-411.343] (-411.417) (-410.538) (-415.466) * (-416.411) (-415.250) (-411.253) [-411.653] -- 0:00:56
      96500 -- [-411.420] (-413.885) (-411.805) (-411.271) * (-414.956) (-419.523) [-410.402] (-413.141) -- 0:00:56
      97000 -- [-413.081] (-411.532) (-409.967) (-416.667) * (-412.700) (-413.232) (-411.804) [-413.205] -- 0:00:55
      97500 -- [-411.646] (-414.346) (-411.048) (-416.066) * (-412.952) (-412.976) (-412.959) [-410.794] -- 0:00:55
      98000 -- (-412.676) (-413.417) (-415.661) [-414.198] * [-410.814] (-411.298) (-412.338) (-410.480) -- 0:00:55
      98500 -- (-409.835) [-416.341] (-412.514) (-416.319) * (-411.860) [-413.297] (-411.682) (-414.677) -- 0:00:54
      99000 -- [-410.332] (-416.354) (-415.939) (-415.718) * (-413.901) (-412.930) (-414.161) [-409.686] -- 0:00:54
      99500 -- [-409.680] (-412.703) (-415.865) (-411.993) * (-417.320) (-414.368) (-417.160) [-410.552] -- 0:00:54
      100000 -- (-411.741) [-412.746] (-413.728) (-411.341) * (-416.398) (-411.914) [-414.196] (-410.377) -- 0:00:54

      Average standard deviation of split frequencies: 0.021486

      100500 -- (-410.225) [-413.626] (-413.886) (-418.903) * (-413.544) (-416.783) [-415.372] (-416.166) -- 0:00:53
      101000 -- (-410.876) (-417.323) [-413.812] (-414.721) * (-416.102) (-412.074) (-411.470) [-409.838] -- 0:00:53
      101500 -- (-411.490) (-415.888) (-415.862) [-417.546] * [-412.049] (-416.105) (-414.251) (-413.773) -- 0:00:53
      102000 -- [-413.590] (-416.171) (-414.373) (-414.465) * [-412.010] (-415.797) (-411.595) (-412.479) -- 0:00:52
      102500 -- [-411.992] (-416.983) (-415.443) (-418.638) * [-410.552] (-412.396) (-412.118) (-414.080) -- 0:00:52
      103000 -- (-415.480) (-416.275) [-414.367] (-412.424) * (-411.529) [-414.230] (-416.091) (-413.281) -- 0:01:00
      103500 -- (-413.654) [-414.629] (-414.747) (-411.851) * (-412.676) (-412.061) (-409.177) [-411.661] -- 0:01:00
      104000 -- (-413.913) (-416.080) (-412.488) [-411.548] * (-414.331) (-416.056) [-411.595] (-414.725) -- 0:01:00
      104500 -- (-414.326) [-414.726] (-411.773) (-412.461) * (-416.089) (-414.680) (-414.763) [-412.770] -- 0:00:59
      105000 -- (-414.211) (-416.273) (-415.251) [-416.305] * (-412.518) (-416.838) [-410.460] (-412.341) -- 0:00:59

      Average standard deviation of split frequencies: 0.020754

      105500 -- [-413.522] (-416.193) (-415.060) (-415.240) * (-418.181) (-416.154) [-409.980] (-415.962) -- 0:00:59
      106000 -- (-416.625) (-420.179) (-414.791) [-414.145] * (-412.256) (-416.825) (-415.207) [-412.248] -- 0:00:59
      106500 -- (-413.126) (-418.702) [-412.243] (-415.008) * (-408.982) (-419.366) (-413.400) [-411.951] -- 0:00:58
      107000 -- (-414.569) (-420.139) (-413.572) [-412.758] * (-413.835) (-415.968) (-413.792) [-411.439] -- 0:00:58
      107500 -- (-415.829) (-417.954) (-413.585) [-411.847] * [-412.672] (-416.780) (-410.452) (-413.208) -- 0:00:58
      108000 -- (-414.473) (-418.137) [-414.619] (-415.283) * (-411.054) (-418.110) [-411.579] (-415.070) -- 0:00:57
      108500 -- (-410.870) (-419.149) (-412.970) [-411.825] * (-413.766) (-413.229) (-415.652) [-418.103] -- 0:00:57
      109000 -- (-412.207) (-422.319) [-412.438] (-413.733) * [-411.016] (-416.996) (-415.740) (-415.869) -- 0:00:57
      109500 -- (-417.028) (-417.382) (-422.827) [-411.720] * (-415.309) [-416.955] (-417.993) (-417.065) -- 0:00:56
      110000 -- (-414.530) (-416.485) [-412.776] (-414.929) * (-414.610) [-415.747] (-413.322) (-412.353) -- 0:00:56

      Average standard deviation of split frequencies: 0.016802

      110500 -- (-415.773) (-414.417) [-412.464] (-415.993) * (-415.358) [-416.840] (-414.527) (-412.556) -- 0:00:56
      111000 -- (-413.163) (-412.520) [-413.648] (-412.984) * (-411.323) (-414.177) (-414.136) [-410.141] -- 0:00:56
      111500 -- (-415.521) (-417.116) [-415.703] (-416.594) * [-414.482] (-413.221) (-415.699) (-416.404) -- 0:00:55
      112000 -- [-414.633] (-412.998) (-416.054) (-417.370) * (-411.794) (-412.431) [-413.713] (-417.870) -- 0:00:55
      112500 -- (-412.708) [-415.730] (-418.016) (-418.411) * (-412.584) [-415.416] (-412.013) (-414.933) -- 0:00:55
      113000 -- (-411.296) [-413.418] (-411.329) (-418.239) * (-412.477) (-412.102) (-411.989) [-415.472] -- 0:00:54
      113500 -- (-413.672) (-419.983) [-413.616] (-421.820) * (-412.839) (-416.950) [-412.138] (-415.137) -- 0:00:54
      114000 -- (-410.661) [-415.023] (-412.328) (-417.817) * (-413.414) [-411.683] (-414.557) (-413.593) -- 0:00:54
      114500 -- (-411.776) [-411.632] (-415.980) (-418.662) * [-410.334] (-413.451) (-415.514) (-415.686) -- 0:00:54
      115000 -- (-411.891) (-412.904) [-412.807] (-424.029) * (-409.251) (-411.356) (-413.590) [-414.315] -- 0:00:53

      Average standard deviation of split frequencies: 0.018965

      115500 -- [-410.610] (-414.111) (-412.401) (-413.558) * (-415.104) (-413.245) [-412.802] (-413.774) -- 0:00:53
      116000 -- (-414.464) [-412.309] (-413.694) (-413.672) * (-412.834) (-417.541) [-412.076] (-417.754) -- 0:00:53
      116500 -- [-410.975] (-416.862) (-412.614) (-417.583) * (-412.109) [-412.773] (-413.435) (-414.883) -- 0:00:53
      117000 -- (-412.459) [-413.955] (-417.424) (-415.972) * (-411.613) (-412.127) (-412.568) [-418.632] -- 0:00:52
      117500 -- [-414.481] (-418.024) (-415.600) (-415.251) * (-414.455) (-412.954) (-412.449) [-415.510] -- 0:00:52
      118000 -- (-412.225) (-419.029) (-414.402) [-417.680] * (-413.501) (-413.974) (-417.977) [-412.493] -- 0:00:52
      118500 -- (-414.115) [-417.088] (-416.535) (-421.925) * (-415.362) (-419.079) [-411.977] (-412.812) -- 0:00:52
      119000 -- [-412.760] (-416.420) (-413.603) (-416.607) * [-410.931] (-409.946) (-411.234) (-417.382) -- 0:00:59
      119500 -- (-414.074) (-414.972) [-412.584] (-416.374) * (-409.305) (-412.838) (-416.013) [-413.495] -- 0:00:58
      120000 -- [-412.287] (-414.061) (-415.044) (-415.692) * (-413.955) (-413.881) [-410.197] (-413.561) -- 0:00:58

      Average standard deviation of split frequencies: 0.025784

      120500 -- (-412.492) (-417.630) (-413.581) [-414.619] * [-412.709] (-416.576) (-412.938) (-415.670) -- 0:00:58
      121000 -- (-410.406) (-413.987) (-415.926) [-414.599] * (-410.817) [-416.100] (-413.721) (-416.661) -- 0:00:58
      121500 -- [-409.982] (-412.443) (-413.360) (-418.326) * (-417.414) (-416.661) [-414.210] (-410.737) -- 0:00:57
      122000 -- (-417.807) (-417.925) (-410.989) [-414.250] * (-411.570) (-417.099) (-414.989) [-414.339] -- 0:00:57
      122500 -- (-411.843) [-413.053] (-413.483) (-413.070) * [-412.460] (-416.480) (-412.350) (-420.435) -- 0:00:57
      123000 -- (-413.176) (-411.488) (-418.585) [-416.042] * (-409.858) (-418.453) (-414.827) [-416.513] -- 0:00:57
      123500 -- (-411.204) (-421.498) [-414.097] (-414.696) * (-415.575) (-418.872) (-411.100) [-413.891] -- 0:00:56
      124000 -- [-412.651] (-411.993) (-420.116) (-415.131) * (-411.071) [-417.546] (-411.803) (-413.128) -- 0:00:56
      124500 -- [-415.021] (-411.714) (-415.076) (-417.727) * (-411.451) (-416.524) (-411.310) [-412.601] -- 0:00:56
      125000 -- [-412.910] (-417.573) (-416.793) (-417.624) * [-411.415] (-420.422) (-414.784) (-415.696) -- 0:00:56

      Average standard deviation of split frequencies: 0.022074

      125500 -- (-416.686) (-414.962) (-412.983) [-416.096] * [-413.826] (-417.810) (-418.190) (-413.300) -- 0:00:55
      126000 -- [-411.436] (-413.159) (-414.043) (-416.240) * (-413.388) [-411.994] (-416.356) (-413.387) -- 0:00:55
      126500 -- [-411.497] (-411.313) (-413.265) (-417.312) * (-412.963) (-414.689) (-418.554) [-412.386] -- 0:00:55
      127000 -- [-409.782] (-415.337) (-416.276) (-414.696) * [-410.047] (-413.801) (-412.860) (-414.870) -- 0:00:54
      127500 -- (-415.741) [-411.666] (-413.097) (-414.974) * (-415.277) (-419.078) [-411.050] (-416.172) -- 0:00:54
      128000 -- [-414.689] (-414.308) (-414.620) (-418.449) * (-415.790) (-412.472) [-411.043] (-416.220) -- 0:00:54
      128500 -- [-415.005] (-416.816) (-414.885) (-419.348) * (-412.611) (-413.088) (-411.888) [-412.201] -- 0:00:54
      129000 -- (-417.026) (-416.212) [-417.735] (-413.088) * [-417.164] (-413.403) (-416.025) (-414.855) -- 0:00:54
      129500 -- (-412.333) (-414.628) (-414.054) [-414.747] * [-413.662] (-412.506) (-414.577) (-412.432) -- 0:00:53
      130000 -- (-414.996) (-413.611) [-414.074] (-413.403) * (-410.742) (-417.994) [-410.740] (-418.896) -- 0:00:53

      Average standard deviation of split frequencies: 0.024172

      130500 -- [-415.939] (-413.415) (-415.388) (-414.280) * (-412.103) [-409.375] (-412.060) (-416.981) -- 0:00:53
      131000 -- [-413.120] (-414.403) (-416.584) (-414.688) * (-409.905) (-415.146) (-410.480) [-418.116] -- 0:00:53
      131500 -- [-409.069] (-414.662) (-416.139) (-419.765) * [-412.301] (-413.691) (-411.822) (-412.744) -- 0:00:52
      132000 -- (-410.467) (-411.629) (-414.709) [-412.256] * (-412.787) [-412.246] (-411.056) (-417.908) -- 0:00:52
      132500 -- [-410.509] (-411.460) (-416.259) (-409.843) * (-411.301) (-409.518) [-413.530] (-410.611) -- 0:00:52
      133000 -- (-412.046) (-412.810) (-413.808) [-409.651] * (-416.648) (-411.127) (-409.179) [-412.394] -- 0:00:52
      133500 -- (-415.319) (-413.310) [-412.965] (-413.080) * (-415.004) (-409.498) (-412.753) [-410.124] -- 0:00:51
      134000 -- [-413.187] (-414.432) (-414.972) (-411.427) * (-418.549) [-411.516] (-412.867) (-416.262) -- 0:00:51
      134500 -- (-410.921) (-414.227) (-416.613) [-413.005] * (-418.069) (-410.550) [-417.102] (-416.755) -- 0:00:57
      135000 -- (-410.459) [-413.910] (-418.281) (-414.362) * (-414.412) (-414.195) [-412.029] (-419.061) -- 0:00:57

      Average standard deviation of split frequencies: 0.016236

      135500 -- (-415.143) [-411.173] (-412.249) (-414.038) * (-412.515) (-411.323) [-411.831] (-412.296) -- 0:00:57
      136000 -- [-414.568] (-420.040) (-412.839) (-413.227) * (-414.037) (-412.744) [-411.785] (-412.946) -- 0:00:57
      136500 -- [-413.918] (-417.702) (-412.488) (-413.093) * [-412.268] (-417.361) (-416.359) (-414.704) -- 0:00:56
      137000 -- [-410.688] (-414.843) (-410.919) (-413.091) * (-414.685) (-411.538) [-410.793] (-410.828) -- 0:00:56
      137500 -- (-415.164) [-414.771] (-413.670) (-412.219) * (-415.340) (-414.138) (-412.822) [-410.773] -- 0:00:56
      138000 -- [-412.251] (-418.326) (-413.220) (-412.824) * [-415.922] (-417.172) (-413.192) (-414.059) -- 0:00:56
      138500 -- (-416.197) [-412.851] (-413.671) (-417.411) * (-414.153) (-413.927) (-415.179) [-410.381] -- 0:00:55
      139000 -- (-413.552) [-412.494] (-411.511) (-412.311) * (-410.653) [-409.798] (-413.162) (-411.941) -- 0:00:55
      139500 -- (-416.549) [-409.936] (-418.942) (-412.845) * (-412.322) (-410.298) (-416.273) [-414.659] -- 0:00:55
      140000 -- (-416.108) [-415.324] (-412.222) (-413.948) * (-416.593) (-414.583) (-415.805) [-418.128] -- 0:00:55

      Average standard deviation of split frequencies: 0.017285

      140500 -- (-417.211) (-414.400) (-410.984) [-414.468] * (-414.851) (-412.490) [-411.008] (-423.771) -- 0:00:55
      141000 -- (-412.525) [-411.938] (-413.931) (-413.894) * [-415.022] (-413.249) (-413.145) (-418.486) -- 0:00:54
      141500 -- (-414.731) (-411.338) [-411.422] (-416.869) * (-414.658) [-412.959] (-412.247) (-414.145) -- 0:00:54
      142000 -- (-412.036) [-410.861] (-416.500) (-412.930) * [-415.891] (-412.366) (-411.291) (-412.602) -- 0:00:54
      142500 -- (-412.684) (-415.779) (-415.396) [-416.361] * [-415.749] (-420.185) (-412.860) (-413.073) -- 0:00:54
      143000 -- (-412.442) (-412.744) [-410.885] (-415.400) * (-416.143) (-416.025) (-413.582) [-417.466] -- 0:00:53
      143500 -- [-416.607] (-417.936) (-412.907) (-416.666) * (-414.247) (-416.692) (-411.661) [-413.161] -- 0:00:53
      144000 -- [-417.234] (-413.164) (-413.145) (-419.651) * (-411.758) (-413.051) [-411.241] (-411.277) -- 0:00:53
      144500 -- [-413.809] (-414.073) (-412.600) (-415.272) * [-413.507] (-412.437) (-411.681) (-412.766) -- 0:00:53
      145000 -- (-411.684) (-414.595) (-411.408) [-414.261] * (-413.764) (-411.753) [-410.976] (-411.940) -- 0:00:53

      Average standard deviation of split frequencies: 0.016605

      145500 -- (-414.529) (-414.553) [-418.330] (-413.813) * [-411.705] (-412.224) (-412.261) (-408.461) -- 0:00:52
      146000 -- (-412.137) [-414.449] (-413.072) (-413.850) * (-412.929) (-412.905) (-410.895) [-410.500] -- 0:00:52
      146500 -- (-415.713) [-412.394] (-417.681) (-412.986) * (-414.555) [-414.625] (-414.242) (-411.798) -- 0:00:52
      147000 -- (-409.905) [-410.734] (-415.138) (-412.091) * (-420.770) (-413.796) (-415.566) [-409.653] -- 0:00:52
      147500 -- (-413.865) (-411.717) (-419.685) [-414.512] * (-418.176) [-412.034] (-410.234) (-409.199) -- 0:00:52
      148000 -- [-413.649] (-412.994) (-413.308) (-413.535) * [-417.424] (-411.713) (-411.981) (-412.327) -- 0:00:51
      148500 -- (-412.259) (-413.848) (-413.427) [-412.389] * (-414.529) [-411.148] (-415.535) (-410.709) -- 0:00:51
      149000 -- (-415.219) (-415.731) (-416.402) [-411.715] * (-409.825) [-412.223] (-414.927) (-414.468) -- 0:00:51
      149500 -- (-415.523) (-416.218) [-415.554] (-414.883) * (-411.048) [-414.448] (-415.079) (-415.560) -- 0:00:56
      150000 -- (-418.037) (-412.971) [-412.822] (-412.683) * (-414.759) [-416.473] (-412.860) (-416.240) -- 0:00:56

      Average standard deviation of split frequencies: 0.017052

      150500 -- (-414.304) (-410.708) [-413.425] (-419.002) * (-417.621) (-410.678) (-414.011) [-412.527] -- 0:00:56
      151000 -- [-413.660] (-412.620) (-413.208) (-416.125) * (-416.326) [-412.564] (-414.439) (-413.786) -- 0:00:56
      151500 -- (-411.604) (-410.485) (-415.707) [-414.510] * (-413.305) [-410.773] (-413.634) (-413.900) -- 0:00:56
      152000 -- (-418.106) (-411.497) (-413.179) [-416.229] * [-411.945] (-412.588) (-410.259) (-419.378) -- 0:00:55
      152500 -- (-415.471) (-414.945) [-413.984] (-416.824) * (-414.681) [-417.945] (-411.360) (-419.213) -- 0:00:55
      153000 -- [-414.003] (-417.683) (-415.513) (-415.445) * (-416.381) [-413.252] (-413.500) (-415.748) -- 0:00:55
      153500 -- [-412.794] (-415.724) (-413.889) (-415.762) * [-410.514] (-413.996) (-414.695) (-411.979) -- 0:00:55
      154000 -- (-415.548) [-412.641] (-410.416) (-420.358) * [-412.924] (-411.369) (-415.530) (-409.805) -- 0:00:54
      154500 -- (-415.533) [-410.947] (-412.454) (-418.429) * (-414.857) (-414.202) (-410.875) [-412.449] -- 0:00:54
      155000 -- (-415.708) (-412.688) (-413.988) [-410.957] * (-416.922) (-414.454) (-410.358) [-410.880] -- 0:00:54

      Average standard deviation of split frequencies: 0.016771

      155500 -- (-412.099) [-412.787] (-411.734) (-416.782) * (-414.474) [-411.364] (-410.864) (-413.411) -- 0:00:54
      156000 -- [-418.180] (-413.105) (-414.981) (-414.154) * (-413.471) (-412.048) [-411.721] (-414.012) -- 0:00:54
      156500 -- (-415.429) [-409.648] (-415.680) (-414.744) * (-412.497) (-413.470) [-411.479] (-414.653) -- 0:00:53
      157000 -- (-422.992) (-418.719) [-412.725] (-416.111) * (-413.341) (-412.522) [-412.683] (-413.146) -- 0:00:53
      157500 -- (-416.474) [-414.264] (-413.576) (-412.280) * [-411.833] (-410.555) (-413.369) (-415.990) -- 0:00:53
      158000 -- (-419.846) [-410.430] (-417.011) (-412.685) * (-412.145) (-416.584) [-413.616] (-416.350) -- 0:00:53
      158500 -- (-424.437) [-415.574] (-414.249) (-413.612) * (-412.355) [-411.937] (-414.020) (-416.538) -- 0:00:53
      159000 -- (-418.510) (-413.874) (-411.995) [-411.178] * (-410.259) [-414.355] (-413.251) (-414.480) -- 0:00:52
      159500 -- [-410.669] (-414.824) (-412.582) (-414.494) * [-412.935] (-412.955) (-413.070) (-416.703) -- 0:00:52
      160000 -- (-415.028) (-414.231) [-412.139] (-414.451) * (-417.941) [-413.107] (-413.607) (-418.289) -- 0:00:52

      Average standard deviation of split frequencies: 0.015906

      160500 -- (-417.367) (-413.435) [-411.576] (-414.338) * (-411.624) (-415.456) (-413.522) [-411.953] -- 0:00:52
      161000 -- (-417.044) [-415.744] (-412.875) (-413.030) * (-411.293) (-414.304) (-412.191) [-412.527] -- 0:00:52
      161500 -- (-412.040) (-417.639) [-411.441] (-412.409) * [-411.321] (-415.567) (-415.597) (-415.256) -- 0:00:51
      162000 -- [-414.267] (-413.333) (-414.212) (-412.874) * (-413.921) (-416.600) [-413.847] (-412.610) -- 0:00:51
      162500 -- (-413.590) [-416.297] (-414.611) (-413.296) * [-413.026] (-419.448) (-409.545) (-412.011) -- 0:00:51
      163000 -- (-416.228) (-418.114) (-412.352) [-414.570] * (-414.336) (-411.752) [-411.961] (-414.238) -- 0:00:51
      163500 -- [-411.831] (-411.916) (-411.637) (-412.174) * [-416.899] (-416.492) (-414.166) (-414.820) -- 0:00:51
      164000 -- (-413.203) (-413.608) [-408.995] (-413.026) * (-412.484) (-411.467) [-411.600] (-418.078) -- 0:00:50
      164500 -- (-417.648) (-412.008) [-410.840] (-411.604) * (-414.078) (-413.121) [-413.904] (-414.180) -- 0:00:50
      165000 -- (-411.757) (-417.219) [-415.736] (-411.651) * (-411.783) (-411.973) [-412.603] (-413.466) -- 0:00:55

      Average standard deviation of split frequencies: 0.016471

      165500 -- (-413.231) (-413.068) [-411.168] (-412.162) * (-414.526) (-416.482) [-415.279] (-415.967) -- 0:00:55
      166000 -- (-415.006) (-415.276) [-415.736] (-411.956) * [-415.121] (-414.602) (-412.178) (-414.597) -- 0:00:55
      166500 -- (-413.343) (-414.688) [-412.645] (-412.468) * (-413.740) (-415.072) [-413.416] (-417.579) -- 0:00:55
      167000 -- (-415.162) (-417.763) [-411.605] (-411.749) * [-411.463] (-413.920) (-410.894) (-411.454) -- 0:00:54
      167500 -- (-412.053) (-417.100) (-413.513) [-412.771] * (-415.056) [-416.120] (-414.119) (-414.552) -- 0:00:54
      168000 -- (-417.051) [-412.191] (-413.061) (-414.839) * (-413.148) [-415.503] (-410.718) (-418.420) -- 0:00:54
      168500 -- [-414.319] (-418.230) (-413.561) (-414.667) * (-411.669) (-414.825) (-412.650) [-413.788] -- 0:00:54
      169000 -- [-411.669] (-414.042) (-417.698) (-411.081) * (-415.384) (-411.023) [-417.208] (-418.655) -- 0:00:54
      169500 -- (-413.444) (-418.125) [-419.031] (-413.048) * (-412.137) (-414.754) [-414.070] (-413.218) -- 0:00:53
      170000 -- (-411.703) (-411.296) [-412.794] (-414.343) * (-410.707) (-415.873) [-411.615] (-414.048) -- 0:00:53

