--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:24:32 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/furB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -550.16 -554.23
2 -550.34 -553.97
--------------------------------------
TOTAL -550.25 -554.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882840 0.087792 0.342662 1.449246 0.857879 1347.55 1379.10 1.001
r(A<->C){all} 0.145022 0.016534 0.000106 0.410633 0.108185 194.90 203.70 1.002
r(A<->G){all} 0.163274 0.020110 0.000063 0.457208 0.124344 166.45 178.68 1.002
r(A<->T){all} 0.168053 0.020015 0.000033 0.451342 0.129457 184.56 259.89 1.000
r(C<->G){all} 0.136815 0.016731 0.000144 0.409440 0.097218 173.53 242.45 1.000
r(C<->T){all} 0.220775 0.027864 0.000001 0.556096 0.184900 176.27 256.75 1.007
r(G<->T){all} 0.166061 0.021122 0.000117 0.451856 0.124821 214.90 239.47 1.000
pi(A){all} 0.222412 0.000432 0.182565 0.264175 0.221936 1364.33 1413.20 1.000
pi(C){all} 0.312794 0.000544 0.264691 0.355730 0.312377 1166.77 1266.49 1.000
pi(G){all} 0.280344 0.000501 0.234830 0.323384 0.279985 1233.30 1332.94 1.000
pi(T){all} 0.184450 0.000378 0.147642 0.221054 0.183354 1199.19 1270.66 1.000
alpha{1,2} 0.328173 0.151017 0.000121 1.009211 0.210145 1038.18 1248.04 1.000
alpha{3} 0.407229 0.226512 0.000209 1.332854 0.237479 1165.01 1181.79 1.001
pinvar{all} 0.990873 0.000064 0.975786 0.999760 0.992935 1328.06 1414.53 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -525.952952
Model 2: PositiveSelection -525.154045
Model 0: one-ratio -525.651831
Model 7: beta -525.952951
Model 8: beta&w>1 -525.154045
Model 0 vs 1 0.6022419999999329
Model 2 vs 1 1.5978139999999712
Model 8 vs 7 1.5978119999999763
>C1
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C2
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C3
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C4
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C5
MTGASVRSTRQRAAISTLLETVDDFRSAQEFHNELRRRGNNISLTTVYRT
LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
AWAAEVAAKHGFSDVSHTIEIFGTCSECRSo
>C6
MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
AWAAEVAAKHGFSDVSHTIEIFGTCSECRSo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=132
C1 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
C2 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
C3 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
C4 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
C5 -MTGASVRSTRQRAAISTLLETVDDFRSAQEFHNELRRRGNNISLTTVYR
C6 -MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
******************************:******************
C1 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
C2 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
C3 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
C4 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
C5 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
C6 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
**************************************************
C1 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
C2 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
C3 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
C4 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
C5 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRSo
C6 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRSo
*******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3978]--->[3978]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.452 Mb, Max= 30.652 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
C2 MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
C3 MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
C4 MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
C5 MTGASVRSTRQRAAISTLLETVDDFRSAQEFHNELRRRGNNISLTTVYRT
C6 MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
******************************:*******************
C1 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
C2 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
C3 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
C4 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
C5 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
C6 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
**************************************************
C1 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
C2 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
C3 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
C4 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
C5 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
C6 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 99.23 C1 C5 99.23
TOP 4 0 99.23 C5 C1 99.23
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 99.23 C2 C5 99.23
TOP 4 1 99.23 C5 C2 99.23
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.23 C3 C5 99.23
TOP 4 2 99.23 C5 C3 99.23
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 99.23 C4 C5 99.23
TOP 4 3 99.23 C5 C4 99.23
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 99.24 C5 C6 99.24
TOP 5 4 99.24 C6 C5 99.24
AVG 0 C1 * 99.85
AVG 1 C2 * 99.85
AVG 2 C3 * 99.85
AVG 3 C4 * 99.85
AVG 4 C5 * 99.23
AVG 5 C6 * 99.85
TOT TOT * 99.74
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
C2 ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
C3 ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
C4 ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
C5 ---ATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
C6 ---ATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
***********************************************
C1 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
C2 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
C3 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
C4 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
C5 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGTTTCACA
C6 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
******************************************* ******
C1 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
C2 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
C3 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
C4 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