      Average standard deviation of split frequencies: 0.015264

      170500 -- (-412.690) (-416.483) (-409.298) [-409.751] * (-410.122) (-417.795) (-409.504) [-415.007] -- 0:00:53
      171000 -- (-417.197) (-413.096) (-412.630) [-411.002] * (-413.626) (-412.060) [-412.171] (-415.271) -- 0:00:53
      171500 -- [-413.098] (-414.320) (-413.846) (-412.667) * (-416.208) [-418.379] (-414.636) (-417.464) -- 0:00:53
      172000 -- (-414.736) (-412.189) [-416.248] (-415.194) * (-410.687) (-413.174) [-412.481] (-413.616) -- 0:00:52
      172500 -- [-412.471] (-413.534) (-416.737) (-413.372) * [-411.945] (-410.906) (-419.726) (-417.645) -- 0:00:52
      173000 -- (-414.690) [-414.666] (-417.317) (-416.182) * [-411.555] (-416.098) (-414.341) (-415.609) -- 0:00:52
      173500 -- (-416.839) (-412.600) [-411.462] (-414.767) * (-414.009) [-412.677] (-413.549) (-416.442) -- 0:00:52
      174000 -- (-414.784) (-410.536) [-414.974] (-414.365) * [-414.762] (-411.663) (-414.377) (-418.045) -- 0:00:52
      174500 -- (-413.818) (-415.526) (-409.009) [-413.019] * (-415.995) [-413.166] (-412.137) (-413.054) -- 0:00:52
      175000 -- (-411.840) (-416.583) [-411.502] (-412.368) * (-412.142) [-413.071] (-413.685) (-412.980) -- 0:00:51

      Average standard deviation of split frequencies: 0.015922

      175500 -- [-413.873] (-413.247) (-416.203) (-412.114) * (-413.084) (-417.642) [-412.250] (-414.150) -- 0:00:51
      176000 -- (-412.139) (-413.688) (-416.489) [-410.199] * (-413.756) [-413.947] (-412.246) (-411.426) -- 0:00:51
      176500 -- (-419.102) (-416.135) (-412.093) [-412.814] * (-421.408) (-415.034) (-410.224) [-415.536] -- 0:00:51
      177000 -- [-411.668] (-412.634) (-410.888) (-412.766) * (-416.550) (-415.028) [-410.851] (-410.897) -- 0:00:51
      177500 -- [-414.033] (-414.899) (-413.833) (-415.812) * [-414.960] (-418.280) (-410.800) (-411.734) -- 0:00:50
      178000 -- (-413.687) (-415.606) [-411.535] (-414.009) * (-413.313) (-417.694) (-412.382) [-413.816] -- 0:00:50
      178500 -- [-413.652] (-413.761) (-412.653) (-412.978) * (-415.440) (-416.064) (-412.537) [-412.650] -- 0:00:50
      179000 -- (-413.560) (-416.069) (-413.037) [-411.827] * [-413.139] (-417.666) (-411.367) (-414.106) -- 0:00:50
      179500 -- (-416.956) [-416.467] (-412.327) (-412.720) * [-412.046] (-415.298) (-412.164) (-410.860) -- 0:00:50
      180000 -- (-411.152) (-419.245) (-412.796) [-416.137] * [-412.508] (-414.876) (-412.527) (-413.678) -- 0:00:50

      Average standard deviation of split frequencies: 0.018555

      180500 -- (-416.285) (-415.123) (-411.851) [-412.910] * [-419.209] (-412.786) (-415.180) (-411.955) -- 0:00:54
      181000 -- (-415.572) (-417.474) [-412.477] (-413.934) * (-416.190) (-413.008) [-411.251] (-412.951) -- 0:00:54
      181500 -- [-411.402] (-420.688) (-413.384) (-413.211) * [-416.677] (-414.715) (-411.289) (-410.416) -- 0:00:54
      182000 -- [-415.895] (-414.085) (-413.111) (-414.275) * (-413.978) (-417.161) (-415.199) [-411.540] -- 0:00:53
      182500 -- [-413.958] (-413.163) (-413.620) (-409.337) * (-409.748) (-414.749) (-417.451) [-410.232] -- 0:00:53
      183000 -- (-415.110) (-414.535) (-416.616) [-411.312] * (-412.800) (-414.410) (-416.214) [-410.678] -- 0:00:53
      183500 -- (-411.351) (-414.670) (-415.507) [-412.856] * (-412.945) (-412.593) [-411.760] (-413.402) -- 0:00:53
      184000 -- (-414.146) (-417.453) (-413.153) [-410.551] * (-413.835) (-411.489) (-412.137) [-413.776] -- 0:00:53
      184500 -- (-416.103) (-412.755) (-416.595) [-410.338] * (-420.705) (-414.964) (-412.338) [-410.407] -- 0:00:53
      185000 -- (-412.607) [-417.453] (-411.720) (-410.155) * (-421.497) (-414.459) [-412.966] (-413.185) -- 0:00:52

      Average standard deviation of split frequencies: 0.020009

      185500 -- (-413.526) [-418.305] (-414.504) (-414.101) * (-427.602) (-412.122) [-412.103] (-409.934) -- 0:00:52
      186000 -- [-411.813] (-417.439) (-415.035) (-413.268) * (-412.963) (-417.003) [-414.222] (-412.794) -- 0:00:52
      186500 -- (-414.049) (-416.833) (-415.598) [-413.179] * (-418.604) (-415.449) (-416.930) [-410.817] -- 0:00:52
      187000 -- (-416.672) (-416.996) [-416.563] (-413.956) * (-413.361) (-414.998) [-413.453] (-411.493) -- 0:00:52
      187500 -- [-412.793] (-419.756) (-414.022) (-411.269) * [-409.948] (-417.102) (-413.403) (-413.399) -- 0:00:52
      188000 -- (-416.490) (-415.354) (-412.688) [-411.971] * (-414.213) (-413.968) [-410.805] (-412.718) -- 0:00:51
      188500 -- (-416.309) (-415.461) (-415.298) [-411.094] * (-411.273) (-414.153) [-410.704] (-412.225) -- 0:00:51
      189000 -- (-413.736) [-415.134] (-421.471) (-411.356) * (-413.833) (-416.606) (-412.924) [-414.114] -- 0:00:51
      189500 -- (-414.648) (-414.257) [-419.970] (-411.938) * (-411.438) (-411.794) [-413.855] (-413.143) -- 0:00:51
      190000 -- (-412.669) [-415.388] (-420.499) (-412.858) * [-411.761] (-419.307) (-414.554) (-410.448) -- 0:00:51

      Average standard deviation of split frequencies: 0.020603

      190500 -- [-411.344] (-412.422) (-413.308) (-413.607) * (-413.783) (-414.297) (-412.033) [-410.471] -- 0:00:50
      191000 -- [-412.385] (-414.237) (-415.409) (-411.461) * (-418.533) (-412.947) (-412.592) [-408.289] -- 0:00:50
      191500 -- (-416.498) (-415.358) (-415.020) [-408.951] * (-412.785) [-414.435] (-413.085) (-410.454) -- 0:00:50
      192000 -- (-412.923) (-413.216) [-410.339] (-415.471) * (-415.582) (-419.427) [-413.962] (-410.324) -- 0:00:50
      192500 -- (-413.983) (-411.281) (-414.335) [-411.145] * (-414.212) (-421.627) (-417.933) [-411.718] -- 0:00:50
      193000 -- (-417.442) (-413.273) [-417.256] (-410.251) * (-415.374) (-411.311) (-410.358) [-411.537] -- 0:00:50
      193500 -- (-413.736) [-410.819] (-414.236) (-413.864) * (-416.272) (-414.255) (-412.121) [-411.850] -- 0:00:50
      194000 -- (-413.369) (-415.191) [-414.048] (-416.064) * (-415.488) (-420.042) [-413.261] (-411.083) -- 0:00:49
      194500 -- (-413.214) (-418.201) [-413.687] (-411.998) * (-414.593) (-416.130) (-411.706) [-411.223] -- 0:00:49
      195000 -- (-414.820) [-413.742] (-412.292) (-413.423) * (-414.534) (-412.660) (-417.036) [-410.242] -- 0:00:49

      Average standard deviation of split frequencies: 0.021646

      195500 -- (-413.326) [-412.557] (-415.714) (-413.091) * (-413.604) (-415.958) [-416.127] (-410.058) -- 0:00:49
      196000 -- (-415.290) (-412.702) (-417.969) [-413.583] * (-415.683) (-416.621) (-412.836) [-412.041] -- 0:00:53
      196500 -- (-414.136) (-415.150) [-414.546] (-412.378) * [-412.310] (-412.793) (-409.030) (-409.366) -- 0:00:53
      197000 -- [-413.393] (-411.272) (-416.632) (-417.102) * (-417.369) [-413.628] (-413.115) (-410.473) -- 0:00:52
      197500 -- (-415.220) [-410.652] (-413.056) (-412.458) * (-416.205) [-414.025] (-413.085) (-418.003) -- 0:00:52
      198000 -- (-415.995) (-411.954) [-410.968] (-411.942) * (-411.884) [-415.107] (-413.332) (-413.450) -- 0:00:52
      198500 -- (-424.494) (-416.972) (-415.495) [-411.906] * (-413.469) (-416.900) (-416.270) [-412.516] -- 0:00:52
      199000 -- (-416.991) (-417.005) (-412.947) [-413.996] * (-414.419) (-415.123) (-412.871) [-412.931] -- 0:00:52
      199500 -- (-414.148) (-413.974) (-415.209) [-413.422] * (-412.869) (-416.361) [-413.968] (-411.601) -- 0:00:52
      200000 -- [-415.693] (-413.193) (-413.874) (-415.541) * (-413.413) (-416.415) [-413.138] (-415.253) -- 0:00:51

      Average standard deviation of split frequencies: 0.019899

      200500 -- (-411.070) (-413.173) [-410.272] (-414.870) * (-414.199) (-412.974) [-414.533] (-414.797) -- 0:00:51
      201000 -- (-417.667) [-412.440] (-413.723) (-413.555) * (-412.784) (-414.767) [-411.544] (-412.054) -- 0:00:51
      201500 -- [-416.260] (-414.154) (-412.837) (-412.508) * (-412.616) (-415.054) (-411.481) [-411.087] -- 0:00:51
      202000 -- (-413.662) [-413.082] (-412.407) (-413.897) * (-415.341) [-414.168] (-412.490) (-413.019) -- 0:00:51
      202500 -- (-412.737) [-414.084] (-412.517) (-411.749) * (-416.828) (-412.819) (-411.622) [-413.769] -- 0:00:51
      203000 -- (-413.031) [-411.619] (-415.610) (-419.638) * (-414.738) (-416.216) (-411.821) [-411.305] -- 0:00:51
      203500 -- (-410.311) [-412.538] (-417.136) (-416.186) * (-419.221) [-411.540] (-415.487) (-412.584) -- 0:00:50
      204000 -- [-414.021] (-410.687) (-415.270) (-412.414) * (-419.389) (-419.478) [-415.155] (-413.052) -- 0:00:50
      204500 -- (-416.799) (-410.251) (-416.780) [-411.786] * (-423.343) (-415.148) [-413.730] (-410.676) -- 0:00:50
      205000 -- (-420.210) (-417.190) (-414.566) [-412.337] * (-416.458) [-414.188] (-412.955) (-410.004) -- 0:00:50

      Average standard deviation of split frequencies: 0.018180

      205500 -- (-416.527) (-410.136) [-410.991] (-416.397) * (-417.541) (-419.510) (-414.190) [-410.397] -- 0:00:50
      206000 -- (-415.205) (-413.799) [-412.066] (-415.207) * (-412.095) (-415.006) (-415.805) [-411.495] -- 0:00:50
      206500 -- (-417.029) (-415.971) (-412.393) [-410.745] * (-413.430) (-414.559) [-411.190] (-412.772) -- 0:00:49
      207000 -- (-414.119) [-411.618] (-416.700) (-417.727) * (-416.029) (-413.357) (-412.291) [-409.726] -- 0:00:49
      207500 -- (-414.332) (-413.283) [-417.296] (-414.321) * (-413.013) [-412.606] (-414.008) (-413.016) -- 0:00:49
      208000 -- [-415.871] (-415.926) (-413.414) (-413.843) * (-411.627) (-415.955) (-416.668) [-415.518] -- 0:00:49
      208500 -- (-416.686) (-414.900) [-412.005] (-410.140) * (-415.206) (-418.570) [-413.983] (-416.443) -- 0:00:49
      209000 -- (-413.117) (-413.272) [-409.963] (-416.711) * (-422.822) (-421.064) [-417.552] (-412.576) -- 0:00:49
      209500 -- (-414.950) (-414.911) [-410.553] (-413.942) * (-417.390) (-421.363) (-411.865) [-412.959] -- 0:00:49
      210000 -- (-413.264) (-421.783) [-412.820] (-418.111) * (-417.684) (-415.449) [-415.127] (-413.735) -- 0:00:48

      Average standard deviation of split frequencies: 0.018523

      210500 -- [-415.595] (-418.396) (-417.136) (-413.623) * (-416.514) (-415.966) [-414.721] (-414.870) -- 0:00:48
      211000 -- (-417.190) (-414.605) [-415.199] (-413.249) * [-413.544] (-416.084) (-414.191) (-421.635) -- 0:00:48
      211500 -- (-412.016) [-411.532] (-412.133) (-418.928) * [-417.079] (-416.555) (-412.841) (-414.488) -- 0:00:52
      212000 -- (-414.878) (-411.273) (-410.170) [-410.942] * (-415.312) (-417.223) (-416.295) [-416.879] -- 0:00:52
      212500 -- (-414.778) (-415.371) [-411.792] (-415.430) * [-411.483] (-417.479) (-412.566) (-413.644) -- 0:00:51
      213000 -- (-416.163) (-415.561) [-410.870] (-414.826) * (-415.904) (-414.902) [-413.235] (-412.625) -- 0:00:51
      213500 -- (-416.762) (-415.166) [-412.627] (-411.319) * [-416.438] (-416.659) (-413.729) (-413.054) -- 0:00:51
      214000 -- (-413.042) (-417.700) (-412.151) [-412.831] * (-413.044) (-413.552) (-412.316) [-412.663] -- 0:00:51
      214500 -- (-413.118) [-410.285] (-418.566) (-416.832) * (-415.955) (-414.389) (-415.737) [-413.623] -- 0:00:51
      215000 -- (-413.235) [-414.909] (-413.943) (-417.021) * [-416.989] (-416.528) (-417.571) (-410.393) -- 0:00:51

      Average standard deviation of split frequencies: 0.016853

      215500 -- [-414.110] (-412.507) (-413.398) (-415.605) * (-416.914) (-414.204) [-415.785] (-409.824) -- 0:00:50
      216000 -- [-413.969] (-412.822) (-413.962) (-414.351) * (-413.688) (-415.661) [-414.185] (-411.561) -- 0:00:50
      216500 -- (-411.382) [-413.721] (-411.206) (-413.133) * (-415.190) (-415.041) [-411.649] (-414.386) -- 0:00:50
      217000 -- (-416.583) (-413.738) [-411.892] (-413.659) * [-419.631] (-415.821) (-416.427) (-411.607) -- 0:00:50
      217500 -- (-416.735) [-411.989] (-410.800) (-412.036) * [-415.702] (-412.770) (-416.111) (-415.473) -- 0:00:50
      218000 -- [-414.529] (-413.197) (-412.094) (-410.166) * (-411.948) (-417.971) [-410.879] (-411.451) -- 0:00:50
      218500 -- (-412.072) (-416.524) (-413.648) [-414.966] * [-413.166] (-414.648) (-416.078) (-414.337) -- 0:00:50
      219000 -- [-411.370] (-414.459) (-410.552) (-415.800) * (-417.174) (-413.077) [-411.918] (-417.412) -- 0:00:49
      219500 -- [-413.102] (-414.035) (-412.333) (-417.625) * (-418.215) (-414.743) [-414.370] (-410.947) -- 0:00:49
      220000 -- (-415.050) (-411.181) [-415.113] (-421.842) * (-413.201) (-412.458) [-412.045] (-416.531) -- 0:00:49

      Average standard deviation of split frequencies: 0.016462

      220500 -- (-412.118) (-414.613) (-411.909) [-413.097] * (-413.447) (-417.037) [-413.447] (-412.452) -- 0:00:49
      221000 -- (-411.802) [-413.681] (-415.318) (-416.048) * [-412.041] (-412.830) (-412.920) (-414.390) -- 0:00:49
      221500 -- (-413.993) (-411.616) [-413.160] (-420.133) * (-416.595) [-410.980] (-410.382) (-419.523) -- 0:00:49
      222000 -- (-411.204) [-412.571] (-415.325) (-414.345) * (-412.914) (-412.552) [-410.232] (-415.022) -- 0:00:49
      222500 -- (-412.559) (-417.446) (-414.257) [-414.094] * (-416.416) [-411.213] (-415.763) (-411.820) -- 0:00:48
      223000 -- (-415.786) (-412.990) (-410.145) [-413.627] * (-414.934) [-414.930] (-412.075) (-414.399) -- 0:00:48
      223500 -- (-414.652) [-415.603] (-412.868) (-416.594) * (-411.251) (-415.269) (-411.306) [-412.786] -- 0:00:48
      224000 -- (-416.896) (-416.500) (-414.104) [-413.561] * (-415.078) (-413.151) (-414.566) [-412.425] -- 0:00:48
      224500 -- (-414.521) (-409.318) (-411.202) [-412.336] * (-418.567) (-416.267) (-411.166) [-414.068] -- 0:00:48
      225000 -- (-417.495) (-414.624) [-415.856] (-411.007) * (-419.415) (-420.153) [-411.616] (-415.396) -- 0:00:48

      Average standard deviation of split frequencies: 0.015644

      225500 -- (-419.693) (-416.310) (-414.232) [-413.254] * (-414.080) (-414.409) (-412.852) [-414.905] -- 0:00:48
      226000 -- [-411.476] (-412.756) (-413.234) (-414.857) * (-415.293) [-412.307] (-413.503) (-413.090) -- 0:00:47
      226500 -- (-412.262) [-411.872] (-412.561) (-417.758) * (-412.573) (-414.915) (-411.272) [-414.284] -- 0:00:47
      227000 -- (-414.086) (-417.731) [-410.418] (-419.636) * (-411.455) (-412.420) [-411.207] (-417.765) -- 0:00:47
      227500 -- [-411.970] (-417.185) (-415.475) (-412.361) * (-411.811) (-413.117) [-411.163] (-412.507) -- 0:00:50
      228000 -- (-413.900) [-411.646] (-413.443) (-414.620) * (-414.194) (-411.781) (-412.623) [-413.261] -- 0:00:50
      228500 -- (-414.442) [-413.856] (-415.285) (-419.786) * (-420.023) [-410.876] (-413.111) (-414.283) -- 0:00:50
      229000 -- (-414.917) (-412.366) (-411.407) [-417.785] * [-412.461] (-415.870) (-414.908) (-416.473) -- 0:00:50
      229500 -- (-415.341) (-414.623) (-416.674) [-414.807] * [-411.795] (-422.563) (-412.760) (-412.265) -- 0:00:50
      230000 -- (-412.305) (-424.503) (-412.767) [-411.521] * (-412.661) [-414.325] (-415.630) (-412.986) -- 0:00:50

      Average standard deviation of split frequencies: 0.017144

      230500 -- [-410.820] (-420.525) (-416.138) (-415.611) * (-413.260) (-418.954) [-416.144] (-410.797) -- 0:00:50
      231000 -- [-414.260] (-415.749) (-416.984) (-417.137) * (-413.156) (-412.127) (-414.325) [-413.528] -- 0:00:49
      231500 -- (-414.901) (-413.923) (-410.253) [-413.480] * (-418.233) (-413.912) (-413.024) [-412.851] -- 0:00:49
      232000 -- (-415.068) [-414.538] (-415.043) (-414.157) * (-412.109) (-417.025) [-412.757] (-413.868) -- 0:00:49
      232500 -- (-417.052) [-413.827] (-412.002) (-411.362) * [-410.823] (-415.594) (-411.489) (-414.874) -- 0:00:49
      233000 -- (-415.621) [-417.591] (-412.156) (-411.225) * [-411.150] (-417.053) (-410.385) (-417.500) -- 0:00:49
      233500 -- (-421.059) (-413.334) (-413.384) [-410.637] * (-410.308) [-414.712] (-412.814) (-417.322) -- 0:00:49
      234000 -- [-417.972] (-410.872) (-413.750) (-412.236) * (-412.108) (-414.821) (-413.876) [-412.035] -- 0:00:49
      234500 -- (-416.216) [-412.699] (-413.084) (-411.145) * (-415.852) (-416.838) [-412.796] (-414.507) -- 0:00:48
      235000 -- (-412.055) (-414.879) (-411.481) [-412.577] * (-414.640) (-417.020) [-411.598] (-414.935) -- 0:00:48

      Average standard deviation of split frequencies: 0.016868

      235500 -- (-413.038) (-413.109) (-412.133) [-413.391] * (-412.207) (-416.361) [-411.121] (-413.162) -- 0:00:48
      236000 -- [-411.155] (-410.448) (-410.381) (-411.810) * (-415.120) (-413.055) [-416.323] (-415.359) -- 0:00:48
      236500 -- (-415.268) [-412.713] (-411.638) (-413.039) * [-415.358] (-415.397) (-412.815) (-414.360) -- 0:00:48
      237000 -- (-414.021) (-416.537) (-411.361) [-411.000] * [-414.200] (-415.822) (-413.301) (-415.007) -- 0:00:48
      237500 -- (-422.526) (-413.906) (-409.769) [-410.822] * (-412.327) (-415.339) (-410.443) [-413.547] -- 0:00:48
      238000 -- (-411.655) (-412.302) (-412.438) [-408.249] * [-411.842] (-415.351) (-416.693) (-416.196) -- 0:00:48
      238500 -- (-412.502) [-409.811] (-409.883) (-412.786) * (-420.508) [-414.428] (-411.700) (-416.207) -- 0:00:47
      239000 -- (-419.063) [-413.946] (-411.699) (-416.244) * (-420.127) (-418.434) [-410.579] (-416.264) -- 0:00:47
      239500 -- (-415.447) (-413.602) [-410.276] (-413.702) * (-414.301) [-414.620] (-412.864) (-413.863) -- 0:00:47
      240000 -- (-412.819) (-413.430) [-413.338] (-412.813) * [-413.080] (-412.242) (-413.752) (-415.949) -- 0:00:47

      Average standard deviation of split frequencies: 0.017513

      240500 -- (-413.321) (-413.787) (-413.638) [-413.341] * (-414.176) [-418.182] (-416.353) (-413.851) -- 0:00:47
      241000 -- [-414.168] (-411.386) (-413.001) (-410.418) * (-413.267) (-417.042) [-414.894] (-416.589) -- 0:00:47
      241500 -- (-416.468) (-421.096) [-411.825] (-415.177) * (-414.073) (-415.031) [-413.353] (-413.072) -- 0:00:47
      242000 -- (-418.402) (-417.098) [-413.278] (-416.241) * (-413.944) (-415.520) (-414.657) [-414.041] -- 0:00:46
      242500 -- (-414.468) [-415.874] (-411.757) (-412.663) * [-413.152] (-413.280) (-415.672) (-413.739) -- 0:00:46
      243000 -- (-412.703) (-415.709) (-415.280) [-413.710] * [-412.773] (-414.748) (-412.899) (-417.102) -- 0:00:49
      243500 -- [-411.111] (-413.305) (-411.333) (-410.606) * (-414.128) [-412.858] (-415.619) (-412.297) -- 0:00:49
      244000 -- (-416.565) [-414.784] (-414.944) (-410.690) * [-416.268] (-421.438) (-414.094) (-411.810) -- 0:00:49
      244500 -- (-414.141) (-412.634) [-410.564] (-411.130) * (-412.631) [-416.723] (-416.549) (-415.551) -- 0:00:49
      245000 -- [-411.486] (-415.199) (-412.740) (-415.784) * (-414.994) (-417.580) (-415.444) [-410.573] -- 0:00:49

      Average standard deviation of split frequencies: 0.017459

      245500 -- [-413.096] (-416.173) (-412.382) (-415.994) * (-417.241) (-415.351) (-411.868) [-412.331] -- 0:00:49
      246000 -- (-410.955) (-414.718) (-414.798) [-413.049] * (-415.577) (-413.397) [-411.917] (-410.893) -- 0:00:49
      246500 -- [-412.226] (-414.859) (-420.841) (-413.439) * (-416.410) [-412.841] (-414.246) (-410.110) -- 0:00:48
      247000 -- (-411.312) (-418.435) [-414.204] (-412.175) * (-413.311) (-417.367) (-415.706) [-413.681] -- 0:00:48
      247500 -- (-415.062) (-413.691) [-411.858] (-413.430) * [-412.475] (-415.775) (-414.482) (-413.865) -- 0:00:48
      248000 -- (-413.552) (-413.583) [-411.032] (-414.031) * [-414.000] (-411.066) (-412.893) (-409.921) -- 0:00:48
      248500 -- (-412.797) [-413.130] (-412.541) (-415.345) * [-411.794] (-413.752) (-414.161) (-416.697) -- 0:00:48
      249000 -- (-412.302) (-413.816) [-412.183] (-410.834) * (-415.010) (-411.798) (-418.817) [-416.058] -- 0:00:48
      249500 -- [-414.503] (-414.520) (-413.843) (-414.661) * (-413.113) (-413.927) (-416.100) [-412.472] -- 0:00:48
      250000 -- (-414.187) (-415.603) [-412.734] (-413.401) * (-414.328) [-418.618] (-416.910) (-411.296) -- 0:00:48

      Average standard deviation of split frequencies: 0.017717

      250500 -- (-416.797) (-414.251) [-409.712] (-413.395) * (-414.887) [-414.291] (-414.788) (-411.483) -- 0:00:47
      251000 -- (-413.448) (-416.379) [-410.496] (-418.568) * (-413.420) [-417.202] (-420.012) (-417.176) -- 0:00:47
      251500 -- (-418.991) (-414.572) [-413.793] (-421.332) * [-413.010] (-417.062) (-414.978) (-415.448) -- 0:00:47
      252000 -- (-414.537) (-412.665) (-417.691) [-414.243] * [-413.412] (-415.810) (-412.732) (-414.167) -- 0:00:47
      252500 -- (-411.803) (-411.465) (-414.899) [-411.659] * (-411.699) (-416.539) [-410.843] (-414.228) -- 0:00:47
      253000 -- (-416.040) [-412.598] (-414.547) (-411.797) * (-415.388) [-411.218] (-415.494) (-409.801) -- 0:00:47
      253500 -- [-416.294] (-416.259) (-414.494) (-414.272) * (-413.519) (-412.413) [-409.476] (-413.454) -- 0:00:47
      254000 -- (-418.962) [-416.492] (-413.341) (-412.005) * (-411.829) (-412.778) (-411.023) [-411.944] -- 0:00:46
      254500 -- (-420.291) [-413.266] (-412.247) (-414.442) * (-413.938) (-414.591) [-410.433] (-414.310) -- 0:00:46
      255000 -- (-414.624) (-413.913) (-415.566) [-411.963] * (-415.211) (-413.386) (-413.403) [-411.340] -- 0:00:46

      Average standard deviation of split frequencies: 0.016767

      255500 -- (-414.043) (-408.721) [-416.796] (-415.563) * (-417.847) (-411.433) [-411.671] (-412.237) -- 0:00:46
      256000 -- (-420.983) [-410.077] (-411.677) (-411.182) * (-415.547) [-410.792] (-413.307) (-411.151) -- 0:00:46
      256500 -- (-414.855) (-412.514) [-410.686] (-413.991) * [-412.268] (-410.868) (-412.206) (-410.903) -- 0:00:46
      257000 -- (-411.988) [-416.209] (-410.660) (-413.685) * (-411.528) [-414.977] (-410.809) (-418.225) -- 0:00:46
      257500 -- (-413.731) (-412.993) [-413.431] (-410.685) * (-417.469) (-417.363) [-413.322] (-426.674) -- 0:00:46
      258000 -- (-415.390) [-413.701] (-412.363) (-410.261) * (-418.264) [-413.812] (-414.022) (-412.274) -- 0:00:48
      258500 -- (-415.964) (-411.776) [-411.367] (-412.957) * (-421.228) [-412.780] (-416.270) (-414.450) -- 0:00:48
      259000 -- (-419.852) (-411.857) (-410.587) [-411.412] * (-414.814) [-413.800] (-415.253) (-416.434) -- 0:00:48
      259500 -- [-413.573] (-412.626) (-413.980) (-413.032) * (-411.498) [-411.127] (-417.096) (-417.268) -- 0:00:48
      260000 -- (-413.229) (-413.766) (-412.550) [-410.995] * (-412.124) (-413.335) [-415.000] (-412.894) -- 0:00:48

      Average standard deviation of split frequencies: 0.016847

      260500 -- (-417.873) [-412.944] (-413.128) (-413.710) * (-415.352) (-415.065) (-415.879) [-413.497] -- 0:00:48
      261000 -- (-417.275) (-412.647) (-416.603) [-415.133] * (-414.328) (-418.461) [-415.554] (-411.726) -- 0:00:48
      261500 -- (-415.769) [-415.553] (-413.159) (-411.853) * [-410.455] (-414.761) (-411.358) (-411.734) -- 0:00:48
      262000 -- (-413.336) [-413.660] (-411.764) (-412.742) * (-411.692) (-416.974) [-412.657] (-414.706) -- 0:00:47
      262500 -- (-414.305) (-416.382) [-411.449] (-412.821) * (-418.534) [-419.268] (-418.349) (-414.059) -- 0:00:47
      263000 -- (-412.668) (-412.337) [-410.557] (-415.813) * (-413.592) (-411.253) (-416.078) [-415.897] -- 0:00:47
      263500 -- (-416.986) (-412.708) [-412.152] (-418.236) * (-413.042) [-410.736] (-411.315) (-414.213) -- 0:00:47
      264000 -- (-412.346) (-417.725) [-410.019] (-417.431) * [-412.946] (-410.896) (-414.639) (-415.486) -- 0:00:47
      264500 -- [-411.423] (-415.458) (-413.846) (-416.818) * (-411.659) [-413.184] (-418.556) (-412.801) -- 0:00:47
      265000 -- (-414.216) [-415.628] (-414.888) (-417.596) * [-414.384] (-412.604) (-411.632) (-415.352) -- 0:00:47

      Average standard deviation of split frequencies: 0.016245

      265500 -- [-413.220] (-413.351) (-418.168) (-423.543) * (-414.671) [-412.657] (-414.455) (-412.279) -- 0:00:47
      266000 -- (-413.921) (-414.629) [-411.897] (-417.169) * [-412.693] (-413.900) (-417.622) (-414.809) -- 0:00:46
      266500 -- (-411.660) (-415.697) (-412.854) [-414.556] * (-415.548) (-414.496) [-414.743] (-413.146) -- 0:00:46
      267000 -- (-413.061) (-411.320) (-411.945) [-413.543] * [-416.259] (-413.187) (-412.937) (-415.032) -- 0:00:46
      267500 -- (-413.930) (-412.189) [-410.215] (-413.703) * (-414.887) [-413.845] (-412.042) (-415.583) -- 0:00:46
      268000 -- (-412.185) (-416.626) [-415.132] (-416.356) * (-413.782) (-417.329) (-419.307) [-412.895] -- 0:00:46
      268500 -- (-414.311) (-415.704) [-410.035] (-420.401) * (-414.841) (-410.950) (-412.543) [-411.470] -- 0:00:46
      269000 -- (-412.766) [-412.199] (-412.516) (-415.287) * (-414.270) (-417.508) (-414.381) [-412.891] -- 0:00:46
      269500 -- (-413.841) (-414.668) (-412.069) [-417.919] * (-411.312) [-414.476] (-415.541) (-411.752) -- 0:00:46
      270000 -- (-413.966) (-410.918) (-415.120) [-412.816] * (-417.271) (-414.635) (-415.874) [-412.033] -- 0:00:45

      Average standard deviation of split frequencies: 0.016392

      270500 -- (-412.268) [-414.300] (-416.106) (-419.918) * [-417.384] (-412.087) (-416.523) (-413.652) -- 0:00:45
      271000 -- (-412.141) (-413.536) [-415.574] (-412.307) * (-418.453) (-414.704) [-414.323] (-410.374) -- 0:00:45
      271500 -- [-411.278] (-410.959) (-411.251) (-414.467) * (-414.503) (-420.037) (-412.246) [-413.125] -- 0:00:45
      272000 -- (-413.137) [-413.109] (-416.305) (-415.885) * (-416.412) [-412.211] (-415.414) (-412.868) -- 0:00:45
      272500 -- (-413.634) [-410.760] (-411.461) (-417.800) * (-410.848) (-415.292) [-415.300] (-412.956) -- 0:00:48
      273000 -- (-413.815) (-413.705) [-413.273] (-414.709) * [-409.283] (-410.529) (-417.739) (-413.233) -- 0:00:47
      273500 -- (-417.245) (-415.033) (-420.114) [-418.522] * [-413.439] (-414.921) (-414.825) (-415.228) -- 0:00:47
      274000 -- (-411.861) (-411.881) (-414.282) [-413.733] * (-413.144) (-417.588) [-415.956] (-415.097) -- 0:00:47
      274500 -- (-416.392) (-411.707) (-415.915) [-415.100] * [-412.683] (-414.138) (-412.652) (-413.423) -- 0:00:47
      275000 -- (-412.652) (-412.540) (-411.864) [-413.603] * (-411.612) (-412.432) [-413.602] (-412.250) -- 0:00:47

      Average standard deviation of split frequencies: 0.015906

      275500 -- (-413.773) [-413.327] (-415.361) (-413.148) * (-413.897) (-412.699) (-413.633) [-412.316] -- 0:00:47
      276000 -- [-412.005] (-411.724) (-413.907) (-417.795) * (-415.724) [-413.627] (-413.558) (-419.107) -- 0:00:47
      276500 -- (-416.803) [-416.844] (-413.941) (-416.462) * [-410.906] (-414.073) (-413.188) (-413.654) -- 0:00:47
      277000 -- (-413.334) (-411.479) (-414.627) [-413.516] * (-415.044) (-417.030) [-414.236] (-414.007) -- 0:00:46
      277500 -- (-414.679) (-413.588) [-415.884] (-417.204) * (-411.881) (-410.815) [-413.617] (-413.889) -- 0:00:46
      278000 -- (-411.384) [-416.595] (-416.078) (-416.503) * (-411.722) (-417.500) (-415.748) [-414.215] -- 0:00:46
      278500 -- (-415.758) [-413.709] (-414.507) (-419.340) * [-412.093] (-415.083) (-411.230) (-411.307) -- 0:00:46
      279000 -- (-416.845) (-410.361) [-412.854] (-414.757) * [-410.897] (-414.517) (-413.200) (-419.119) -- 0:00:46
      279500 -- [-412.292] (-410.516) (-417.304) (-418.479) * [-411.586] (-409.897) (-411.367) (-410.308) -- 0:00:46
      280000 -- (-414.738) (-413.029) (-416.414) [-412.650] * (-410.743) [-413.450] (-413.852) (-418.303) -- 0:00:46

      Average standard deviation of split frequencies: 0.016203

      280500 -- (-414.988) (-414.681) (-412.837) [-413.197] * (-417.047) (-412.952) (-410.917) [-412.531] -- 0:00:46
      281000 -- [-413.718] (-418.406) (-411.979) (-412.584) * [-414.839] (-413.429) (-411.637) (-416.938) -- 0:00:46
      281500 -- [-410.703] (-412.635) (-411.676) (-414.552) * (-416.266) [-411.122] (-412.428) (-414.282) -- 0:00:45
      282000 -- (-412.184) (-414.664) [-415.459] (-414.759) * (-412.984) [-416.881] (-413.247) (-415.731) -- 0:00:45
      282500 -- (-415.252) (-414.778) (-414.758) [-414.533] * (-411.796) (-410.708) [-410.149] (-414.739) -- 0:00:45
      283000 -- [-411.013] (-424.716) (-413.038) (-415.884) * (-411.481) (-412.413) (-413.513) [-413.225] -- 0:00:45
      283500 -- (-412.410) [-411.895] (-416.734) (-415.582) * [-409.172] (-415.285) (-412.499) (-412.611) -- 0:00:45
      284000 -- (-415.294) [-413.961] (-415.188) (-417.071) * (-415.394) (-413.642) (-411.711) [-416.178] -- 0:00:45
      284500 -- (-411.967) (-417.036) [-416.597] (-415.097) * [-412.900] (-414.906) (-414.269) (-415.118) -- 0:00:45
      285000 -- [-413.170] (-411.588) (-412.478) (-414.831) * (-412.121) (-414.345) [-412.010] (-412.147) -- 0:00:45

      Average standard deviation of split frequencies: 0.015384

      285500 -- (-410.133) (-413.606) (-414.345) [-416.997] * [-411.883] (-414.858) (-412.796) (-413.953) -- 0:00:45
      286000 -- (-414.639) [-415.742] (-416.438) (-418.391) * (-414.635) [-414.992] (-419.023) (-412.840) -- 0:00:44
      286500 -- [-413.508] (-410.738) (-414.437) (-414.289) * [-413.559] (-417.106) (-418.876) (-415.868) -- 0:00:44
      287000 -- [-411.848] (-412.895) (-413.801) (-419.304) * [-412.276] (-416.560) (-419.913) (-417.116) -- 0:00:47
      287500 -- (-414.826) [-413.280] (-416.151) (-421.635) * (-413.380) (-413.476) (-419.555) [-411.509] -- 0:00:47
      288000 -- (-414.828) [-411.215] (-413.631) (-415.198) * [-411.768] (-415.279) (-412.864) (-415.222) -- 0:00:46
      288500 -- (-413.926) (-409.956) (-410.882) [-412.259] * (-414.531) (-413.249) [-413.244] (-417.329) -- 0:00:46
      289000 -- (-416.222) [-418.326] (-412.321) (-413.654) * (-417.774) (-411.147) (-415.872) [-412.552] -- 0:00:46
      289500 -- (-411.971) [-414.177] (-412.576) (-416.760) * (-415.042) (-417.249) (-415.295) [-411.323] -- 0:00:46
      290000 -- (-413.649) [-413.640] (-411.779) (-413.516) * (-412.816) (-415.716) [-413.807] (-413.208) -- 0:00:46

      Average standard deviation of split frequencies: 0.015741

      290500 -- [-411.360] (-410.691) (-410.298) (-412.333) * (-414.307) (-411.529) [-415.358] (-414.059) -- 0:00:46
      291000 -- (-412.564) (-414.077) [-414.071] (-418.383) * (-415.704) [-414.751] (-412.218) (-413.925) -- 0:00:46
      291500 -- (-413.389) (-414.027) [-412.270] (-415.042) * [-409.901] (-415.276) (-410.650) (-416.968) -- 0:00:46
      292000 -- (-415.699) (-415.740) (-412.564) [-415.571] * (-413.318) [-414.959] (-411.782) (-415.806) -- 0:00:46
      292500 -- (-413.867) (-417.666) (-412.566) [-414.806] * (-411.571) [-414.175] (-414.110) (-413.257) -- 0:00:45
      293000 -- (-414.655) [-415.158] (-413.996) (-413.894) * (-412.817) (-413.582) (-413.806) [-413.687] -- 0:00:45
      293500 -- (-413.285) [-410.838] (-413.221) (-416.379) * (-414.845) (-410.918) [-416.524] (-415.503) -- 0:00:45
      294000 -- (-416.295) (-416.810) [-414.357] (-413.155) * (-412.439) (-413.538) (-413.474) [-412.604] -- 0:00:45
      294500 -- (-412.569) (-413.207) [-410.115] (-412.510) * [-413.851] (-412.538) (-419.852) (-412.121) -- 0:00:45
      295000 -- [-415.880] (-412.704) (-414.185) (-411.226) * (-413.375) (-415.156) [-414.889] (-412.275) -- 0:00:45

      Average standard deviation of split frequencies: 0.016899

      295500 -- (-411.323) [-415.474] (-414.938) (-411.076) * (-415.766) (-418.285) (-410.881) [-411.360] -- 0:00:45
      296000 -- (-413.559) (-413.671) (-413.144) [-414.266] * (-415.769) [-414.067] (-414.412) (-416.413) -- 0:00:45
      296500 -- (-414.735) (-418.773) [-415.897] (-413.598) * (-414.725) (-415.368) [-410.459] (-416.780) -- 0:00:45
      297000 -- (-413.356) (-415.249) (-411.522) [-414.982] * (-417.991) (-420.526) (-420.553) [-414.161] -- 0:00:44
      297500 -- (-414.413) [-413.852] (-413.385) (-416.712) * (-411.583) [-413.216] (-410.672) (-413.476) -- 0:00:44
      298000 -- [-411.180] (-416.963) (-410.845) (-411.414) * (-414.777) (-415.656) (-414.981) [-413.502] -- 0:00:44
      298500 -- (-412.601) (-415.325) (-412.149) [-412.759] * [-413.844] (-416.924) (-413.237) (-417.059) -- 0:00:44
      299000 -- (-415.624) [-411.166] (-410.379) (-413.672) * (-414.421) (-416.096) [-413.805] (-414.156) -- 0:00:44
      299500 -- (-416.406) (-412.557) [-413.156] (-416.467) * (-414.099) (-415.470) [-412.402] (-411.740) -- 0:00:44
      300000 -- (-415.696) (-414.928) (-415.865) [-414.598] * (-415.688) [-415.412] (-417.018) (-412.928) -- 0:00:44

      Average standard deviation of split frequencies: 0.016878

      300500 -- (-418.616) [-416.601] (-410.756) (-414.769) * (-416.085) (-411.970) (-413.007) [-413.652] -- 0:00:44
      301000 -- (-413.323) (-411.732) [-413.613] (-413.217) * (-412.000) [-413.547] (-414.998) (-415.868) -- 0:00:44
      301500 -- (-411.187) [-414.917] (-413.730) (-415.751) * [-415.850] (-411.960) (-416.661) (-414.967) -- 0:00:46
      302000 -- (-414.524) (-411.552) [-412.808] (-417.275) * (-414.752) (-413.740) [-412.197] (-411.766) -- 0:00:46
      302500 -- (-415.400) (-415.690) [-414.407] (-412.571) * (-413.746) (-413.375) (-418.421) [-412.502] -- 0:00:46
      303000 -- (-419.081) (-410.642) (-410.871) [-410.707] * [-412.755] (-415.126) (-413.056) (-409.495) -- 0:00:46
      303500 -- (-419.109) (-413.480) (-416.321) [-412.908] * (-413.339) (-411.375) [-410.088] (-409.991) -- 0:00:45
      304000 -- (-412.964) [-411.574] (-414.925) (-412.707) * (-414.247) (-411.505) (-417.569) [-413.945] -- 0:00:45
      304500 -- (-414.548) (-412.301) [-409.904] (-416.564) * [-414.416] (-415.849) (-413.002) (-417.928) -- 0:00:45
      305000 -- (-410.214) (-415.188) (-410.609) [-414.363] * (-414.647) (-413.161) (-415.138) [-413.020] -- 0:00:45

      Average standard deviation of split frequencies: 0.017288

      305500 -- (-409.503) [-413.934] (-417.481) (-413.702) * (-414.592) (-411.489) [-413.452] (-416.193) -- 0:00:45
      306000 -- (-416.189) (-414.952) (-412.967) [-413.090] * (-410.814) (-410.715) [-412.590] (-415.607) -- 0:00:45
      306500 -- (-410.199) (-414.120) [-415.189] (-415.455) * (-415.134) (-412.169) (-411.646) [-413.765] -- 0:00:45
      307000 -- (-409.064) (-409.469) (-410.339) [-414.269] * (-409.503) (-414.840) (-411.193) [-419.051] -- 0:00:45
      307500 -- (-415.886) (-413.200) [-413.429] (-412.776) * (-410.835) (-416.279) [-412.808] (-412.681) -- 0:00:45
      308000 -- (-411.752) (-413.476) [-412.369] (-414.357) * [-409.972] (-416.970) (-416.783) (-411.046) -- 0:00:44
      308500 -- (-415.832) [-412.756] (-415.798) (-414.768) * (-411.365) (-411.090) [-414.865] (-412.752) -- 0:00:44
      309000 -- (-420.334) [-412.729] (-416.741) (-414.647) * (-412.605) [-411.507] (-416.290) (-417.895) -- 0:00:44
      309500 -- (-417.892) (-408.762) [-411.416] (-420.250) * (-413.042) (-418.695) [-415.012] (-415.379) -- 0:00:44
      310000 -- (-414.513) (-417.055) (-409.677) [-414.126] * [-414.081] (-412.654) (-416.420) (-418.902) -- 0:00:44

      Average standard deviation of split frequencies: 0.016372

      310500 -- (-417.148) (-412.532) [-413.137] (-412.576) * [-411.501] (-418.898) (-421.103) (-414.404) -- 0:00:44
      311000 -- (-416.001) [-408.854] (-413.418) (-411.541) * [-414.693] (-414.358) (-416.580) (-418.172) -- 0:00:44
      311500 -- (-414.605) [-412.210] (-416.045) (-414.488) * (-415.135) (-413.246) (-413.799) [-409.818] -- 0:00:44
      312000 -- (-414.626) (-415.245) (-412.325) [-416.825] * (-411.059) [-413.955] (-419.459) (-416.243) -- 0:00:44
      312500 -- (-416.453) [-413.737] (-412.679) (-415.928) * [-411.803] (-414.186) (-418.905) (-416.396) -- 0:00:44
      313000 -- (-413.980) (-410.193) [-410.237] (-413.431) * [-415.577] (-414.898) (-415.235) (-415.555) -- 0:00:43
      313500 -- [-413.642] (-417.524) (-414.099) (-414.087) * (-416.104) (-414.483) [-416.023] (-415.107) -- 0:00:43
      314000 -- [-412.774] (-414.088) (-410.732) (-414.137) * (-418.771) [-413.333] (-414.256) (-414.126) -- 0:00:43
      314500 -- (-412.146) (-414.882) [-411.598] (-412.698) * (-417.505) (-410.506) (-411.351) [-411.802] -- 0:00:43
      315000 -- [-411.588] (-412.820) (-413.133) (-414.040) * (-413.773) (-415.361) (-413.418) [-411.784] -- 0:00:43

      Average standard deviation of split frequencies: 0.017238

      315500 -- [-410.436] (-415.261) (-410.717) (-411.056) * (-412.220) (-411.928) (-412.270) [-413.620] -- 0:00:43
      316000 -- (-416.416) (-416.846) (-417.141) [-415.495] * (-420.245) (-412.370) [-420.336] (-415.147) -- 0:00:45
      316500 -- (-414.936) (-413.142) [-416.263] (-412.491) * (-413.824) (-412.797) (-416.380) [-415.147] -- 0:00:45
      317000 -- (-412.424) (-416.342) (-418.344) [-414.628] * (-412.552) [-412.006] (-416.349) (-413.434) -- 0:00:45
      317500 -- (-411.665) [-412.393] (-414.181) (-412.199) * (-414.372) (-415.732) (-417.124) [-412.613] -- 0:00:45
      318000 -- [-410.310] (-412.543) (-412.863) (-413.133) * (-415.474) (-412.606) (-414.099) [-412.365] -- 0:00:45
      318500 -- (-413.331) (-411.368) (-415.742) [-414.712] * (-417.541) [-410.208] (-411.321) (-414.674) -- 0:00:44
      319000 -- (-415.349) [-413.604] (-416.714) (-412.522) * [-414.703] (-412.510) (-418.116) (-412.713) -- 0:00:44
      319500 -- (-412.344) (-413.559) (-413.541) [-410.363] * [-412.267] (-412.741) (-416.333) (-416.439) -- 0:00:44
      320000 -- (-416.899) [-414.273] (-416.837) (-413.414) * (-415.077) [-414.071] (-413.435) (-413.983) -- 0:00:44

      Average standard deviation of split frequencies: 0.016824

      320500 -- (-417.003) (-414.011) [-414.441] (-414.513) * (-415.349) [-411.669] (-412.613) (-418.768) -- 0:00:44
      321000 -- [-413.885] (-414.723) (-416.839) (-409.662) * (-414.051) [-414.711] (-413.581) (-415.329) -- 0:00:44
      321500 -- (-414.986) (-417.963) (-415.318) [-411.397] * (-412.013) (-416.303) [-413.505] (-414.413) -- 0:00:44
      322000 -- [-413.890] (-410.758) (-417.115) (-413.683) * (-412.583) [-414.229] (-416.905) (-412.831) -- 0:00:44
      322500 -- (-413.569) [-414.375] (-416.310) (-413.327) * (-418.190) [-418.051] (-424.653) (-418.033) -- 0:00:44
      323000 -- (-416.752) (-415.227) [-416.688] (-414.686) * (-415.499) [-410.060] (-419.500) (-418.088) -- 0:00:44
      323500 -- (-417.443) (-413.006) [-411.946] (-411.451) * [-414.882] (-409.325) (-414.241) (-415.289) -- 0:00:43
      324000 -- (-415.161) [-411.698] (-417.509) (-412.951) * (-415.128) [-411.514] (-414.316) (-416.923) -- 0:00:43
      324500 -- (-419.547) (-412.916) (-419.509) [-415.666] * (-417.888) (-412.615) (-412.798) [-414.261] -- 0:00:43
      325000 -- (-418.410) [-414.552] (-415.349) (-414.767) * (-419.126) [-411.412] (-413.138) (-413.999) -- 0:00:43

      Average standard deviation of split frequencies: 0.016667

      325500 -- (-415.911) (-417.185) (-416.897) [-416.156] * (-415.818) [-412.709] (-414.905) (-414.120) -- 0:00:43
      326000 -- (-415.869) (-418.242) [-413.880] (-414.664) * (-413.543) [-410.600] (-419.176) (-416.199) -- 0:00:43
      326500 -- [-414.391] (-416.680) (-417.136) (-415.222) * [-413.590] (-412.508) (-416.403) (-413.512) -- 0:00:43
      327000 -- (-413.429) (-413.988) (-418.834) [-411.373] * (-415.855) (-412.871) [-411.980] (-410.823) -- 0:00:43
      327500 -- (-414.327) (-413.004) (-413.075) [-413.871] * (-413.295) (-410.278) [-410.252] (-414.124) -- 0:00:43
      328000 -- (-416.744) (-413.906) (-412.877) [-420.751] * (-412.983) (-415.798) (-410.462) [-414.999] -- 0:00:43
      328500 -- (-418.382) (-413.460) [-412.846] (-415.333) * (-413.476) (-411.392) (-414.106) [-414.010] -- 0:00:42
      329000 -- (-417.500) [-412.546] (-414.020) (-421.373) * (-414.307) (-413.051) (-413.615) [-411.100] -- 0:00:42
      329500 -- (-418.539) (-413.813) (-412.624) [-415.185] * [-413.492] (-410.871) (-414.110) (-411.760) -- 0:00:42
      330000 -- (-418.363) [-413.769] (-410.081) (-413.602) * (-416.815) (-412.687) [-413.069] (-409.683) -- 0:00:44

      Average standard deviation of split frequencies: 0.016057

      330500 -- (-414.577) [-411.867] (-411.635) (-419.765) * (-417.260) (-413.566) [-413.865] (-416.170) -- 0:00:44
      331000 -- [-412.053] (-413.327) (-412.473) (-412.446) * (-412.418) (-414.631) (-412.886) [-413.683] -- 0:00:44
      331500 -- [-417.291] (-412.905) (-414.936) (-413.938) * (-417.899) [-415.261] (-413.949) (-410.999) -- 0:00:44
      332000 -- (-414.880) (-414.604) [-412.299] (-416.464) * (-413.535) [-413.584] (-412.739) (-412.621) -- 0:00:44
      332500 -- (-412.764) (-411.537) [-411.817] (-410.933) * (-409.852) [-413.013] (-415.836) (-412.237) -- 0:00:44
      333000 -- [-413.401] (-411.754) (-414.928) (-411.457) * [-410.030] (-410.778) (-415.178) (-413.924) -- 0:00:44
      333500 -- (-415.144) [-410.456] (-412.793) (-415.365) * (-413.725) (-412.258) (-417.760) [-414.046] -- 0:00:43
      334000 -- (-414.057) [-409.137] (-410.952) (-414.258) * (-415.509) [-412.671] (-417.429) (-410.874) -- 0:00:43
      334500 -- [-415.465] (-410.143) (-414.695) (-415.183) * [-416.033] (-414.836) (-412.699) (-413.339) -- 0:00:43
      335000 -- (-411.382) (-414.471) (-413.949) [-415.246] * [-414.146] (-411.950) (-411.157) (-410.982) -- 0:00:43

      Average standard deviation of split frequencies: 0.016245

      335500 -- (-412.541) (-411.377) (-413.042) [-411.913] * (-411.556) [-413.066] (-415.457) (-413.271) -- 0:00:43
      336000 -- (-421.949) (-413.575) [-413.146] (-413.140) * (-414.823) [-411.578] (-414.301) (-412.703) -- 0:00:43
      336500 -- (-416.859) (-415.828) (-414.236) [-411.183] * (-410.572) [-411.828] (-411.773) (-416.060) -- 0:00:43
      337000 -- (-415.799) [-412.783] (-419.772) (-412.320) * (-412.460) [-417.404] (-416.078) (-412.264) -- 0:00:43
      337500 -- (-420.222) (-412.331) [-415.792] (-411.717) * (-417.754) (-414.308) [-412.902] (-414.779) -- 0:00:43
      338000 -- (-416.443) [-412.205] (-417.990) (-410.457) * (-416.270) (-414.852) [-411.386] (-414.861) -- 0:00:43
      338500 -- (-420.364) (-420.963) [-416.463] (-412.976) * (-411.673) (-412.082) (-418.805) [-415.991] -- 0:00:42
      339000 -- (-417.830) (-412.909) [-417.284] (-411.207) * (-411.470) (-411.163) (-418.195) [-412.325] -- 0:00:42
      339500 -- (-416.566) (-413.137) (-411.457) [-413.609] * (-420.490) (-412.254) (-412.814) [-411.131] -- 0:00:42
      340000 -- (-412.799) [-412.428] (-414.925) (-413.243) * (-411.851) (-414.628) [-414.619] (-410.506) -- 0:00:42

      Average standard deviation of split frequencies: 0.016460

      340500 -- (-411.028) [-414.518] (-415.926) (-411.274) * [-410.890] (-410.852) (-415.328) (-412.044) -- 0:00:42
      341000 -- (-412.603) [-410.481] (-415.816) (-411.272) * (-414.414) [-415.288] (-418.143) (-417.199) -- 0:00:42
      341500 -- (-414.010) (-413.107) (-412.203) [-412.693] * (-416.911) (-414.443) [-415.133] (-410.797) -- 0:00:42
      342000 -- [-412.433] (-410.571) (-413.514) (-411.565) * (-412.922) (-412.494) (-416.597) [-412.315] -- 0:00:42
      342500 -- (-413.181) [-415.698] (-415.286) (-413.369) * (-415.231) (-411.652) (-412.875) [-412.608] -- 0:00:42
      343000 -- (-413.704) (-415.026) [-417.176] (-413.034) * (-414.318) [-412.140] (-416.208) (-413.842) -- 0:00:42
      343500 -- [-416.542] (-417.153) (-414.276) (-413.155) * (-411.133) (-410.359) (-416.206) [-413.232] -- 0:00:42
      344000 -- (-418.334) [-414.972] (-415.225) (-414.789) * (-410.750) [-413.595] (-416.538) (-415.338) -- 0:00:41
      344500 -- (-411.792) (-413.137) (-419.516) [-411.598] * (-410.629) (-413.992) (-415.374) [-415.069] -- 0:00:43
      345000 -- (-415.523) [-411.596] (-414.369) (-412.548) * [-413.294] (-413.875) (-418.250) (-410.739) -- 0:00:43

      Average standard deviation of split frequencies: 0.016564

      345500 -- [-410.480] (-413.946) (-411.793) (-415.996) * (-414.364) [-414.743] (-414.319) (-413.935) -- 0:00:43
      346000 -- (-414.091) [-411.926] (-415.799) (-415.102) * (-421.576) (-411.667) [-413.036] (-415.385) -- 0:00:43
      346500 -- (-411.591) (-413.364) [-414.083] (-412.007) * (-414.581) [-410.022] (-416.855) (-413.932) -- 0:00:43
      347000 -- (-412.546) (-410.676) (-419.155) [-412.855] * (-416.777) (-412.964) [-414.605] (-417.665) -- 0:00:43
      347500 -- (-415.517) (-410.583) [-417.538] (-411.015) * (-413.983) [-412.528] (-418.726) (-415.162) -- 0:00:43
      348000 -- (-414.997) (-410.809) [-415.394] (-410.436) * (-416.713) [-415.457] (-412.300) (-413.361) -- 0:00:43
      348500 -- (-419.776) (-415.446) [-416.371] (-411.196) * (-416.766) (-414.293) (-413.363) [-411.768] -- 0:00:42
      349000 -- (-419.789) [-411.757] (-414.412) (-410.437) * (-416.244) [-409.666] (-412.747) (-412.006) -- 0:00:42
      349500 -- (-412.264) (-415.879) [-416.736] (-412.149) * [-416.620] (-412.162) (-412.613) (-410.457) -- 0:00:42
      350000 -- [-414.305] (-413.045) (-417.180) (-413.981) * (-417.134) [-410.027] (-410.666) (-412.274) -- 0:00:42

      Average standard deviation of split frequencies: 0.016356

      350500 -- [-416.987] (-411.824) (-416.768) (-412.253) * (-411.908) (-412.762) [-411.272] (-412.940) -- 0:00:42
      351000 -- (-415.305) [-411.212] (-412.505) (-415.888) * [-411.264] (-414.781) (-414.360) (-414.802) -- 0:00:42
      351500 -- (-415.004) (-413.023) (-413.788) [-411.481] * [-412.296] (-412.654) (-414.434) (-411.092) -- 0:00:42
      352000 -- (-412.864) (-415.125) (-418.532) [-411.267] * (-413.443) (-411.725) (-411.941) [-412.610] -- 0:00:42
      352500 -- (-412.196) [-412.916] (-415.577) (-410.607) * (-411.116) (-410.420) [-416.403] (-414.591) -- 0:00:42
      353000 -- (-415.385) (-412.585) (-417.561) [-413.417] * (-409.551) (-413.766) (-415.664) [-413.304] -- 0:00:42
      353500 -- (-415.448) (-409.565) (-418.453) [-414.980] * (-410.614) (-412.783) [-410.691] (-411.978) -- 0:00:42
      354000 -- [-413.441] (-416.141) (-414.045) (-419.004) * [-415.760] (-409.634) (-411.730) (-412.239) -- 0:00:41
      354500 -- (-414.702) [-412.941] (-417.122) (-413.513) * (-417.265) (-415.893) (-412.464) [-411.582] -- 0:00:41
      355000 -- (-419.098) (-413.799) [-413.755] (-412.471) * (-414.953) [-412.801] (-410.377) (-411.268) -- 0:00:41

      Average standard deviation of split frequencies: 0.016591

      355500 -- (-418.021) [-413.499] (-412.585) (-416.338) * [-417.910] (-412.534) (-410.306) (-414.862) -- 0:00:41
      356000 -- (-416.196) (-412.931) (-415.564) [-414.691] * (-415.220) (-411.330) [-416.704] (-415.522) -- 0:00:41
      356500 -- [-414.557] (-415.003) (-417.396) (-414.502) * (-414.921) [-413.289] (-416.051) (-412.923) -- 0:00:41
      357000 -- [-411.377] (-413.435) (-414.368) (-413.439) * [-411.716] (-409.645) (-417.224) (-416.650) -- 0:00:41
      357500 -- (-411.816) (-415.295) (-414.450) [-413.620] * (-413.477) [-411.900] (-414.054) (-416.952) -- 0:00:41
      358000 -- [-412.827] (-414.476) (-412.685) (-413.491) * [-411.205] (-417.091) (-415.697) (-415.390) -- 0:00:41
      358500 -- (-413.233) (-420.218) [-413.628] (-412.227) * (-411.967) (-413.996) [-413.014] (-417.295) -- 0:00:42
      359000 -- (-411.161) (-416.202) [-417.482] (-411.992) * [-413.608] (-413.388) (-412.607) (-417.942) -- 0:00:42
      359500 -- [-409.401] (-414.113) (-414.630) (-412.216) * (-413.742) [-412.888] (-416.044) (-418.909) -- 0:00:42
      360000 -- (-411.924) [-414.059] (-420.210) (-413.496) * (-413.420) (-413.673) (-416.717) [-419.995] -- 0:00:42

      Average standard deviation of split frequencies: 0.016376

      360500 -- (-413.066) (-412.018) (-417.041) [-412.988] * (-415.294) (-414.019) [-411.887] (-411.478) -- 0:00:42
      361000 -- (-412.108) (-413.173) (-414.000) [-416.351] * (-411.382) (-413.177) (-423.067) [-412.557] -- 0:00:42
      361500 -- [-413.124] (-410.605) (-414.286) (-416.899) * (-411.685) [-411.729] (-416.442) (-412.968) -- 0:00:42
      362000 -- (-410.902) (-412.893) (-412.222) [-414.777] * (-415.324) (-413.123) (-416.106) [-412.242] -- 0:00:42
      362500 -- (-408.460) (-417.054) (-416.520) [-417.431] * [-413.144] (-415.164) (-417.612) (-412.575) -- 0:00:42
      363000 -- [-410.759] (-411.037) (-413.426) (-415.682) * (-412.662) (-413.430) (-419.385) [-411.511] -- 0:00:42
      363500 -- (-411.909) [-414.008] (-413.233) (-415.246) * [-409.625] (-411.700) (-418.227) (-412.701) -- 0:00:42
      364000 -- (-412.316) [-416.669] (-413.799) (-414.248) * (-412.322) (-411.512) (-413.035) [-411.148] -- 0:00:41
      364500 -- (-413.455) [-412.509] (-412.046) (-414.975) * [-413.689] (-412.278) (-414.009) (-411.080) -- 0:00:41
      365000 -- (-412.976) [-412.696] (-411.712) (-415.836) * (-412.110) (-411.655) (-419.710) [-411.082] -- 0:00:41

      Average standard deviation of split frequencies: 0.016214

      365500 -- (-418.352) (-411.546) [-414.073] (-413.304) * (-418.981) (-415.053) [-411.246] (-410.126) -- 0:00:41
      366000 -- [-411.404] (-417.343) (-413.114) (-416.790) * (-419.644) [-414.071] (-414.653) (-411.470) -- 0:00:41
      366500 -- (-414.624) (-414.769) [-412.908] (-412.695) * (-414.222) (-414.354) [-415.319] (-415.374) -- 0:00:41
      367000 -- (-414.046) [-411.885] (-414.395) (-415.076) * (-409.812) [-412.384] (-412.442) (-417.927) -- 0:00:41
      367500 -- (-414.888) [-410.865] (-413.777) (-417.095) * (-412.139) [-413.983] (-411.490) (-410.807) -- 0:00:41
      368000 -- (-409.735) [-410.444] (-416.090) (-413.680) * [-410.878] (-412.428) (-414.454) (-413.407) -- 0:00:41
      368500 -- (-413.187) [-414.842] (-414.686) (-412.621) * (-412.788) (-414.744) (-417.742) [-414.042] -- 0:00:41
      369000 -- (-411.985) (-414.462) (-414.890) [-411.271] * (-413.404) (-411.229) [-413.906] (-419.562) -- 0:00:41
      369500 -- [-413.387] (-413.662) (-413.149) (-410.838) * (-414.783) (-417.380) [-411.266] (-416.454) -- 0:00:40
      370000 -- (-411.669) (-413.737) [-414.101] (-412.047) * [-413.016] (-417.239) (-412.111) (-412.309) -- 0:00:40

      Average standard deviation of split frequencies: 0.015403

      370500 -- [-410.413] (-412.208) (-414.833) (-412.625) * (-411.584) (-411.500) [-410.914] (-415.201) -- 0:00:40
      371000 -- (-409.377) (-413.250) (-412.466) [-411.666] * (-412.841) (-411.871) [-411.320] (-416.490) -- 0:00:40
      371500 -- (-415.665) [-411.065] (-416.234) (-410.317) * [-413.752] (-419.145) (-413.567) (-412.825) -- 0:00:40
      372000 -- (-413.886) [-409.771] (-415.029) (-412.928) * (-416.189) (-414.558) (-413.498) [-413.716] -- 0:00:40
      372500 -- (-413.365) (-416.523) (-415.192) [-413.177] * (-411.802) (-414.051) [-411.525] (-414.692) -- 0:00:42
      373000 -- (-411.315) (-412.595) [-412.142] (-413.717) * (-414.237) (-416.783) (-416.115) [-413.538] -- 0:00:42
      373500 -- (-413.166) (-411.757) (-418.202) [-409.706] * (-412.647) (-412.627) (-414.020) [-413.241] -- 0:00:41
      374000 -- (-414.421) [-416.974] (-411.665) (-413.646) * (-419.083) (-413.432) (-414.092) [-411.973] -- 0:00:41
      374500 -- (-409.397) (-414.005) (-414.086) [-412.377] * (-412.421) [-412.857] (-413.281) (-410.500) -- 0:00:41
      375000 -- (-414.053) (-412.358) (-415.358) [-412.143] * (-411.268) [-410.874] (-413.754) (-414.761) -- 0:00:41

      Average standard deviation of split frequencies: 0.015184

      375500 -- (-413.126) (-414.861) [-417.090] (-411.451) * [-412.569] (-414.513) (-412.637) (-415.160) -- 0:00:41
      376000 -- [-417.735] (-411.584) (-411.556) (-415.586) * (-412.623) (-412.181) [-411.649] (-414.246) -- 0:00:41
      376500 -- (-418.920) (-410.936) [-408.954] (-412.847) * (-416.067) (-413.138) (-415.082) [-412.804] -- 0:00:41
      377000 -- (-410.680) (-412.071) [-412.665] (-409.646) * [-411.486] (-412.441) (-410.869) (-418.503) -- 0:00:41
      377500 -- (-410.512) (-418.545) [-410.574] (-412.712) * (-411.783) (-415.560) (-409.134) [-412.782] -- 0:00:41
      378000 -- (-412.418) (-416.032) (-411.562) [-411.120] * [-410.981] (-413.933) (-410.301) (-416.735) -- 0:00:41
      378500 -- (-410.979) (-413.316) (-410.414) [-412.603] * (-413.675) (-415.518) (-413.116) [-413.867] -- 0:00:41
      379000 -- (-411.175) (-415.434) [-408.729] (-412.741) * [-411.941] (-419.266) (-415.118) (-414.407) -- 0:00:40
      379500 -- (-412.294) (-413.971) [-412.637] (-412.613) * (-417.201) (-418.333) [-411.209] (-416.817) -- 0:00:40
      380000 -- (-415.897) [-410.218] (-415.966) (-413.878) * [-416.677] (-415.933) (-412.573) (-415.707) -- 0:00:40

      Average standard deviation of split frequencies: 0.015152

      380500 -- (-411.165) (-418.317) (-414.511) [-410.978] * (-419.202) (-417.065) [-412.726] (-413.118) -- 0:00:40
      381000 -- [-411.158] (-415.929) (-414.281) (-412.197) * [-412.976] (-417.183) (-413.476) (-411.790) -- 0:00:40
      381500 -- [-415.918] (-418.476) (-410.225) (-410.671) * (-412.701) [-412.310] (-414.921) (-413.572) -- 0:00:40
      382000 -- (-410.536) (-411.738) (-411.915) [-416.260] * (-413.406) [-410.925] (-413.431) (-412.606) -- 0:00:40
      382500 -- [-409.916] (-412.757) (-414.245) (-410.359) * (-415.793) [-410.912] (-411.915) (-415.080) -- 0:00:40
      383000 -- (-412.824) [-418.048] (-412.831) (-418.255) * (-416.926) [-410.188] (-415.399) (-412.548) -- 0:00:40
      383500 -- (-416.321) (-415.441) [-413.527] (-417.108) * (-411.802) [-413.307] (-413.787) (-414.142) -- 0:00:40
      384000 -- (-413.997) [-414.696] (-411.294) (-418.985) * (-413.068) (-412.061) [-410.290] (-411.462) -- 0:00:40
      384500 -- (-417.810) (-414.883) (-418.399) [-411.583] * (-412.400) [-412.114] (-413.644) (-414.068) -- 0:00:40
      385000 -- [-411.425] (-416.471) (-417.928) (-417.165) * (-411.449) [-411.098] (-414.018) (-416.308) -- 0:00:39

      Average standard deviation of split frequencies: 0.015130

      385500 -- (-411.628) (-415.653) (-420.385) [-414.638] * [-411.967] (-414.773) (-417.623) (-419.963) -- 0:00:39
      386000 -- [-415.654] (-414.512) (-421.068) (-413.353) * (-415.734) [-410.144] (-412.851) (-414.382) -- 0:00:39
      386500 -- [-412.527] (-417.430) (-414.582) (-412.478) * (-413.746) [-413.715] (-411.889) (-415.985) -- 0:00:39
      387000 -- (-413.508) (-414.160) (-412.922) [-414.836] * [-414.282] (-416.528) (-410.804) (-412.600) -- 0:00:39
      387500 -- [-418.338] (-411.911) (-410.205) (-412.393) * [-410.851] (-415.289) (-412.194) (-412.952) -- 0:00:39
      388000 -- (-412.525) (-411.782) [-412.545] (-419.216) * [-414.562] (-416.846) (-415.427) (-412.505) -- 0:00:39
      388500 -- (-412.463) (-412.013) [-414.253] (-412.735) * [-415.575] (-413.498) (-414.027) (-420.604) -- 0:00:40
      389000 -- (-417.363) (-417.704) (-413.525) [-413.615] * [-413.161] (-413.488) (-413.248) (-419.718) -- 0:00:40
      389500 -- (-415.255) [-412.846] (-416.476) (-414.911) * (-413.525) (-416.922) [-413.096] (-415.425) -- 0:00:40
      390000 -- (-413.667) (-413.998) [-414.077] (-412.186) * [-413.608] (-412.033) (-417.638) (-420.494) -- 0:00:40

      Average standard deviation of split frequencies: 0.014480

      390500 -- (-412.910) (-412.013) (-416.166) [-412.194] * (-415.054) (-414.988) [-410.642] (-412.609) -- 0:00:40
      391000 -- (-412.927) (-413.791) (-411.583) [-410.982] * (-411.825) (-417.039) [-415.852] (-410.853) -- 0:00:40
      391500 -- (-412.657) [-412.114] (-415.259) (-412.750) * [-414.621] (-414.221) (-412.209) (-413.235) -- 0:00:40
      392000 -- (-414.635) (-412.480) [-412.403] (-411.572) * [-414.191] (-418.608) (-414.612) (-410.868) -- 0:00:40
      392500 -- (-416.065) [-411.104] (-413.636) (-410.859) * (-417.846) (-413.812) (-414.883) [-412.958] -- 0:00:40
      393000 -- (-419.885) (-413.437) (-413.072) [-413.225] * (-419.701) (-415.052) [-414.331] (-416.171) -- 0:00:40
      393500 -- (-418.360) (-411.314) [-417.376] (-411.090) * (-412.556) (-411.338) (-411.533) [-415.596] -- 0:00:40
      394000 -- (-421.884) [-412.059] (-415.666) (-415.651) * [-411.458] (-412.802) (-415.327) (-420.491) -- 0:00:39
      394500 -- (-420.040) (-413.334) [-412.914] (-412.723) * [-413.259] (-413.391) (-418.972) (-410.645) -- 0:00:39
      395000 -- (-412.758) [-411.004] (-413.406) (-414.458) * [-410.473] (-413.653) (-414.125) (-411.360) -- 0:00:39

      Average standard deviation of split frequencies: 0.015773

      395500 -- (-415.467) [-412.021] (-412.615) (-415.783) * [-411.691] (-412.767) (-415.235) (-414.507) -- 0:00:39
      396000 -- (-418.321) (-413.095) [-412.975] (-413.268) * (-413.665) (-413.951) (-416.102) [-412.547] -- 0:00:39
      396500 -- (-413.603) (-413.505) (-417.311) [-416.297] * [-411.487] (-414.190) (-420.863) (-413.002) -- 0:00:39
      397000 -- [-413.399] (-417.043) (-416.304) (-412.875) * (-412.528) (-412.985) [-418.190] (-414.099) -- 0:00:39
      397500 -- (-413.228) (-417.808) (-416.010) [-411.252] * [-415.241] (-415.111) (-415.715) (-415.858) -- 0:00:39
      398000 -- [-412.297] (-416.141) (-413.421) (-411.012) * (-414.608) (-417.306) (-413.922) [-411.375] -- 0:00:39
      398500 -- (-413.620) (-415.447) (-415.804) [-411.775] * (-409.890) [-413.777] (-414.657) (-413.449) -- 0:00:39
      399000 -- (-411.867) (-415.119) (-416.513) [-413.068] * (-413.673) (-415.700) (-415.821) [-410.885] -- 0:00:39
      399500 -- (-412.569) [-412.127] (-415.082) (-411.934) * (-412.646) [-416.245] (-414.799) (-415.720) -- 0:00:39
      400000 -- [-412.963] (-413.872) (-415.597) (-412.527) * (-411.879) (-411.951) (-418.062) [-410.959] -- 0:00:39

      Average standard deviation of split frequencies: 0.016178

      400500 -- (-415.957) [-410.397] (-416.037) (-415.973) * [-415.761] (-413.176) (-418.755) (-410.966) -- 0:00:38
      401000 -- (-411.070) (-410.297) [-416.325] (-411.836) * (-414.791) (-411.639) [-414.851] (-418.241) -- 0:00:38
      401500 -- [-410.656] (-412.264) (-414.718) (-415.835) * [-413.747] (-417.536) (-416.235) (-417.610) -- 0:00:38
      402000 -- (-413.563) (-414.948) (-415.766) [-416.130] * (-413.822) (-417.885) (-413.563) [-413.475] -- 0:00:38
      402500 -- [-411.759] (-411.145) (-414.615) (-416.241) * (-412.204) (-414.011) (-413.729) [-412.203] -- 0:00:38
      403000 -- [-414.359] (-412.876) (-416.122) (-414.451) * (-413.277) (-413.795) (-415.854) [-412.367] -- 0:00:38
      403500 -- [-412.370] (-414.358) (-414.802) (-411.064) * (-415.671) [-411.555] (-415.955) (-414.301) -- 0:00:38
      404000 -- [-411.794] (-413.147) (-414.019) (-415.256) * [-410.112] (-414.110) (-415.815) (-416.240) -- 0:00:39
      404500 -- (-412.053) [-412.251] (-414.854) (-412.436) * [-414.313] (-413.720) (-414.984) (-414.917) -- 0:00:39
      405000 -- (-414.036) (-415.796) [-412.750] (-414.214) * (-412.031) (-413.963) [-415.113] (-412.329) -- 0:00:39

      Average standard deviation of split frequencies: 0.016119

      405500 -- (-414.565) (-412.290) (-411.190) [-410.642] * (-418.471) (-415.719) (-415.984) [-417.875] -- 0:00:39
      406000 -- (-417.988) (-419.527) [-412.996] (-414.057) * (-416.473) [-413.344] (-415.166) (-418.639) -- 0:00:39
      406500 -- (-421.663) (-412.268) (-413.224) [-410.473] * [-412.464] (-415.173) (-414.072) (-414.722) -- 0:00:39
      407000 -- (-418.765) (-409.839) [-413.503] (-411.477) * (-411.213) [-412.966] (-413.630) (-416.993) -- 0:00:39
      407500 -- (-415.772) [-412.834] (-413.591) (-417.816) * (-414.733) [-413.589] (-414.964) (-415.484) -- 0:00:39
      408000 -- (-413.578) [-415.326] (-416.098) (-411.778) * (-411.527) (-411.466) (-412.884) [-414.909] -- 0:00:39
      408500 -- (-417.162) (-412.171) (-416.306) [-412.769] * (-413.345) (-415.270) (-412.924) [-414.893] -- 0:00:39
      409000 -- (-412.962) [-415.154] (-412.697) (-417.969) * (-414.302) [-412.749] (-412.768) (-412.726) -- 0:00:39
      409500 -- (-414.442) (-414.935) (-420.584) [-413.237] * (-411.829) (-414.600) [-414.758] (-414.514) -- 0:00:38
      410000 -- (-415.260) (-419.726) [-416.424] (-412.117) * (-414.532) [-412.251] (-410.485) (-417.660) -- 0:00:38

      Average standard deviation of split frequencies: 0.017354

      410500 -- (-412.829) [-409.259] (-416.264) (-413.656) * (-416.845) (-414.792) [-413.306] (-414.078) -- 0:00:38
      411000 -- (-411.532) (-410.916) (-416.049) [-410.124] * (-413.236) (-417.076) [-413.645] (-415.620) -- 0:00:38
      411500 -- (-417.674) [-412.490] (-416.116) (-414.770) * [-413.695] (-415.403) (-414.070) (-419.123) -- 0:00:38
      412000 -- [-412.672] (-413.722) (-410.354) (-414.187) * (-414.668) [-414.635] (-417.194) (-413.222) -- 0:00:38
      412500 -- (-412.924) [-412.604] (-414.802) (-410.494) * (-415.306) (-411.539) (-414.729) [-411.509] -- 0:00:38
      413000 -- [-417.275] (-416.370) (-414.007) (-412.436) * (-413.036) (-415.823) [-414.037] (-417.575) -- 0:00:38
      413500 -- [-416.577] (-413.297) (-420.233) (-413.362) * (-413.056) [-417.150] (-416.867) (-417.587) -- 0:00:38
      414000 -- [-413.151] (-410.582) (-418.089) (-415.003) * (-413.919) (-413.632) [-413.975] (-420.758) -- 0:00:38
      414500 -- (-417.970) (-409.663) (-416.665) [-410.592] * (-414.322) [-415.034] (-416.826) (-417.787) -- 0:00:38
      415000 -- [-414.165] (-415.567) (-414.114) (-412.655) * (-413.796) (-414.035) (-412.136) [-412.788] -- 0:00:38

      Average standard deviation of split frequencies: 0.016683

      415500 -- (-411.875) [-410.661] (-414.171) (-411.605) * (-416.083) [-418.179] (-412.141) (-412.344) -- 0:00:37
      416000 -- (-410.001) (-413.742) [-412.273] (-412.077) * (-415.050) (-415.889) [-411.367] (-415.703) -- 0:00:37
      416500 -- (-409.661) (-414.484) (-414.877) [-412.945] * (-414.608) (-417.301) [-413.088] (-410.464) -- 0:00:37
      417000 -- (-412.486) (-412.131) [-412.572] (-414.391) * (-413.807) (-417.945) (-416.053) [-410.753] -- 0:00:37
      417500 -- [-409.011] (-413.764) (-411.234) (-410.708) * (-414.036) (-416.741) (-415.186) [-411.534] -- 0:00:37
      418000 -- [-410.590] (-416.023) (-414.434) (-415.477) * [-417.117] (-416.578) (-418.781) (-415.285) -- 0:00:37
      418500 -- [-413.988] (-414.534) (-412.326) (-416.678) * (-416.023) (-412.734) (-414.828) [-413.171] -- 0:00:37
      419000 -- (-413.759) (-412.385) [-412.478] (-412.695) * (-414.081) (-416.751) [-412.577] (-412.687) -- 0:00:37
      419500 -- (-417.354) (-412.842) [-411.122] (-416.297) * [-414.642] (-418.400) (-414.592) (-413.444) -- 0:00:37
      420000 -- (-413.956) [-422.417] (-413.064) (-413.561) * (-421.355) [-415.997] (-414.546) (-416.319) -- 0:00:38

      Average standard deviation of split frequencies: 0.016480

      420500 -- (-415.146) [-413.866] (-413.482) (-413.282) * (-420.517) [-414.094] (-412.578) (-415.925) -- 0:00:38
      421000 -- [-410.059] (-416.958) (-415.627) (-412.373) * (-422.424) [-411.138] (-415.685) (-416.327) -- 0:00:38
      421500 -- [-413.992] (-413.800) (-410.251) (-411.796) * [-417.151] (-418.086) (-420.772) (-411.688) -- 0:00:38
      422000 -- (-414.121) (-411.875) (-413.341) [-410.287] * (-412.148) (-415.400) (-414.709) [-410.174] -- 0:00:38
      422500 -- (-412.193) (-413.470) (-410.751) [-412.704] * [-412.417] (-415.781) (-414.836) (-414.713) -- 0:00:38
      423000 -- (-413.513) (-417.879) [-411.981] (-411.172) * (-415.327) [-409.799] (-416.333) (-417.865) -- 0:00:38
      423500 -- [-415.408] (-415.218) (-414.847) (-414.384) * (-416.385) (-414.456) [-414.193] (-415.726) -- 0:00:38
      424000 -- [-412.785] (-413.262) (-414.897) (-412.142) * [-411.008] (-416.147) (-413.166) (-417.911) -- 0:00:38
      424500 -- (-414.755) [-417.323] (-414.154) (-411.349) * (-415.255) (-416.812) (-412.079) [-413.262] -- 0:00:37
      425000 -- (-415.334) (-415.346) (-415.579) [-413.032] * (-410.469) [-414.034] (-415.744) (-416.884) -- 0:00:37

      Average standard deviation of split frequencies: 0.014877

      425500 -- (-412.746) (-413.423) [-415.731] (-414.666) * (-414.027) (-413.195) [-414.392] (-412.598) -- 0:00:37
      426000 -- (-414.259) (-416.159) (-417.457) [-412.473] * (-414.787) [-415.935] (-414.349) (-414.723) -- 0:00:37
      426500 -- (-413.584) (-416.135) (-413.480) [-412.043] * [-413.802] (-414.815) (-412.296) (-411.671) -- 0:00:37
      427000 -- (-415.884) (-413.382) (-413.598) [-413.529] * [-416.245] (-413.197) (-415.437) (-415.030) -- 0:00:37
      427500 -- (-413.397) [-410.727] (-416.849) (-416.364) * [-415.843] (-413.159) (-413.284) (-410.966) -- 0:00:37
      428000 -- (-413.816) (-413.093) (-410.549) [-410.421] * [-410.170] (-413.743) (-411.312) (-415.142) -- 0:00:37
      428500 -- (-413.074) (-416.915) [-409.801] (-411.288) * [-414.158] (-414.909) (-412.684) (-415.330) -- 0:00:37
      429000 -- (-411.263) (-415.071) [-412.308] (-415.248) * (-414.495) (-418.314) (-413.605) [-411.776] -- 0:00:37
      429500 -- (-410.849) (-413.807) (-413.428) [-413.921] * (-412.147) [-413.323] (-414.508) (-412.290) -- 0:00:37
      430000 -- [-412.522] (-415.871) (-417.595) (-417.987) * (-414.158) (-413.862) (-412.983) [-411.685] -- 0:00:37

      Average standard deviation of split frequencies: 0.016226

      430500 -- (-413.675) (-414.660) [-413.621] (-414.796) * (-413.724) (-413.861) [-411.655] (-413.001) -- 0:00:37
      431000 -- [-411.257] (-413.244) (-416.645) (-414.075) * (-416.510) (-417.678) (-417.102) [-411.337] -- 0:00:36
      431500 -- [-419.743] (-413.899) (-411.652) (-419.443) * (-417.003) (-413.961) (-412.860) [-414.352] -- 0:00:36
      432000 -- [-413.502] (-413.714) (-411.744) (-411.679) * [-414.195] (-417.557) (-417.736) (-417.067) -- 0:00:36
      432500 -- (-410.461) (-411.177) [-411.910] (-413.855) * (-415.635) [-414.502] (-417.423) (-412.117) -- 0:00:36
      433000 -- (-420.739) (-413.634) [-410.562] (-412.166) * [-411.711] (-416.492) (-413.552) (-415.633) -- 0:00:36
      433500 -- (-415.834) (-414.806) [-411.636] (-414.025) * (-411.017) [-409.926] (-419.051) (-414.169) -- 0:00:36
      434000 -- (-414.308) (-414.081) [-410.819] (-416.244) * [-412.022] (-413.039) (-416.040) (-413.455) -- 0:00:36
      434500 -- (-418.571) (-416.445) (-410.829) [-411.446] * (-413.422) (-412.800) [-414.028] (-411.341) -- 0:00:36
      435000 -- (-415.668) (-415.964) [-412.650] (-410.385) * [-413.311] (-419.452) (-413.426) (-410.485) -- 0:00:36

      Average standard deviation of split frequencies: 0.016600

      435500 -- [-412.912] (-413.051) (-412.126) (-410.064) * [-411.429] (-418.890) (-414.795) (-412.222) -- 0:00:37
      436000 -- (-413.257) (-414.456) (-413.385) [-413.481] * (-413.162) (-415.197) (-411.554) [-415.034] -- 0:00:37
      436500 -- [-413.601] (-414.679) (-412.442) (-417.382) * (-413.149) [-415.427] (-414.876) (-411.368) -- 0:00:37
      437000 -- [-413.075] (-411.207) (-412.204) (-415.009) * [-414.896] (-414.838) (-417.036) (-414.376) -- 0:00:37
      437500 -- (-418.681) (-410.764) [-414.387] (-411.936) * (-411.665) [-413.919] (-418.438) (-412.522) -- 0:00:37
      438000 -- (-414.564) (-412.988) (-412.124) [-414.028] * (-410.907) (-415.600) [-413.064] (-412.037) -- 0:00:37
      438500 -- (-413.544) (-414.180) [-414.411] (-416.781) * (-414.193) (-416.208) (-412.382) [-413.384] -- 0:00:37
      439000 -- [-411.059] (-416.531) (-411.135) (-414.395) * (-411.258) (-417.174) (-414.667) [-415.441] -- 0:00:37
      439500 -- [-413.357] (-413.384) (-412.099) (-419.893) * (-414.438) (-412.490) [-413.645] (-414.540) -- 0:00:36
      440000 -- (-410.699) (-412.555) (-412.956) [-411.609] * (-413.942) (-412.900) [-413.276] (-417.182) -- 0:00:36

      Average standard deviation of split frequencies: 0.016046

      440500 -- [-417.827] (-413.789) (-414.743) (-410.861) * (-415.219) [-413.761] (-413.970) (-415.808) -- 0:00:36
      441000 -- (-419.288) (-416.243) (-414.390) [-413.734] * [-414.877] (-415.901) (-414.454) (-416.916) -- 0:00:36
      441500 -- (-413.190) (-418.626) [-413.800] (-415.111) * (-414.969) [-414.216] (-416.947) (-414.248) -- 0:00:36
      442000 -- (-417.418) [-411.161] (-414.900) (-413.088) * [-411.600] (-415.438) (-415.353) (-412.636) -- 0:00:36
      442500 -- (-417.657) (-412.995) (-414.507) [-413.492] * [-414.701] (-410.121) (-412.648) (-416.130) -- 0:00:36
      443000 -- (-415.203) (-413.899) [-414.657] (-413.372) * (-416.038) (-416.304) [-411.656] (-415.340) -- 0:00:36
      443500 -- (-416.637) [-412.863] (-413.497) (-412.574) * (-414.390) (-417.236) [-412.197] (-416.911) -- 0:00:36
      444000 -- (-417.981) [-414.186] (-412.596) (-410.722) * (-415.507) (-411.802) [-413.765] (-415.073) -- 0:00:36
      444500 -- (-414.535) (-412.007) (-411.566) [-411.253] * [-415.901] (-417.028) (-414.677) (-416.697) -- 0:00:36
      445000 -- (-417.802) (-414.556) (-414.586) [-412.615] * (-412.561) (-417.472) (-413.777) [-413.803] -- 0:00:36

      Average standard deviation of split frequencies: 0.015544

      445500 -- (-413.586) [-412.502] (-414.679) (-413.681) * [-414.609] (-415.128) (-412.136) (-418.041) -- 0:00:36
      446000 -- (-415.276) [-412.696] (-413.055) (-414.197) * (-413.458) [-413.694] (-413.395) (-413.063) -- 0:00:36
      446500 -- (-416.568) (-414.752) [-412.213] (-412.521) * [-412.065] (-413.021) (-412.011) (-412.665) -- 0:00:35
      447000 -- (-416.498) (-416.385) [-411.152] (-412.909) * [-413.730] (-414.783) (-415.337) (-415.333) -- 0:00:35
      447500 -- (-417.580) (-414.900) [-408.873] (-418.207) * (-412.180) [-417.232] (-413.321) (-417.311) -- 0:00:35
      448000 -- (-413.847) [-413.774] (-413.759) (-413.951) * [-410.667] (-415.480) (-415.152) (-416.163) -- 0:00:35
      448500 -- (-414.072) (-409.426) (-410.604) [-414.623] * (-412.588) (-413.924) (-416.842) [-410.075] -- 0:00:35
      449000 -- (-413.794) (-409.970) [-414.450] (-419.432) * (-415.790) (-412.752) [-414.445] (-415.268) -- 0:00:35
      449500 -- (-415.288) (-411.396) [-413.879] (-415.072) * (-416.297) (-413.042) (-416.694) [-410.446] -- 0:00:35
      450000 -- (-414.523) (-412.948) [-412.681] (-414.522) * (-413.943) (-415.167) [-412.279] (-411.281) -- 0:00:35

      Average standard deviation of split frequencies: 0.014767

      450500 -- (-416.160) [-411.726] (-412.588) (-416.763) * (-414.731) (-414.700) [-411.313] (-412.830) -- 0:00:35
      451000 -- (-413.917) (-412.834) (-415.907) [-412.518] * (-414.034) (-413.171) (-412.345) [-412.709] -- 0:00:36
      451500 -- [-415.110] (-413.193) (-411.983) (-412.365) * (-411.422) [-415.373] (-413.488) (-415.479) -- 0:00:36
      452000 -- (-411.265) (-416.159) [-410.412] (-413.468) * (-415.754) (-414.545) [-414.871] (-417.880) -- 0:00:36
      452500 -- [-414.534] (-410.105) (-413.475) (-415.965) * (-416.752) [-411.971] (-413.450) (-417.813) -- 0:00:36
      453000 -- (-414.233) [-414.576] (-416.384) (-410.960) * [-408.993] (-414.746) (-415.146) (-417.866) -- 0:00:36
      453500 -- [-416.621] (-415.523) (-415.563) (-413.042) * [-411.956] (-412.596) (-414.907) (-419.208) -- 0:00:36
      454000 -- (-415.169) [-412.358] (-415.538) (-416.361) * [-411.574] (-414.673) (-418.433) (-411.236) -- 0:00:36
      454500 -- [-411.457] (-412.212) (-414.641) (-415.864) * (-411.690) (-412.564) [-413.802] (-411.754) -- 0:00:36
      455000 -- (-414.063) (-415.737) [-414.520] (-417.201) * (-412.610) [-412.794] (-412.452) (-416.431) -- 0:00:35

      Average standard deviation of split frequencies: 0.014716

      455500 -- [-409.757] (-412.565) (-410.621) (-417.274) * (-415.306) [-418.171] (-413.791) (-409.192) -- 0:00:35
      456000 -- (-416.237) (-409.238) [-413.390] (-416.467) * [-413.445] (-414.360) (-413.343) (-415.102) -- 0:00:35
      456500 -- (-414.601) [-411.228] (-414.452) (-416.950) * [-411.328] (-416.460) (-411.665) (-413.419) -- 0:00:35
      457000 -- [-412.572] (-411.875) (-414.184) (-413.232) * (-412.461) (-414.280) [-413.391] (-411.108) -- 0:00:35
      457500 -- (-415.269) (-409.863) [-411.881] (-414.788) * (-411.284) (-413.279) (-415.376) [-413.463] -- 0:00:35
      458000 -- (-414.937) (-413.211) (-414.219) [-414.266] * (-415.642) [-414.224] (-416.828) (-414.711) -- 0:00:35
      458500 -- (-415.800) [-409.146] (-418.639) (-412.851) * (-413.122) [-411.188] (-414.426) (-410.812) -- 0:00:35
      459000 -- (-417.202) [-413.128] (-414.584) (-413.314) * (-418.682) [-414.803] (-412.769) (-409.979) -- 0:00:35
      459500 -- (-413.714) (-414.136) (-413.796) [-413.982] * (-420.776) (-416.048) (-414.320) [-414.149] -- 0:00:35
      460000 -- (-416.226) [-415.244] (-414.342) (-416.605) * (-416.468) (-415.677) [-415.830] (-411.411) -- 0:00:35

      Average standard deviation of split frequencies: 0.015109

      460500 -- [-412.237] (-419.195) (-412.662) (-415.083) * (-417.691) (-418.182) (-417.616) [-411.012] -- 0:00:35
      461000 -- (-412.383) [-412.217] (-411.499) (-413.745) * (-414.016) (-419.007) (-417.283) [-416.770] -- 0:00:35
      461500 -- (-414.361) (-416.149) [-412.638] (-417.171) * [-414.435] (-413.744) (-417.302) (-418.340) -- 0:00:35
      462000 -- (-412.417) [-415.965] (-417.750) (-417.801) * (-411.391) [-411.428] (-415.020) (-412.448) -- 0:00:34
      462500 -- (-412.656) (-412.007) [-414.530] (-417.860) * (-415.727) (-413.016) (-410.083) [-412.754] -- 0:00:34
      463000 -- (-413.558) (-410.061) (-414.823) [-412.709] * (-414.437) (-417.047) (-417.556) [-411.113] -- 0:00:34
      463500 -- (-413.929) (-417.234) [-414.316] (-417.289) * (-414.060) (-418.870) (-413.941) [-412.071] -- 0:00:34
      464000 -- (-413.355) (-419.326) (-414.591) [-418.681] * (-411.680) (-413.360) [-412.266] (-417.633) -- 0:00:34
      464500 -- (-413.100) (-415.269) (-416.040) [-414.691] * [-410.903] (-410.926) (-414.676) (-419.916) -- 0:00:34
      465000 -- (-416.215) [-416.880] (-414.622) (-412.381) * (-414.047) (-416.023) (-416.347) [-412.877] -- 0:00:34

      Average standard deviation of split frequencies: 0.015888

      465500 -- (-411.438) (-417.179) [-412.794] (-417.926) * (-415.247) [-414.006] (-412.418) (-414.136) -- 0:00:34
      466000 -- (-412.022) (-414.860) [-415.716] (-413.803) * [-415.511] (-414.825) (-421.465) (-413.205) -- 0:00:34
      466500 -- (-412.337) [-411.700] (-416.542) (-416.774) * [-415.180] (-413.200) (-412.847) (-413.227) -- 0:00:35
      467000 -- (-416.761) (-416.743) (-412.685) [-413.964] * (-417.615) (-415.215) [-418.039] (-411.827) -- 0:00:35
      467500 -- (-416.549) [-416.834] (-412.656) (-415.583) * (-415.379) (-415.234) (-413.422) [-415.452] -- 0:00:35
      468000 -- (-413.263) (-415.887) [-414.448] (-412.337) * (-415.020) (-417.535) (-416.651) [-411.536] -- 0:00:35
      468500 -- (-412.951) (-415.901) [-414.096] (-411.204) * (-411.108) (-413.817) (-415.051) [-412.427] -- 0:00:35
      469000 -- [-413.909] (-412.196) (-413.772) (-414.366) * (-413.580) (-416.143) [-414.482] (-411.910) -- 0:00:35
      469500 -- [-411.109] (-413.779) (-416.934) (-415.717) * [-414.834] (-414.458) (-413.686) (-412.224) -- 0:00:35
      470000 -- (-415.904) (-410.956) [-413.559] (-412.454) * (-416.113) (-413.747) (-414.537) [-412.458] -- 0:00:34

      Average standard deviation of split frequencies: 0.015672

      470500 -- (-411.869) [-412.377] (-413.486) (-419.484) * [-414.820] (-413.170) (-412.557) (-417.534) -- 0:00:34
      471000 -- (-410.136) (-414.799) [-416.964] (-412.182) * (-418.530) (-415.520) [-411.951] (-416.059) -- 0:00:34
      471500 -- (-413.750) (-413.333) [-416.525] (-416.612) * (-414.205) (-414.261) (-413.610) [-411.646] -- 0:00:34
      472000 -- (-416.857) [-411.322] (-415.568) (-416.667) * (-415.745) [-411.701] (-413.145) (-410.869) -- 0:00:34
      472500 -- [-413.628] (-411.602) (-415.490) (-419.168) * (-415.307) [-415.533] (-413.483) (-417.355) -- 0:00:34
      473000 -- (-417.817) (-415.909) (-415.238) [-417.411] * (-418.796) [-415.568] (-414.548) (-415.199) -- 0:00:34
      473500 -- (-412.970) (-415.253) (-420.329) [-417.100] * (-423.684) [-414.708] (-417.265) (-414.643) -- 0:00:34
      474000 -- (-414.696) [-415.225] (-419.720) (-414.496) * [-416.274] (-413.526) (-411.727) (-415.521) -- 0:00:34
      474500 -- (-423.646) (-411.011) [-415.442] (-415.079) * (-417.422) (-409.554) (-414.609) [-411.345] -- 0:00:34
      475000 -- (-418.255) [-414.084] (-415.806) (-413.900) * (-419.323) (-414.142) [-413.506] (-415.000) -- 0:00:34

      Average standard deviation of split frequencies: 0.014564

      475500 -- (-415.345) (-411.373) (-419.178) [-412.264] * (-414.588) (-413.526) [-414.254] (-414.604) -- 0:00:34
      476000 -- [-414.135] (-411.508) (-421.530) (-412.611) * (-415.833) (-413.181) [-412.002] (-414.103) -- 0:00:34
      476500 -- [-413.938] (-410.999) (-416.438) (-417.482) * (-413.412) [-412.544] (-411.904) (-417.500) -- 0:00:34
      477000 -- (-417.613) [-411.949] (-414.698) (-413.110) * (-416.690) (-416.674) (-414.236) [-411.536] -- 0:00:33
      477500 -- (-416.851) (-415.002) [-416.196] (-412.733) * [-413.396] (-418.150) (-413.638) (-413.232) -- 0:00:33
      478000 -- [-417.745] (-414.064) (-416.050) (-415.972) * (-417.036) (-413.898) [-411.501] (-409.982) -- 0:00:33
      478500 -- [-412.933] (-415.153) (-418.135) (-417.089) * (-415.711) [-412.128] (-413.708) (-413.633) -- 0:00:33
      479000 -- [-412.579] (-414.900) (-417.611) (-411.665) * (-421.198) [-414.379] (-414.556) (-410.554) -- 0:00:33
      479500 -- (-412.210) (-415.443) [-413.128] (-412.446) * (-413.824) (-418.923) (-412.458) [-410.305] -- 0:00:33
      480000 -- (-417.961) (-413.950) [-414.823] (-415.207) * [-410.711] (-419.053) (-417.387) (-411.558) -- 0:00:33

      Average standard deviation of split frequencies: 0.014769

      480500 -- (-415.681) (-410.492) [-414.961] (-415.000) * (-416.209) (-411.912) [-411.687] (-414.721) -- 0:00:33
      481000 -- (-415.129) (-411.731) [-416.340] (-414.663) * (-413.867) (-413.413) (-412.850) [-413.753] -- 0:00:33
      481500 -- (-412.518) (-411.650) [-416.549] (-414.440) * (-414.780) (-410.353) [-414.681] (-413.013) -- 0:00:33
      482000 -- (-417.977) [-413.755] (-418.299) (-410.063) * (-415.122) [-411.464] (-416.363) (-414.637) -- 0:00:33
      482500 -- (-414.799) [-411.832] (-413.496) (-416.464) * [-412.733] (-414.832) (-415.655) (-411.730) -- 0:00:34
      483000 -- (-414.338) (-413.384) [-413.170] (-414.241) * [-415.207] (-412.113) (-411.802) (-414.312) -- 0:00:34
      483500 -- (-413.484) [-413.759] (-412.498) (-416.579) * (-417.301) (-410.483) [-412.476] (-419.948) -- 0:00:34
      484000 -- [-413.096] (-412.913) (-412.336) (-414.711) * (-412.176) [-410.496] (-413.017) (-410.952) -- 0:00:34
      484500 -- [-411.931] (-414.139) (-414.477) (-416.927) * (-414.612) (-411.807) (-412.329) [-412.199] -- 0:00:34
      485000 -- [-413.020] (-417.529) (-415.486) (-413.107) * (-413.538) [-417.040] (-413.260) (-413.064) -- 0:00:33

      Average standard deviation of split frequencies: 0.014607

      485500 -- [-412.040] (-411.957) (-418.172) (-410.303) * [-411.338] (-413.669) (-416.476) (-413.308) -- 0:00:33
      486000 -- (-414.149) (-411.859) (-414.281) [-413.011] * (-412.491) [-414.527] (-414.850) (-418.328) -- 0:00:33
      486500 -- (-415.648) [-413.570] (-416.478) (-413.272) * (-412.103) [-415.646] (-413.443) (-413.805) -- 0:00:33
      487000 -- (-413.077) [-412.989] (-416.383) (-413.609) * (-417.951) [-411.579] (-411.646) (-416.404) -- 0:00:33
      487500 -- (-413.944) (-415.128) (-413.692) [-410.996] * [-411.564] (-413.516) (-414.226) (-415.842) -- 0:00:33
      488000 -- (-411.924) (-421.385) [-414.049] (-411.881) * (-414.564) [-411.257] (-413.513) (-415.121) -- 0:00:33
      488500 -- [-419.772] (-415.661) (-415.540) (-412.746) * (-417.176) (-411.638) [-413.378] (-418.544) -- 0:00:33
      489000 -- [-417.338] (-415.374) (-415.496) (-413.286) * (-415.151) [-413.851] (-415.003) (-416.221) -- 0:00:33
      489500 -- (-416.140) [-413.839] (-412.485) (-411.795) * (-415.909) (-410.444) [-413.817] (-422.944) -- 0:00:33
      490000 -- (-416.593) [-414.217] (-417.380) (-412.919) * (-413.983) [-411.547] (-418.745) (-419.857) -- 0:00:33

      Average standard deviation of split frequencies: 0.014298

      490500 -- [-416.762] (-415.712) (-415.991) (-412.755) * (-412.887) (-420.408) [-415.189] (-416.827) -- 0:00:33
      491000 -- [-416.039] (-418.057) (-415.564) (-410.686) * (-411.000) (-414.587) (-412.425) [-420.464] -- 0:00:33
      491500 -- (-412.709) [-410.846] (-419.167) (-414.172) * (-413.734) (-415.047) [-410.710] (-412.208) -- 0:00:33
      492000 -- (-418.056) [-410.746] (-414.711) (-410.823) * (-410.669) (-410.369) [-409.560] (-415.191) -- 0:00:33
      492500 -- (-414.337) (-415.543) (-415.400) [-412.407] * (-414.094) [-414.021] (-410.422) (-416.444) -- 0:00:32
      493000 -- (-416.566) (-414.941) [-415.672] (-410.605) * (-413.439) (-418.644) [-411.511] (-416.388) -- 0:00:32
      493500 -- [-413.271] (-412.663) (-415.097) (-414.062) * (-415.376) [-409.973] (-411.002) (-415.949) -- 0:00:32
      494000 -- (-414.225) (-414.357) (-414.958) [-411.412] * (-415.086) (-409.159) [-413.003] (-413.143) -- 0:00:32
      494500 -- (-412.680) (-416.099) [-417.057] (-412.632) * [-413.405] (-412.492) (-412.932) (-420.199) -- 0:00:32
      495000 -- (-414.672) [-412.523] (-414.111) (-413.379) * (-413.274) (-412.461) (-412.599) [-419.714] -- 0:00:32

      Average standard deviation of split frequencies: 0.013977

      495500 -- [-416.933] (-413.560) (-413.428) (-413.512) * (-410.636) [-412.967] (-412.557) (-413.892) -- 0:00:32
      496000 -- (-416.704) [-416.951] (-412.347) (-413.614) * [-412.121] (-416.694) (-414.391) (-414.109) -- 0:00:32
      496500 -- (-414.613) (-413.658) [-412.015] (-414.591) * (-414.143) (-410.571) (-414.208) [-413.177] -- 0:00:32
      497000 -- (-419.288) [-413.192] (-413.991) (-414.726) * (-417.116) (-413.539) (-410.870) [-414.863] -- 0:00:32
      497500 -- [-415.188] (-414.778) (-413.278) (-415.945) * (-414.286) (-410.513) (-411.319) [-413.490] -- 0:00:32
      498000 -- (-416.361) (-412.377) (-411.994) [-413.273] * (-412.586) [-411.176] (-412.293) (-417.144) -- 0:00:33
      498500 -- (-415.063) (-413.098) (-411.964) [-411.406] * [-412.534] (-411.266) (-414.637) (-418.102) -- 0:00:33
      499000 -- (-414.451) (-411.812) [-416.147] (-415.521) * (-411.652) (-413.739) [-413.329] (-417.360) -- 0:00:33
      499500 -- [-413.356] (-411.003) (-414.348) (-417.467) * [-412.834] (-414.393) (-414.069) (-412.076) -- 0:00:33
      500000 -- (-413.828) (-414.132) (-412.347) [-416.102] * [-414.328] (-413.117) (-412.053) (-414.014) -- 0:00:33

      Average standard deviation of split frequencies: 0.014345

      500500 -- (-413.584) (-411.958) [-411.949] (-414.378) * (-413.792) (-410.743) [-416.311] (-410.252) -- 0:00:32
      501000 -- (-416.251) (-418.458) [-412.570] (-411.596) * (-416.701) (-413.432) [-411.863] (-414.243) -- 0:00:32
      501500 -- (-413.116) (-415.164) (-414.052) [-413.908] * [-410.796] (-412.208) (-411.949) (-411.869) -- 0:00:32
      502000 -- (-414.201) (-415.305) (-414.823) [-412.601] * (-411.253) [-411.818] (-410.370) (-413.557) -- 0:00:32
      502500 -- (-415.256) (-414.665) (-416.573) [-410.723] * (-413.019) (-413.256) [-412.746] (-416.409) -- 0:00:32
      503000 -- (-414.700) (-415.880) (-414.311) [-412.960] * [-411.438] (-413.770) (-415.365) (-411.883) -- 0:00:32
      503500 -- [-416.170] (-417.224) (-410.580) (-412.533) * (-412.217) (-412.042) (-412.483) [-413.734] -- 0:00:32
      504000 -- (-414.937) (-414.472) [-415.447] (-416.579) * (-413.937) (-420.673) [-410.483] (-412.741) -- 0:00:32
      504500 -- [-418.858] (-417.892) (-417.520) (-412.692) * (-412.176) (-414.476) [-411.140] (-413.073) -- 0:00:32
      505000 -- [-416.883] (-415.674) (-411.694) (-414.890) * (-416.750) (-413.489) [-412.889] (-416.467) -- 0:00:32

      Average standard deviation of split frequencies: 0.013426

      505500 -- (-421.480) (-416.173) [-414.254] (-411.785) * (-415.544) (-413.065) [-409.726] (-412.400) -- 0:00:32
      506000 -- [-420.334] (-417.037) (-411.966) (-413.400) * (-419.184) [-415.786] (-412.743) (-411.489) -- 0:00:32
      506500 -- (-416.377) (-421.968) (-416.666) [-412.451] * [-414.815] (-415.690) (-419.755) (-411.592) -- 0:00:32
      507000 -- [-414.379] (-416.082) (-412.559) (-410.243) * (-411.802) (-416.881) (-410.900) [-412.973] -- 0:00:32
      507500 -- (-416.942) (-414.073) (-413.041) [-412.726] * [-418.887] (-415.588) (-413.591) (-417.754) -- 0:00:32
      508000 -- (-412.317) (-413.681) [-418.199] (-413.277) * (-415.649) [-414.571] (-410.398) (-418.946) -- 0:00:31
      508500 -- (-415.512) (-413.448) [-413.755] (-415.485) * (-413.505) (-415.126) [-411.076] (-415.242) -- 0:00:31
      509000 -- (-413.781) (-418.322) (-414.803) [-411.399] * (-416.098) (-416.101) (-414.946) [-414.290] -- 0:00:31
      509500 -- (-412.321) (-415.854) (-415.731) [-414.558] * [-412.654] (-415.703) (-417.268) (-413.538) -- 0:00:31
      510000 -- (-412.767) (-414.336) [-415.491] (-412.711) * (-414.027) [-413.465] (-417.607) (-410.912) -- 0:00:31

      Average standard deviation of split frequencies: 0.012978

      510500 -- (-413.888) (-415.485) [-410.693] (-412.080) * (-411.179) (-415.836) [-413.129] (-416.455) -- 0:00:31
      511000 -- (-417.332) (-416.315) [-418.041] (-413.420) * (-412.557) (-413.300) (-410.789) [-411.955] -- 0:00:31
      511500 -- (-415.721) (-415.255) [-415.711] (-410.047) * (-417.953) (-415.475) (-411.835) [-413.820] -- 0:00:31
      512000 -- (-418.909) (-414.849) (-417.595) [-410.887] * [-411.403] (-414.750) (-415.793) (-414.756) -- 0:00:31
      512500 -- [-414.670] (-415.087) (-421.744) (-413.467) * [-413.003] (-416.878) (-412.362) (-410.653) -- 0:00:31
      513000 -- (-414.645) (-414.263) [-417.222] (-413.148) * (-416.136) (-416.110) (-411.372) [-413.626] -- 0:00:31
      513500 -- (-417.743) [-415.504] (-417.672) (-413.635) * (-413.451) [-412.759] (-410.666) (-411.323) -- 0:00:32
      514000 -- (-417.904) (-413.571) [-413.925] (-412.413) * [-411.203] (-418.404) (-415.259) (-412.863) -- 0:00:32
      514500 -- (-415.720) (-411.854) (-412.116) [-412.819] * (-418.734) (-415.408) [-410.666] (-411.113) -- 0:00:32
      515000 -- (-419.337) (-414.999) (-412.908) [-410.609] * (-414.807) (-416.449) [-411.338] (-411.625) -- 0:00:32

      Average standard deviation of split frequencies: 0.013166

      515500 -- (-422.085) (-413.314) (-415.526) [-412.515] * (-414.167) (-414.822) (-412.836) [-412.162] -- 0:00:31
      516000 -- (-417.699) (-412.033) (-415.850) [-409.117] * (-412.164) [-411.614] (-412.728) (-411.109) -- 0:00:31
      516500 -- (-415.239) [-412.389] (-417.592) (-411.980) * (-412.398) (-411.690) (-414.325) [-411.251] -- 0:00:31
      517000 -- (-418.763) [-410.817] (-416.531) (-411.715) * [-413.531] (-415.758) (-413.625) (-412.133) -- 0:00:31
      517500 -- (-414.904) (-416.775) (-410.856) [-415.099] * [-413.367] (-416.680) (-413.817) (-412.758) -- 0:00:31
      518000 -- (-412.462) [-415.509] (-414.152) (-416.733) * (-411.835) (-415.771) [-412.181] (-411.680) -- 0:00:31
      518500 -- (-414.379) (-417.675) (-414.332) [-412.609] * (-410.940) [-414.279] (-415.860) (-415.243) -- 0:00:31
      519000 -- (-418.389) [-412.788] (-412.458) (-415.237) * (-416.002) [-417.569] (-416.898) (-412.997) -- 0:00:31
      519500 -- (-415.388) (-415.580) [-414.736] (-413.281) * (-412.726) (-412.327) (-411.826) [-412.508] -- 0:00:31
      520000 -- [-416.223] (-412.828) (-412.026) (-417.627) * [-413.590] (-413.538) (-412.867) (-415.801) -- 0:00:31

      Average standard deviation of split frequencies: 0.012888

      520500 -- (-416.181) [-410.737] (-413.454) (-411.382) * (-414.494) [-413.360] (-418.774) (-416.031) -- 0:00:31
      521000 -- [-415.045] (-411.064) (-416.388) (-410.708) * [-413.535] (-411.663) (-417.579) (-410.365) -- 0:00:31
      521500 -- (-419.823) (-415.438) (-415.059) [-415.015] * [-413.010] (-418.309) (-413.801) (-409.717) -- 0:00:31
      522000 -- (-422.907) (-417.056) [-414.241] (-415.199) * (-417.248) (-414.505) [-414.662] (-413.092) -- 0:00:31
      522500 -- (-420.197) (-418.714) (-415.533) [-414.703] * (-419.561) (-413.758) (-413.699) [-412.405] -- 0:00:31
      523000 -- (-419.055) [-419.451] (-410.699) (-412.263) * (-418.406) (-415.252) (-410.285) [-415.297] -- 0:00:31
      523500 -- (-415.711) [-416.830] (-417.109) (-412.432) * (-417.619) (-413.194) (-409.732) [-412.019] -- 0:00:30
      524000 -- (-413.886) (-410.237) (-410.765) [-410.698] * [-416.824] (-414.871) (-414.762) (-412.104) -- 0:00:30
      524500 -- (-414.031) [-410.926] (-411.425) (-411.843) * (-414.693) [-412.244] (-413.912) (-414.603) -- 0:00:30
      525000 -- (-416.424) (-413.271) (-415.385) [-410.650] * (-416.157) (-416.497) (-410.141) [-413.854] -- 0:00:30

      Average standard deviation of split frequencies: 0.013127

      525500 -- [-416.632] (-414.810) (-414.750) (-412.955) * [-413.681] (-413.843) (-411.084) (-411.077) -- 0:00:30
      526000 -- (-416.285) (-417.144) (-413.659) [-412.121] * (-413.863) (-412.998) [-412.558] (-411.681) -- 0:00:30
      526500 -- (-416.840) (-414.710) (-413.476) [-415.122] * [-412.766] (-412.901) (-413.318) (-411.532) -- 0:00:30
      527000 -- (-419.590) [-415.009] (-408.341) (-411.039) * (-413.171) (-419.457) (-412.620) [-411.369] -- 0:00:30
      527500 -- (-416.466) (-416.687) (-415.523) [-410.802] * (-416.932) [-414.651] (-413.778) (-413.829) -- 0:00:30
      528000 -- (-416.944) (-416.721) (-415.218) [-408.926] * [-418.389] (-412.140) (-414.085) (-412.756) -- 0:00:30
      528500 -- (-415.106) (-415.350) (-411.908) [-411.999] * (-411.594) [-412.647] (-412.796) (-410.365) -- 0:00:30
      529000 -- (-410.982) (-416.213) [-412.709] (-409.880) * (-415.528) [-412.874] (-413.197) (-412.060) -- 0:00:30
      529500 -- (-409.924) (-412.550) [-410.856] (-411.290) * (-415.936) [-410.618] (-414.419) (-417.330) -- 0:00:31
      530000 -- (-413.763) [-410.803] (-411.362) (-409.273) * (-416.273) (-415.890) [-412.792] (-415.713) -- 0:00:31

      Average standard deviation of split frequencies: 0.013168

      530500 -- (-410.897) (-416.363) (-412.972) [-412.281] * [-411.249] (-411.170) (-413.209) (-413.275) -- 0:00:30
      531000 -- [-414.545] (-414.946) (-416.736) (-413.951) * (-417.225) (-414.297) [-411.959] (-411.620) -- 0:00:30
      531500 -- (-413.915) (-416.618) [-411.603] (-415.433) * (-420.066) (-418.762) [-411.953] (-413.830) -- 0:00:30
      532000 -- [-414.166] (-413.439) (-416.950) (-412.768) * (-414.872) (-414.462) [-415.039] (-414.039) -- 0:00:30
      532500 -- (-414.646) (-412.040) (-414.938) [-413.347] * (-413.655) (-417.520) (-414.722) [-412.165] -- 0:00:30
      533000 -- [-415.430] (-415.439) (-412.735) (-416.424) * (-413.667) [-413.344] (-417.483) (-415.226) -- 0:00:30
      533500 -- (-416.537) [-416.982] (-410.759) (-416.102) * (-417.706) (-412.332) (-418.352) [-411.366] -- 0:00:30
      534000 -- (-415.325) [-414.067] (-411.997) (-413.614) * (-410.756) (-416.489) [-415.887] (-416.366) -- 0:00:30
      534500 -- (-417.879) (-416.046) (-410.542) [-412.416] * [-412.232] (-416.642) (-412.286) (-410.651) -- 0:00:30
      535000 -- (-415.793) (-411.946) [-410.988] (-414.346) * (-413.665) (-413.915) [-413.528] (-412.497) -- 0:00:30

      Average standard deviation of split frequencies: 0.012675

      535500 -- (-415.849) (-412.635) [-412.907] (-413.196) * [-413.830] (-410.998) (-416.904) (-412.223) -- 0:00:30
      536000 -- [-415.350] (-414.574) (-413.737) (-419.101) * [-413.401] (-410.763) (-414.575) (-413.091) -- 0:00:30
      536500 -- (-416.289) (-424.040) (-409.172) [-419.780] * (-413.630) (-412.902) (-415.844) [-410.193] -- 0:00:30
      537000 -- (-416.508) (-413.760) [-410.031] (-412.933) * (-415.037) (-412.743) [-412.096] (-411.087) -- 0:00:30
      537500 -- (-416.677) (-415.437) (-415.059) [-414.210] * (-414.791) (-417.165) (-413.450) [-412.461] -- 0:00:30
      538000 -- (-421.185) [-409.348] (-410.320) (-415.139) * [-414.557] (-418.068) (-415.171) (-419.179) -- 0:00:30
      538500 -- (-419.398) [-414.264] (-411.757) (-413.137) * (-414.544) [-413.486] (-416.216) (-411.984) -- 0:00:29
      539000 -- (-415.411) (-417.990) [-409.088] (-410.527) * (-413.360) (-411.205) [-413.389] (-412.092) -- 0:00:29
      539500 -- (-417.554) [-420.584] (-416.055) (-412.209) * (-416.311) (-411.393) [-412.986] (-411.962) -- 0:00:29
      540000 -- (-418.696) (-416.068) [-410.624] (-411.609) * (-414.660) [-411.891] (-412.765) (-411.429) -- 0:00:29

      Average standard deviation of split frequencies: 0.012719

      540500 -- (-411.212) (-417.856) (-413.276) [-412.580] * (-410.249) [-412.633] (-415.788) (-413.874) -- 0:00:29
      541000 -- (-411.877) (-416.564) [-415.453] (-417.126) * (-412.224) [-412.343] (-415.137) (-410.887) -- 0:00:29
      541500 -- (-417.311) (-419.020) (-412.393) [-413.640] * (-413.348) [-411.940] (-417.007) (-411.759) -- 0:00:29
      542000 -- (-414.691) (-413.946) [-412.399] (-409.832) * [-412.728] (-414.020) (-413.499) (-411.783) -- 0:00:29
      542500 -- (-412.824) [-413.632] (-414.132) (-411.595) * (-412.307) [-411.168] (-413.450) (-414.823) -- 0:00:29
      543000 -- (-415.731) (-409.725) (-414.388) [-411.750] * [-412.715] (-413.657) (-415.654) (-413.394) -- 0:00:29
      543500 -- [-413.922] (-412.906) (-414.845) (-411.577) * [-413.687] (-411.774) (-412.250) (-415.936) -- 0:00:29
      544000 -- (-412.633) [-417.284] (-416.675) (-411.586) * [-413.254] (-415.648) (-411.398) (-416.091) -- 0:00:29
      544500 -- [-415.374] (-411.712) (-410.554) (-415.654) * (-416.224) [-411.984] (-413.951) (-414.774) -- 0:00:29
      545000 -- (-413.316) (-419.084) (-410.344) [-410.884] * (-416.060) (-412.148) [-412.789] (-413.547) -- 0:00:30

      Average standard deviation of split frequencies: 0.012494

      545500 -- [-416.370] (-415.026) (-412.512) (-414.172) * [-414.721] (-414.739) (-412.672) (-410.602) -- 0:00:29
      546000 -- (-413.124) [-413.627] (-412.443) (-410.551) * (-413.906) (-410.074) (-421.164) [-409.740] -- 0:00:29
      546500 -- [-413.103] (-413.899) (-412.081) (-411.317) * (-412.553) [-414.519] (-413.408) (-416.166) -- 0:00:29
      547000 -- (-411.712) (-412.793) (-415.509) [-412.825] * (-414.304) [-411.595] (-415.551) (-412.823) -- 0:00:29
      547500 -- (-414.786) [-413.446] (-413.317) (-412.156) * (-413.788) (-417.676) [-412.979] (-411.291) -- 0:00:29
      548000 -- (-415.929) (-417.066) (-414.596) [-417.536] * (-415.122) [-413.390] (-415.222) (-412.042) -- 0:00:29
      548500 -- [-414.569] (-414.340) (-416.115) (-413.770) * (-413.570) [-416.069] (-410.847) (-412.967) -- 0:00:29
      549000 -- (-413.148) [-413.936] (-415.042) (-414.305) * (-415.676) (-414.185) (-414.981) [-411.782] -- 0:00:29
      549500 -- (-415.495) [-410.939] (-414.537) (-415.184) * (-414.057) [-412.552] (-410.511) (-412.003) -- 0:00:29
      550000 -- (-417.083) (-415.030) [-417.922] (-414.302) * (-417.582) [-410.714] (-411.924) (-414.980) -- 0:00:29

      Average standard deviation of split frequencies: 0.012086

      550500 -- (-414.671) [-411.266] (-414.966) (-412.227) * (-418.710) [-412.603] (-412.644) (-410.001) -- 0:00:29
      551000 -- [-415.157] (-409.314) (-416.086) (-410.924) * (-414.076) (-411.826) [-413.396] (-420.330) -- 0:00:29
      551500 -- (-412.702) (-412.365) [-417.631] (-413.405) * (-413.034) [-411.205] (-413.431) (-415.981) -- 0:00:29
      552000 -- [-416.401] (-412.234) (-415.053) (-414.000) * (-417.660) (-411.220) [-415.178] (-415.224) -- 0:00:29
      552500 -- (-414.935) (-410.363) [-414.339] (-413.604) * (-423.887) (-412.724) (-413.699) [-416.803] -- 0:00:29
      553000 -- [-412.674] (-415.098) (-416.209) (-411.148) * (-413.596) (-411.904) [-408.921] (-415.107) -- 0:00:29
      553500 -- (-413.681) [-414.537] (-413.300) (-412.532) * (-415.872) [-412.464] (-412.918) (-420.170) -- 0:00:29
      554000 -- (-414.747) (-416.189) [-412.745] (-412.076) * [-416.781] (-411.976) (-410.606) (-417.174) -- 0:00:28
      554500 -- (-412.068) (-411.665) (-415.196) [-413.903] * (-415.108) (-412.072) (-411.778) [-417.034] -- 0:00:28
      555000 -- [-411.418] (-412.902) (-415.258) (-412.692) * (-413.401) (-416.249) [-411.325] (-417.117) -- 0:00:28

      Average standard deviation of split frequencies: 0.011321

      555500 -- (-411.394) (-415.033) (-412.542) [-411.041] * (-414.728) (-417.131) [-411.470] (-412.718) -- 0:00:28
      556000 -- (-414.923) [-414.862] (-413.538) (-415.199) * (-415.793) (-415.690) [-412.181] (-416.814) -- 0:00:28
      556500 -- [-414.496] (-413.176) (-415.629) (-415.814) * (-416.252) (-415.177) (-413.583) [-409.801] -- 0:00:28
      557000 -- (-413.118) (-414.151) (-411.186) [-412.496] * (-413.896) [-413.237] (-413.461) (-420.472) -- 0:00:28
      557500 -- (-416.381) [-411.000] (-420.775) (-411.076) * [-414.726] (-417.511) (-414.507) (-413.902) -- 0:00:28
      558000 -- (-413.548) (-410.804) (-418.187) [-412.083] * [-414.718] (-417.251) (-413.729) (-415.776) -- 0:00:28
      558500 -- [-414.898] (-411.413) (-414.206) (-412.151) * [-413.934] (-414.665) (-411.933) (-416.323) -- 0:00:28
      559000 -- [-415.773] (-416.861) (-415.871) (-413.394) * (-413.608) (-413.685) (-418.207) [-411.918] -- 0:00:28
      559500 -- (-413.838) [-411.198] (-413.700) (-413.484) * [-414.706] (-413.502) (-414.457) (-415.284) -- 0:00:28
      560000 -- (-411.974) [-409.920] (-418.346) (-412.121) * (-418.213) (-412.480) (-412.977) [-412.730] -- 0:00:28

      Average standard deviation of split frequencies: 0.011722

      560500 -- (-411.978) [-413.516] (-418.239) (-410.083) * (-417.377) (-417.352) (-413.617) [-415.076] -- 0:00:28
      561000 -- (-412.425) (-411.974) [-414.159] (-418.784) * (-412.396) [-410.682] (-416.668) (-410.645) -- 0:00:28
      561500 -- (-412.043) [-411.652] (-415.963) (-412.064) * (-411.473) [-412.955] (-417.547) (-414.860) -- 0:00:28
      562000 -- (-414.829) [-411.147] (-416.326) (-415.168) * (-418.574) [-413.074] (-413.512) (-416.245) -- 0:00:28
      562500 -- (-414.128) [-410.200] (-416.269) (-414.631) * (-414.707) (-414.110) [-412.243] (-414.607) -- 0:00:28
      563000 -- (-411.702) [-410.649] (-416.003) (-414.585) * [-414.342] (-412.508) (-410.220) (-414.130) -- 0:00:28
      563500 -- (-411.350) (-411.569) (-414.981) [-416.879] * [-413.473] (-415.468) (-413.939) (-418.881) -- 0:00:28
      564000 -- [-414.036] (-413.423) (-420.362) (-414.589) * (-415.136) (-415.226) [-413.332] (-413.752) -- 0:00:28
      564500 -- (-417.556) (-410.604) [-413.631] (-414.264) * (-411.395) (-412.791) (-413.869) [-414.042] -- 0:00:28
      565000 -- (-412.279) (-412.483) [-414.016] (-415.051) * (-413.094) (-415.242) (-414.773) [-412.224] -- 0:00:28

      Average standard deviation of split frequencies: 0.011954

      565500 -- [-410.628] (-411.607) (-419.275) (-410.875) * (-413.920) [-413.234] (-425.583) (-411.451) -- 0:00:28
      566000 -- (-414.474) [-411.384] (-417.104) (-420.400) * (-417.468) [-411.622] (-418.274) (-415.717) -- 0:00:28
      566500 -- (-413.504) [-410.880] (-415.682) (-410.362) * (-414.796) (-413.672) [-409.920] (-414.384) -- 0:00:28
      567000 -- [-414.593] (-409.889) (-417.583) (-410.400) * (-414.987) (-412.095) [-415.224] (-412.200) -- 0:00:28
      567500 -- (-413.033) (-414.445) (-415.173) [-410.254] * (-419.599) (-414.199) [-413.232] (-411.881) -- 0:00:28
      568000 -- [-412.822] (-414.555) (-416.445) (-413.633) * (-413.724) (-416.544) (-418.172) [-412.228] -- 0:00:28
      568500 -- (-413.560) (-413.553) (-415.924) [-414.530] * (-418.326) (-410.277) (-413.161) [-415.902] -- 0:00:28
      569000 -- (-415.845) [-415.962] (-413.160) (-410.624) * (-416.044) (-414.408) [-413.086] (-416.104) -- 0:00:28
      569500 -- (-415.052) (-417.869) [-411.891] (-410.116) * (-415.250) (-415.012) [-412.300] (-413.368) -- 0:00:27
      570000 -- (-411.578) [-411.512] (-412.492) (-410.155) * (-413.089) [-413.180] (-417.194) (-417.426) -- 0:00:27

      Average standard deviation of split frequencies: 0.011662

      570500 -- (-413.382) [-411.222] (-412.003) (-414.209) * (-413.035) [-410.784] (-411.341) (-415.518) -- 0:00:27
      571000 -- [-418.356] (-413.470) (-412.795) (-411.491) * (-416.447) (-412.028) [-413.041] (-412.206) -- 0:00:27
      571500 -- (-412.542) [-412.689] (-411.251) (-410.316) * (-419.800) [-411.039] (-412.814) (-413.794) -- 0:00:27
      572000 -- (-410.814) [-411.680] (-420.098) (-413.567) * [-413.565] (-412.805) (-412.784) (-411.155) -- 0:00:27
      572500 -- [-412.673] (-412.064) (-415.456) (-413.961) * (-416.794) (-410.907) (-415.389) [-416.998] -- 0:00:27
      573000 -- (-416.189) [-412.257] (-412.589) (-410.169) * (-416.442) (-412.527) [-412.046] (-414.504) -- 0:00:27
      573500 -- (-413.859) (-412.424) (-412.056) [-411.701] * (-415.162) (-414.852) (-416.402) [-413.806] -- 0:00:27
      574000 -- (-415.235) (-411.680) [-413.230] (-410.721) * (-414.801) [-410.220] (-417.822) (-411.861) -- 0:00:27
      574500 -- [-412.687] (-411.793) (-409.696) (-410.757) * (-413.882) (-414.874) [-408.415] (-411.614) -- 0:00:27
      575000 -- (-412.396) (-411.853) (-409.690) [-410.761] * (-414.045) (-415.913) [-411.058] (-412.674) -- 0:00:27

      Average standard deviation of split frequencies: 0.011891

      575500 -- (-414.317) (-411.658) [-413.765] (-412.447) * (-419.153) (-413.238) (-413.131) [-414.297] -- 0:00:27
      576000 -- (-410.177) (-410.576) (-412.903) [-413.680] * (-414.099) [-415.290] (-418.180) (-413.088) -- 0:00:27
      576500 -- (-414.176) [-418.032] (-411.850) (-417.246) * (-415.937) (-413.328) [-412.210] (-418.702) -- 0:00:27
      577000 -- [-413.776] (-413.875) (-410.736) (-416.296) * (-415.662) (-417.189) (-412.471) [-412.944] -- 0:00:27
      577500 -- (-415.959) (-413.643) [-413.783] (-411.805) * (-422.146) (-417.519) (-415.516) [-418.790] -- 0:00:27
      578000 -- (-419.559) (-413.990) (-414.455) [-412.364] * [-415.456] (-415.680) (-415.416) (-418.438) -- 0:00:27
      578500 -- (-413.690) (-416.782) (-413.743) [-412.535] * (-417.830) [-412.230] (-411.573) (-415.883) -- 0:00:27
      579000 -- [-415.239] (-416.385) (-414.497) (-416.396) * (-416.070) [-414.360] (-415.426) (-413.541) -- 0:00:27
      579500 -- (-419.536) (-417.172) [-412.929] (-412.839) * [-413.888] (-414.468) (-412.008) (-416.761) -- 0:00:27
      580000 -- [-411.204] (-413.012) (-415.235) (-420.589) * (-418.968) [-412.839] (-416.656) (-414.848) -- 0:00:27

      Average standard deviation of split frequencies: 0.011366

      580500 -- (-414.029) (-411.218) (-410.967) [-411.805] * [-416.857] (-411.110) (-414.990) (-416.676) -- 0:00:27
      581000 -- (-413.764) (-411.163) (-414.994) [-414.526] * [-416.349] (-413.516) (-413.243) (-414.418) -- 0:00:27
      581500 -- (-412.356) (-411.748) [-412.988] (-417.598) * (-420.269) (-413.907) [-411.371] (-416.149) -- 0:00:27
      582000 -- [-411.477] (-410.481) (-411.174) (-413.750) * (-414.704) (-414.778) [-412.334] (-413.606) -- 0:00:27
      582500 -- [-409.143] (-411.556) (-413.947) (-411.001) * (-415.907) (-414.907) [-411.075] (-412.279) -- 0:00:27
      583000 -- [-412.273] (-414.273) (-416.216) (-414.673) * (-417.394) [-411.794] (-412.951) (-413.034) -- 0:00:27
      583500 -- [-412.273] (-414.064) (-411.392) (-414.848) * (-415.836) (-414.574) (-413.065) [-413.329] -- 0:00:27
      584000 -- [-414.217] (-413.610) (-410.391) (-414.467) * (-414.963) (-416.274) [-416.022] (-412.534) -- 0:00:27
      584500 -- [-418.776] (-413.024) (-411.529) (-414.951) * (-415.307) (-416.130) [-415.997] (-411.938) -- 0:00:27
      585000 -- (-414.995) (-412.735) [-417.379] (-418.604) * (-421.069) (-412.337) (-413.615) [-412.621] -- 0:00:26

      Average standard deviation of split frequencies: 0.010637

      585500 -- (-411.687) (-412.924) [-408.788] (-412.379) * (-416.602) (-416.403) (-413.491) [-414.825] -- 0:00:26
      586000 -- [-412.639] (-412.397) (-412.463) (-416.924) * [-416.095] (-411.086) (-419.994) (-419.742) -- 0:00:26
      586500 -- (-414.220) [-411.419] (-412.402) (-414.604) * [-414.078] (-418.505) (-412.624) (-415.053) -- 0:00:26
      587000 -- [-414.759] (-416.516) (-411.807) (-414.696) * (-410.967) (-418.595) (-413.450) [-410.267] -- 0:00:26
      587500 -- (-416.466) [-414.284] (-411.057) (-411.526) * (-415.751) (-410.445) [-413.889] (-411.677) -- 0:00:26
      588000 -- (-417.965) (-415.914) (-413.422) [-412.113] * (-412.798) [-411.974] (-412.715) (-414.125) -- 0:00:26
      588500 -- (-413.621) (-413.467) [-411.751] (-414.330) * (-412.970) (-413.383) [-411.430] (-417.592) -- 0:00:26
      589000 -- (-413.731) (-413.558) (-411.178) [-416.958] * (-413.203) (-413.184) (-411.497) [-417.203] -- 0:00:26
      589500 -- (-416.361) [-413.540] (-412.831) (-412.791) * [-413.578] (-411.892) (-411.541) (-416.447) -- 0:00:26
      590000 -- [-412.333] (-410.966) (-411.301) (-415.308) * (-413.652) (-416.175) [-411.185] (-413.676) -- 0:00:26

      Average standard deviation of split frequencies: 0.010422

      590500 -- [-414.567] (-412.416) (-413.175) (-419.735) * [-412.590] (-413.821) (-414.870) (-414.586) -- 0:00:26
      591000 -- (-411.224) [-414.847] (-416.759) (-416.700) * (-419.099) (-418.085) [-412.429] (-410.409) -- 0:00:26
      591500 -- (-413.157) (-412.477) [-411.084] (-414.864) * (-418.919) (-413.195) (-411.579) [-413.355] -- 0:00:26
      592000 -- (-416.872) (-417.311) (-418.795) [-414.008] * (-412.512) (-413.487) (-412.888) [-411.058] -- 0:00:26
      592500 -- (-416.197) (-413.300) (-414.968) [-414.188] * (-414.453) (-414.154) (-413.945) [-413.211] -- 0:00:26
      593000 -- [-414.126] (-415.494) (-414.638) (-415.314) * [-413.345] (-418.150) (-410.993) (-411.513) -- 0:00:26
      593500 -- (-414.379) (-413.432) (-412.807) [-412.547] * [-410.372] (-409.575) (-413.831) (-414.598) -- 0:00:26
      594000 -- (-412.956) (-416.104) [-410.601] (-417.162) * (-416.632) (-415.144) [-413.379] (-412.794) -- 0:00:26
      594500 -- (-411.698) [-414.008] (-414.190) (-415.886) * (-414.169) [-416.102] (-411.316) (-414.244) -- 0:00:26
      595000 -- (-411.900) [-417.477] (-414.795) (-419.723) * (-414.699) [-414.667] (-411.778) (-413.151) -- 0:00:26

      Average standard deviation of split frequencies: 0.010282

      595500 -- (-412.629) (-413.364) (-415.076) [-415.902] * (-419.046) [-417.328] (-414.620) (-414.152) -- 0:00:26
      596000 -- (-416.435) (-411.530) [-412.042] (-417.152) * (-423.858) [-412.718] (-412.616) (-411.333) -- 0:00:26
      596500 -- (-412.966) [-414.295] (-412.017) (-419.299) * [-414.076] (-411.829) (-411.508) (-411.681) -- 0:00:26
      597000 -- (-411.478) (-416.358) [-414.835] (-416.623) * [-415.619] (-416.137) (-414.884) (-414.604) -- 0:00:26
      597500 -- [-414.940] (-414.168) (-416.237) (-413.788) * (-417.315) (-414.724) (-411.623) [-412.298] -- 0:00:26
      598000 -- [-410.544] (-410.958) (-411.916) (-414.348) * [-415.616] (-413.387) (-413.906) (-418.398) -- 0:00:26
      598500 -- (-414.274) (-415.474) [-417.295] (-413.012) * (-416.550) [-411.219] (-413.213) (-414.067) -- 0:00:26
      599000 -- (-413.890) [-410.195] (-413.687) (-412.305) * (-415.122) (-414.734) (-415.243) [-417.048] -- 0:00:26
      599500 -- (-415.120) [-415.826] (-414.634) (-412.261) * (-415.466) (-413.335) [-412.157] (-411.722) -- 0:00:26
      600000 -- (-415.464) [-412.822] (-413.717) (-415.203) * (-416.892) [-414.026] (-411.633) (-415.769) -- 0:00:25

      Average standard deviation of split frequencies: 0.010664

      600500 -- (-416.432) [-412.256] (-414.785) (-414.266) * (-413.932) [-413.067] (-416.483) (-413.575) -- 0:00:25
      601000 -- (-418.447) (-412.423) (-413.325) [-413.910] * [-416.337] (-412.497) (-410.890) (-412.955) -- 0:00:25
      601500 -- (-412.746) (-420.475) (-415.502) [-412.671] * (-415.313) (-413.564) (-413.507) [-414.500] -- 0:00:25
      602000 -- (-412.572) (-416.546) [-416.214] (-415.650) * [-412.842] (-410.886) (-413.317) (-419.562) -- 0:00:25
      602500 -- (-416.323) [-416.211] (-411.466) (-421.037) * (-419.867) [-415.324] (-413.510) (-416.910) -- 0:00:25
      603000 -- (-414.296) [-410.879] (-415.698) (-418.652) * (-415.082) [-414.486] (-415.477) (-413.968) -- 0:00:25
      603500 -- [-411.821] (-414.084) (-414.945) (-416.582) * (-415.644) [-412.602] (-415.765) (-413.335) -- 0:00:25
      604000 -- (-413.201) (-413.052) (-412.275) [-411.115] * (-415.695) (-414.639) (-413.897) [-413.847] -- 0:00:25
      604500 -- [-410.320] (-419.284) (-415.046) (-413.596) * (-413.136) [-413.047] (-412.770) (-413.397) -- 0:00:25
      605000 -- (-417.449) (-412.682) [-409.986] (-410.445) * (-413.948) (-414.304) [-413.579] (-412.388) -- 0:00:25

      Average standard deviation of split frequencies: 0.010707

      605500 -- (-409.626) (-412.374) [-412.525] (-417.237) * (-417.046) (-411.891) [-412.221] (-414.664) -- 0:00:25
      606000 -- (-414.071) (-413.136) [-414.937] (-414.826) * (-415.906) (-414.231) [-410.877] (-412.943) -- 0:00:25
      606500 -- [-413.929] (-412.222) (-414.750) (-415.243) * (-416.007) (-415.561) [-414.088] (-414.103) -- 0:00:25
      607000 -- [-414.631] (-414.138) (-414.451) (-412.595) * (-412.332) [-411.652] (-415.348) (-415.289) -- 0:00:25
      607500 -- (-418.835) (-416.128) (-413.236) [-412.610] * [-412.248] (-414.971) (-414.373) (-418.477) -- 0:00:25
      608000 -- (-421.731) (-417.787) [-411.202] (-414.259) * (-414.749) [-411.232] (-413.208) (-415.064) -- 0:00:25
      608500 -- [-413.200] (-416.756) (-411.683) (-412.187) * (-416.957) (-414.492) [-413.977] (-414.570) -- 0:00:25
      609000 -- (-415.508) (-412.974) [-415.370] (-416.436) * (-412.345) (-415.228) [-410.724] (-413.552) -- 0:00:25
      609500 -- (-416.099) [-412.915] (-420.694) (-415.982) * [-410.433] (-412.258) (-412.743) (-413.128) -- 0:00:25
      610000 -- [-414.274] (-411.380) (-414.098) (-417.991) * (-413.619) (-414.625) [-411.800] (-416.099) -- 0:00:25

      Average standard deviation of split frequencies: 0.010626

      610500 -- [-415.996] (-413.797) (-415.118) (-416.353) * (-412.654) (-415.630) [-410.255] (-414.259) -- 0:00:25
      611000 -- (-416.746) (-418.668) [-412.637] (-413.686) * (-414.377) (-412.950) [-412.153] (-415.595) -- 0:00:25
      611500 -- [-413.525] (-417.495) (-414.932) (-414.266) * (-411.241) (-410.738) [-418.058] (-415.386) -- 0:00:25
      612000 -- [-415.438] (-413.234) (-413.113) (-416.113) * (-412.606) [-416.751] (-412.041) (-413.413) -- 0:00:25
      612500 -- (-414.965) (-413.611) (-414.018) [-412.397] * (-415.508) [-415.210] (-411.311) (-417.073) -- 0:00:25
      613000 -- [-414.856] (-414.356) (-419.328) (-419.864) * (-411.545) [-411.986] (-415.128) (-413.911) -- 0:00:25
      613500 -- (-414.028) (-413.739) (-415.819) [-414.975] * (-413.208) (-414.786) (-414.996) [-410.807] -- 0:00:25
      614000 -- (-416.382) (-411.359) [-419.422] (-417.246) * (-415.754) (-412.777) (-414.526) [-414.479] -- 0:00:25
      614500 -- [-417.380] (-415.500) (-415.789) (-417.129) * (-417.777) (-413.186) [-414.235] (-413.228) -- 0:00:25
      615000 -- (-414.831) (-415.088) (-415.761) [-414.571] * (-410.116) [-413.224] (-411.541) (-413.386) -- 0:00:25

      Average standard deviation of split frequencies: 0.010894

      615500 -- (-413.146) (-414.638) [-412.534] (-419.882) * (-412.740) (-413.791) [-415.122] (-415.761) -- 0:00:24
      616000 -- (-414.330) [-412.747] (-415.118) (-419.805) * [-415.881] (-414.458) (-414.535) (-414.697) -- 0:00:24
      616500 -- (-420.154) [-416.972] (-417.395) (-413.576) * (-412.353) [-411.102] (-417.273) (-417.264) -- 0:00:24
      617000 -- [-415.727] (-414.458) (-416.109) (-415.358) * (-411.435) (-412.637) [-412.851] (-414.801) -- 0:00:24
      617500 -- (-417.423) (-415.172) [-412.132] (-412.833) * (-416.700) [-408.756] (-412.585) (-413.419) -- 0:00:24
      618000 -- (-412.707) (-412.941) [-414.676] (-415.789) * (-416.909) [-411.023] (-414.817) (-416.815) -- 0:00:24
      618500 -- (-414.610) [-410.940] (-417.989) (-420.300) * (-415.063) (-411.757) (-415.757) [-412.772] -- 0:00:24
      619000 -- (-415.251) (-412.315) [-415.266] (-412.916) * (-412.855) [-411.943] (-418.269) (-416.428) -- 0:00:24
      619500 -- (-415.229) (-416.542) [-415.243] (-416.471) * [-409.590] (-415.517) (-414.528) (-416.940) -- 0:00:24
      620000 -- [-415.136] (-413.858) (-417.969) (-414.197) * (-411.605) (-413.770) [-411.656] (-415.551) -- 0:00:24

      Average standard deviation of split frequencies: 0.010946

      620500 -- (-413.749) (-410.738) [-413.706] (-414.180) * (-414.063) (-412.945) (-413.410) [-413.070] -- 0:00:24
      621000 -- (-413.401) (-412.927) (-414.578) [-412.531] * (-410.530) [-413.102] (-417.642) (-414.815) -- 0:00:24
      621500 -- (-415.120) (-414.080) (-413.642) [-414.459] * (-413.568) (-414.246) (-418.081) [-414.849] -- 0:00:24
      622000 -- (-417.178) [-413.936] (-414.182) (-412.020) * [-413.497] (-412.134) (-418.694) (-419.429) -- 0:00:24
      622500 -- (-413.228) [-421.244] (-416.350) (-416.000) * [-412.749] (-412.952) (-415.891) (-417.801) -- 0:00:24
      623000 -- (-419.262) (-416.392) [-415.324] (-414.347) * (-412.696) (-410.184) [-413.071] (-413.526) -- 0:00:24
      623500 -- (-414.228) (-416.463) [-412.642] (-415.780) * (-414.494) (-413.305) [-414.874] (-415.782) -- 0:00:24
      624000 -- (-417.374) (-415.607) (-419.058) [-414.604] * (-413.071) (-410.882) (-415.041) [-413.870] -- 0:00:24
      624500 -- (-412.913) [-410.898] (-417.490) (-413.150) * (-414.095) [-411.872] (-415.396) (-415.545) -- 0:00:24
      625000 -- (-412.409) [-412.098] (-416.024) (-412.223) * (-414.858) [-410.161] (-415.348) (-418.404) -- 0:00:24

      Average standard deviation of split frequencies: 0.011163

      625500 -- [-411.643] (-412.696) (-418.449) (-415.441) * (-411.214) [-413.748] (-417.454) (-413.677) -- 0:00:24
      626000 -- (-412.120) (-415.799) [-416.013] (-414.475) * (-413.905) [-412.540] (-415.380) (-414.217) -- 0:00:24
      626500 -- (-411.827) (-413.817) [-412.153] (-416.783) * [-412.702] (-413.140) (-416.828) (-410.863) -- 0:00:24
      627000 -- (-418.979) (-412.762) [-416.693] (-414.871) * (-412.800) (-411.485) (-413.535) [-415.422] -- 0:00:24
      627500 -- (-412.895) (-415.620) (-415.512) [-415.145] * (-411.705) [-414.171] (-412.136) (-413.951) -- 0:00:24
      628000 -- [-414.136] (-415.192) (-418.637) (-410.480) * (-411.996) (-412.070) [-415.503] (-414.602) -- 0:00:24
      628500 -- (-414.298) [-418.892] (-415.567) (-419.121) * (-411.492) [-408.920] (-414.029) (-411.822) -- 0:00:24
      629000 -- (-416.751) (-415.229) (-413.998) [-414.754] * (-411.990) (-411.636) [-413.104] (-414.490) -- 0:00:24
      629500 -- [-413.986] (-415.493) (-414.549) (-411.764) * [-409.246] (-412.164) (-412.521) (-420.330) -- 0:00:24
      630000 -- (-413.825) (-411.542) (-417.308) [-414.326] * (-411.158) [-409.747] (-414.708) (-419.952) -- 0:00:24

      Average standard deviation of split frequencies: 0.011828

      630500 -- [-412.738] (-416.606) (-413.879) (-414.080) * (-411.981) (-412.144) (-416.276) [-418.667] -- 0:00:24
      631000 -- (-415.473) (-417.811) [-417.311] (-414.395) * [-415.409] (-415.057) (-412.181) (-412.997) -- 0:00:23
      631500 -- (-413.969) (-416.881) [-414.552] (-418.103) * (-413.180) (-413.735) [-413.823] (-416.089) -- 0:00:23
      632000 -- (-416.443) (-414.812) [-414.371] (-418.095) * (-412.116) (-413.358) [-412.055] (-409.512) -- 0:00:23
      632500 -- (-414.081) [-410.330] (-416.650) (-416.084) * (-412.218) [-412.370] (-414.098) (-413.391) -- 0:00:23
      633000 -- (-413.823) (-415.730) (-414.399) [-414.841] * [-413.602] (-415.178) (-412.097) (-419.390) -- 0:00:23
      633500 -- (-416.071) [-422.433] (-416.993) (-413.210) * (-415.215) (-411.920) (-412.987) [-412.458] -- 0:00:23
      634000 -- (-417.154) [-419.211] (-413.998) (-413.282) * (-414.299) [-410.759] (-413.192) (-414.153) -- 0:00:23
      634500 -- (-417.514) (-413.625) (-414.736) [-411.875] * [-415.708] (-412.747) (-415.047) (-417.640) -- 0:00:23
      635000 -- (-419.623) [-413.882] (-418.450) (-418.347) * (-413.202) (-412.576) [-413.558] (-414.532) -- 0:00:23

      Average standard deviation of split frequencies: 0.011772

      635500 -- (-415.008) (-416.215) [-412.589] (-418.042) * (-413.721) [-418.424] (-413.667) (-416.249) -- 0:00:23
      636000 -- (-415.050) (-418.047) [-410.394] (-415.073) * (-416.754) (-413.558) (-417.659) [-413.571] -- 0:00:23
      636500 -- (-413.653) (-410.661) [-413.566] (-414.279) * (-413.808) (-412.903) [-416.920] (-413.153) -- 0:00:23
      637000 -- (-413.012) [-416.600] (-420.425) (-412.290) * (-413.570) (-416.367) [-412.561] (-413.739) -- 0:00:23
      637500 -- [-412.938] (-412.943) (-415.562) (-416.866) * (-411.279) [-418.631] (-411.102) (-421.335) -- 0:00:23
      638000 -- (-413.701) (-412.205) [-413.935] (-412.172) * (-412.499) (-413.730) [-414.013] (-413.419) -- 0:00:23
      638500 -- (-414.250) (-414.474) (-413.950) [-416.031] * [-412.176] (-413.698) (-413.110) (-415.760) -- 0:00:23
      639000 -- (-416.074) (-414.891) (-411.640) [-411.836] * [-413.589] (-412.761) (-411.135) (-416.830) -- 0:00:23
      639500 -- (-418.025) [-413.898] (-411.829) (-413.772) * [-410.148] (-414.877) (-410.394) (-414.017) -- 0:00:23
      640000 -- (-413.324) (-411.850) [-412.570] (-412.986) * (-411.760) (-412.394) [-412.425] (-412.534) -- 0:00:23

      Average standard deviation of split frequencies: 0.011129

      640500 -- [-413.564] (-414.411) (-413.717) (-416.539) * [-411.429] (-411.222) (-416.451) (-413.019) -- 0:00:23
      641000 -- (-418.051) (-414.231) [-412.611] (-415.264) * (-413.861) (-411.332) [-413.470] (-411.694) -- 0:00:23
      641500 -- (-417.624) (-411.557) [-412.850] (-416.223) * (-413.057) (-413.891) (-415.655) [-416.781] -- 0:00:23
      642000 -- [-415.227] (-412.133) (-412.556) (-415.588) * [-410.767] (-413.381) (-418.396) (-414.995) -- 0:00:23
      642500 -- (-414.343) (-412.432) [-411.838] (-412.645) * (-413.219) (-411.974) [-413.277] (-413.507) -- 0:00:23
      643000 -- [-415.140] (-420.595) (-413.379) (-414.516) * (-413.532) [-411.189] (-415.591) (-416.340) -- 0:00:23
      643500 -- (-418.993) [-415.026] (-413.118) (-413.199) * [-412.434] (-411.578) (-415.161) (-412.860) -- 0:00:23
      644000 -- (-415.952) (-416.720) [-411.606] (-412.446) * (-413.327) (-413.640) (-413.526) [-413.300] -- 0:00:23
      644500 -- (-417.274) (-413.839) [-410.522] (-416.676) * (-414.130) [-413.096] (-414.252) (-413.782) -- 0:00:23
      645000 -- (-416.057) (-412.452) [-411.100] (-409.174) * (-412.592) (-411.692) [-414.750] (-414.436) -- 0:00:23

      Average standard deviation of split frequencies: 0.011083

      645500 -- (-416.233) (-415.824) [-413.071] (-412.837) * [-409.608] (-412.082) (-416.166) (-412.432) -- 0:00:23
      646000 -- (-412.701) (-416.581) (-414.521) [-413.945] * (-412.479) [-415.981] (-413.547) (-413.969) -- 0:00:23
      646500 -- (-415.424) (-416.799) (-412.806) [-410.572] * (-412.989) (-412.999) (-417.862) [-412.566] -- 0:00:22
      647000 -- [-414.977] (-416.263) (-413.391) (-413.561) * (-412.703) (-412.037) (-413.463) [-414.519] -- 0:00:22
      647500 -- [-415.599] (-416.175) (-418.265) (-416.483) * (-414.457) [-410.697] (-412.784) (-412.097) -- 0:00:22
      648000 -- (-413.841) (-414.127) (-414.031) [-410.715] * (-409.437) [-411.852] (-413.517) (-412.452) -- 0:00:22
      648500 -- [-414.607] (-413.269) (-414.102) (-414.325) * [-409.727] (-412.302) (-415.741) (-412.656) -- 0:00:22
      649000 -- (-418.190) (-415.651) (-410.411) [-412.952] * (-410.145) (-411.911) (-415.014) [-410.777] -- 0:00:22
      649500 -- (-412.342) (-418.053) (-414.060) [-414.026] * [-414.183] (-414.897) (-419.643) (-414.947) -- 0:00:22
      650000 -- (-415.629) (-420.491) (-415.577) [-412.879] * (-414.300) [-409.897] (-412.751) (-414.181) -- 0:00:22

      Average standard deviation of split frequencies: 0.010867

      650500 -- (-416.397) (-415.132) (-416.189) [-413.882] * (-412.725) [-413.027] (-411.550) (-414.043) -- 0:00:22
      651000 -- (-413.656) (-415.252) (-413.927) [-413.996] * (-410.973) (-413.354) (-413.901) [-413.962] -- 0:00:22
      651500 -- (-415.580) [-416.654] (-416.181) (-414.542) * (-417.421) [-412.643] (-414.922) (-414.343) -- 0:00:22
      652000 -- [-416.072] (-416.858) (-411.891) (-413.990) * [-413.157] (-413.262) (-414.819) (-413.113) -- 0:00:22
      652500 -- (-411.890) (-416.284) [-412.071] (-417.593) * (-412.950) [-410.042] (-415.986) (-416.578) -- 0:00:22
      653000 -- (-412.141) (-412.844) (-413.564) [-412.440] * (-412.715) [-410.448] (-414.906) (-411.852) -- 0:00:22
      653500 -- (-412.906) (-420.426) (-412.953) [-413.213] * [-413.308] (-415.514) (-417.400) (-415.956) -- 0:00:22
      654000 -- (-414.567) (-412.663) [-410.002] (-414.110) * (-410.336) (-410.335) (-418.000) [-415.283] -- 0:00:22
      654500 -- (-413.813) (-416.598) [-417.524] (-417.227) * (-412.576) [-410.832] (-415.439) (-414.991) -- 0:00:22
      655000 -- (-413.235) (-415.857) [-412.685] (-414.418) * (-415.343) (-411.803) (-417.956) [-415.380] -- 0:00:22

      Average standard deviation of split frequencies: 0.011667

      655500 -- (-411.750) (-412.499) (-417.189) [-411.919] * (-412.314) [-410.294] (-413.783) (-411.692) -- 0:00:22
      656000 -- (-412.164) (-414.455) [-413.747] (-419.758) * (-414.342) [-410.534] (-417.240) (-415.691) -- 0:00:22
      656500 -- (-413.583) [-412.462] (-412.164) (-415.993) * [-414.037] (-414.267) (-420.517) (-413.987) -- 0:00:22
      657000 -- (-412.679) (-411.106) (-412.707) [-413.271] * (-410.922) [-412.939] (-415.119) (-412.398) -- 0:00:22
      657500 -- (-413.806) (-418.127) [-412.620] (-416.906) * [-413.647] (-411.000) (-415.884) (-415.117) -- 0:00:22
      658000 -- (-415.551) [-413.578] (-411.511) (-416.761) * (-410.954) (-412.832) [-412.367] (-413.604) -- 0:00:22
      658500 -- [-413.767] (-415.423) (-413.066) (-411.857) * (-412.059) (-412.767) (-413.870) [-415.278] -- 0:00:22
      659000 -- (-414.285) (-412.074) [-412.683] (-411.691) * (-413.597) [-409.581] (-416.076) (-416.893) -- 0:00:22
      659500 -- (-415.760) (-413.255) [-410.529] (-414.215) * (-421.036) (-413.234) [-412.381] (-411.353) -- 0:00:22
      660000 -- (-417.302) [-413.561] (-411.925) (-416.582) * [-412.527] (-412.261) (-416.275) (-412.593) -- 0:00:22

      Average standard deviation of split frequencies: 0.011836

      660500 -- (-413.718) (-415.531) (-415.673) [-411.842] * (-415.310) (-411.348) [-414.488] (-413.132) -- 0:00:22
      661000 -- (-413.922) (-411.657) (-413.393) [-413.512] * (-414.158) (-410.775) (-415.289) [-409.856] -- 0:00:22
      661500 -- (-416.102) [-409.453] (-412.985) (-412.176) * [-414.312] (-416.993) (-414.424) (-412.475) -- 0:00:22
      662000 -- (-416.648) (-410.780) [-414.815] (-414.396) * (-418.700) (-412.438) [-413.597] (-410.840) -- 0:00:21
      662500 -- (-411.332) [-413.739] (-412.435) (-419.482) * (-414.518) (-410.530) [-413.732] (-412.244) -- 0:00:21
      663000 -- (-412.566) (-412.374) (-411.442) [-418.070] * [-410.107] (-411.592) (-416.944) (-410.668) -- 0:00:21
      663500 -- (-413.031) [-413.518] (-415.903) (-412.070) * (-415.221) (-410.680) (-415.904) [-411.840] -- 0:00:21
      664000 -- [-410.977] (-410.396) (-413.308) (-418.614) * (-412.907) (-415.473) (-416.390) [-412.321] -- 0:00:21
      664500 -- (-412.966) (-415.717) [-413.891] (-417.431) * [-414.049] (-412.776) (-415.080) (-414.515) -- 0:00:21
      665000 -- (-413.719) [-415.037] (-416.943) (-413.851) * (-417.280) (-414.252) [-416.804] (-413.621) -- 0:00:21

      Average standard deviation of split frequencies: 0.011492

      665500 -- (-414.790) (-414.346) [-418.767] (-412.234) * (-417.578) (-416.762) (-411.737) [-411.722] -- 0:00:21
      666000 -- [-414.838] (-411.229) (-413.759) (-412.898) * [-415.323] (-412.440) (-418.496) (-410.505) -- 0:00:21
      666500 -- (-414.182) [-411.384] (-412.118) (-414.080) * [-413.257] (-413.449) (-415.504) (-418.231) -- 0:00:21
      667000 -- (-414.180) [-415.320] (-416.207) (-415.269) * (-416.727) (-410.857) (-418.981) [-414.513] -- 0:00:21
      667500 -- (-415.845) (-414.952) (-416.319) [-412.974] * (-413.579) (-410.692) [-413.859] (-420.489) -- 0:00:21
      668000 -- (-413.633) (-414.211) [-412.523] (-415.488) * (-411.080) (-415.542) (-416.134) [-414.375] -- 0:00:21
      668500 -- [-414.107] (-414.513) (-414.035) (-416.616) * (-414.317) [-411.847] (-415.604) (-418.285) -- 0:00:21
      669000 -- (-412.492) (-412.632) [-412.390] (-413.805) * (-411.958) (-412.817) [-416.940] (-419.968) -- 0:00:21
      669500 -- (-413.590) (-410.149) [-413.190] (-412.903) * (-413.839) [-411.035] (-414.958) (-413.025) -- 0:00:21
      670000 -- (-412.934) [-414.457] (-415.652) (-413.540) * (-415.004) [-411.697] (-414.778) (-412.491) -- 0:00:21

      Average standard deviation of split frequencies: 0.011577

      670500 -- (-412.627) [-411.779] (-412.324) (-415.123) * (-413.852) (-413.227) (-416.046) [-413.315] -- 0:00:21
      671000 -- (-415.442) [-415.086] (-415.121) (-414.698) * (-419.108) (-418.120) [-411.974] (-418.015) -- 0:00:21
      671500 -- (-411.232) (-416.897) (-411.328) [-416.704] * (-415.099) [-415.855] (-415.173) (-418.333) -- 0:00:21
      672000 -- (-411.440) (-417.699) [-412.638] (-416.000) * (-414.790) (-413.951) (-413.077) [-416.163] -- 0:00:21
      672500 -- (-412.715) [-413.304] (-410.836) (-413.951) * (-411.938) (-415.020) [-413.261] (-414.652) -- 0:00:21
      673000 -- [-411.455] (-415.577) (-413.130) (-414.637) * (-410.602) (-409.971) [-414.580] (-419.561) -- 0:00:21
      673500 -- (-413.621) [-415.135] (-412.255) (-413.851) * (-412.706) [-410.401] (-410.009) (-414.494) -- 0:00:21
      674000 -- (-414.768) (-419.496) [-409.520] (-415.545) * (-411.668) [-411.777] (-410.955) (-413.907) -- 0:00:21
      674500 -- (-413.043) [-411.662] (-415.730) (-412.209) * [-410.956] (-412.045) (-416.959) (-415.798) -- 0:00:21
      675000 -- [-414.171] (-415.784) (-411.463) (-415.575) * (-412.900) (-413.625) [-412.371] (-417.348) -- 0:00:21

      Average standard deviation of split frequencies: 0.011814

      675500 -- [-417.248] (-418.314) (-412.037) (-417.089) * [-411.456] (-412.331) (-415.820) (-416.243) -- 0:00:21
      676000 -- (-414.355) [-412.966] (-415.231) (-410.586) * [-416.698] (-413.547) (-416.189) (-417.584) -- 0:00:21
      676500 -- (-412.821) (-416.521) (-418.536) [-414.707] * (-413.603) [-416.007] (-417.875) (-414.094) -- 0:00:21
      677000 -- (-413.611) (-413.942) (-418.301) [-413.883] * (-412.760) [-414.369] (-414.043) (-413.598) -- 0:00:20
      677500 -- (-411.187) [-413.111] (-418.648) (-414.522) * [-413.391] (-411.158) (-415.522) (-416.511) -- 0:00:20
      678000 -- [-413.075] (-414.649) (-420.712) (-416.240) * (-412.371) (-412.205) [-410.936] (-416.653) -- 0:00:20
      678500 -- [-412.475] (-413.645) (-411.063) (-413.998) * (-415.870) [-414.158] (-418.378) (-413.233) -- 0:00:20
      679000 -- (-407.744) [-412.044] (-414.220) (-411.687) * (-413.788) (-412.872) (-412.425) [-413.521] -- 0:00:20
      679500 -- (-412.365) (-412.163) (-420.867) [-418.808] * (-415.771) [-410.726] (-414.515) (-410.916) -- 0:00:20
      680000 -- (-411.631) [-411.107] (-418.105) (-417.521) * (-412.044) [-410.360] (-418.934) (-413.377) -- 0:00:20

      Average standard deviation of split frequencies: 0.011038

      680500 -- [-410.336] (-414.903) (-415.225) (-418.845) * (-413.304) (-415.230) (-417.183) [-412.098] -- 0:00:20
      681000 -- (-410.249) [-410.265] (-415.491) (-420.258) * (-417.480) [-411.364] (-417.247) (-413.962) -- 0:00:20
      681500 -- (-412.242) (-415.373) (-414.646) [-413.034] * (-418.245) (-419.927) (-411.714) [-414.016] -- 0:00:20
      682000 -- (-412.696) (-413.250) (-413.589) [-415.589] * (-415.526) (-413.167) (-414.074) [-412.836] -- 0:00:20
      682500 -- (-413.263) [-412.418] (-410.592) (-412.854) * (-414.191) [-413.093] (-409.218) (-413.002) -- 0:00:20
      683000 -- (-416.750) (-417.479) [-412.748] (-415.799) * [-414.283] (-413.615) (-413.478) (-416.122) -- 0:00:20
      683500 -- (-413.277) (-413.217) [-410.281] (-414.673) * (-417.859) [-412.541] (-412.811) (-413.534) -- 0:00:20
      684000 -- [-416.733] (-415.913) (-412.682) (-412.013) * (-412.880) [-413.417] (-415.646) (-410.098) -- 0:00:20
      684500 -- (-410.318) (-416.026) [-410.374] (-416.224) * (-414.829) (-412.470) (-414.614) [-413.168] -- 0:00:20
      685000 -- (-414.238) [-417.504] (-412.925) (-412.361) * (-412.541) (-411.907) [-413.659] (-414.382) -- 0:00:20

      Average standard deviation of split frequencies: 0.011424

      685500 -- (-412.894) [-413.040] (-412.257) (-413.606) * [-412.525] (-415.144) (-414.597) (-409.381) -- 0:00:20
      686000 -- (-415.911) [-410.948] (-413.367) (-415.822) * [-410.551] (-414.683) (-413.797) (-412.066) -- 0:00:20
      686500 -- (-412.355) [-415.394] (-412.523) (-416.254) * [-410.677] (-415.856) (-415.931) (-414.800) -- 0:00:20
      687000 -- [-418.293] (-413.575) (-410.213) (-413.976) * (-412.593) [-412.733] (-414.910) (-419.032) -- 0:00:20
      687500 -- (-416.342) (-412.305) (-409.486) [-417.140] * [-414.413] (-413.644) (-415.719) (-414.769) -- 0:00:20
      688000 -- (-411.572) (-414.190) (-413.026) [-416.382] * (-416.332) (-414.251) [-411.575] (-411.281) -- 0:00:20
      688500 -- (-414.743) (-412.700) [-412.266] (-418.687) * (-412.211) [-414.099] (-420.155) (-420.039) -- 0:00:20
      689000 -- (-415.358) (-414.356) (-413.214) [-411.929] * [-413.875] (-414.630) (-416.403) (-415.537) -- 0:00:20
      689500 -- [-412.730] (-412.534) (-413.520) (-415.963) * [-410.288] (-412.833) (-412.624) (-411.297) -- 0:00:20
      690000 -- [-411.333] (-417.908) (-417.650) (-415.135) * (-415.729) [-413.261] (-414.135) (-413.860) -- 0:00:20

      Average standard deviation of split frequencies: 0.011239

      690500 -- (-414.513) (-414.250) (-413.418) [-415.763] * (-414.781) (-413.550) (-413.090) [-413.315] -- 0:00:20
      691000 -- (-413.857) (-413.988) (-414.563) [-417.126] * (-412.903) (-416.837) (-413.509) [-410.729] -- 0:00:20
      691500 -- (-415.503) (-413.694) [-414.441] (-412.436) * [-414.661] (-417.076) (-412.236) (-412.498) -- 0:00:20
      692000 -- (-414.207) [-414.512] (-416.446) (-417.006) * [-412.893] (-419.583) (-412.628) (-413.594) -- 0:00:20
      692500 -- (-413.150) (-413.394) (-411.705) [-411.505] * [-415.887] (-417.376) (-413.129) (-412.307) -- 0:00:19
      693000 -- (-413.027) [-415.125] (-416.335) (-411.022) * (-416.221) (-418.429) [-416.182] (-413.056) -- 0:00:19
      693500 -- (-411.867) (-413.403) [-412.778] (-414.664) * (-414.409) (-416.190) [-411.930] (-411.553) -- 0:00:19
      694000 -- [-411.019] (-414.473) (-415.375) (-411.136) * (-416.915) (-415.079) (-414.365) [-409.435] -- 0:00:19
      694500 -- (-414.035) (-413.426) [-414.791] (-413.883) * (-413.237) [-413.056] (-415.043) (-410.860) -- 0:00:19
      695000 -- (-413.152) [-413.562] (-415.695) (-417.688) * (-412.737) (-413.722) [-413.600] (-411.841) -- 0:00:19

      Average standard deviation of split frequencies: 0.011557

      695500 -- [-413.927] (-412.525) (-412.745) (-412.387) * [-415.829] (-417.605) (-418.876) (-415.533) -- 0:00:19
      696000 -- (-416.809) (-417.048) [-412.121] (-414.435) * (-416.073) (-416.349) [-415.239] (-412.589) -- 0:00:19
      696500 -- [-413.789] (-415.842) (-415.092) (-413.380) * (-414.148) [-414.018] (-414.624) (-411.517) -- 0:00:19
      697000 -- (-415.216) [-416.656] (-413.533) (-411.840) * [-412.370] (-416.248) (-414.980) (-412.636) -- 0:00:19
      697500 -- (-415.818) (-414.424) [-415.354] (-413.252) * [-415.852] (-414.554) (-412.180) (-412.656) -- 0:00:19
      698000 -- [-410.791] (-411.832) (-415.881) (-413.661) * (-419.419) (-413.329) [-412.614] (-411.362) -- 0:00:19
      698500 -- [-412.479] (-416.547) (-413.852) (-414.689) * [-417.815] (-411.839) (-413.047) (-410.323) -- 0:00:19
      699000 -- [-412.942] (-415.642) (-413.831) (-415.325) * (-415.707) (-416.101) (-411.091) [-413.415] -- 0:00:19
      699500 -- (-410.178) (-415.989) (-410.919) [-413.345] * (-413.850) (-415.897) [-415.429] (-412.892) -- 0:00:19
      700000 -- (-411.992) [-412.453] (-411.437) (-413.758) * (-418.251) (-414.596) [-412.958] (-417.456) -- 0:00:19

      Average standard deviation of split frequencies: 0.011393

      700500 -- (-417.137) [-413.850] (-412.819) (-416.549) * (-412.619) [-410.019] (-414.018) (-416.885) -- 0:00:19
      701000 -- (-415.792) (-415.091) (-412.574) [-410.956] * (-416.903) [-409.818] (-410.664) (-411.792) -- 0:00:19
      701500 -- (-412.830) (-412.939) (-413.934) [-410.539] * [-414.126] (-414.537) (-417.063) (-412.836) -- 0:00:19
      702000 -- (-413.397) (-418.409) (-412.588) [-412.150] * (-413.334) (-412.871) (-413.547) [-414.611] -- 0:00:19
      702500 -- (-410.669) (-414.192) (-414.026) [-413.288] * (-415.623) (-412.497) (-412.699) [-412.278] -- 0:00:19
      703000 -- (-414.352) (-417.881) [-415.697] (-422.720) * (-413.398) (-410.763) (-414.162) [-410.944] -- 0:00:19
      703500 -- [-412.189] (-413.501) (-413.960) (-412.362) * (-415.002) (-415.979) (-415.834) [-413.751] -- 0:00:19
      704000 -- (-416.366) (-416.100) [-411.674] (-415.677) * (-413.568) [-416.086] (-414.369) (-415.064) -- 0:00:19
      704500 -- (-410.493) (-410.392) (-411.357) [-412.853] * (-417.625) (-416.302) [-413.793] (-412.716) -- 0:00:19
      705000 -- (-415.731) (-412.359) (-412.016) [-412.913] * (-411.950) (-415.998) (-412.627) [-413.178] -- 0:00:19

      Average standard deviation of split frequencies: 0.011885

      705500 -- (-412.671) (-410.381) (-413.134) [-418.686] * (-418.628) [-416.864] (-411.528) (-411.827) -- 0:00:19
      706000 -- (-417.221) [-411.656] (-415.408) (-416.497) * (-416.885) [-414.582] (-411.379) (-414.243) -- 0:00:19
      706500 -- [-412.718] (-413.148) (-411.780) (-415.236) * (-413.058) (-419.519) [-413.539] (-411.581) -- 0:00:19
      707000 -- [-413.080] (-411.047) (-415.388) (-412.002) * [-414.725] (-411.219) (-415.616) (-411.973) -- 0:00:19
      707500 -- (-414.779) [-413.875] (-416.116) (-415.585) * (-411.677) (-412.095) (-411.961) [-413.957] -- 0:00:19
      708000 -- (-420.012) [-413.317] (-415.782) (-411.709) * (-413.656) (-414.006) [-411.537] (-419.654) -- 0:00:18
      708500 -- [-415.899] (-411.283) (-416.012) (-413.089) * (-413.762) (-416.861) (-411.574) [-413.675] -- 0:00:18
      709000 -- (-415.900) [-411.261] (-413.851) (-415.093) * (-413.110) (-416.918) (-409.856) [-412.780] -- 0:00:18
      709500 -- (-412.439) (-411.740) (-415.552) [-416.421] * (-413.534) (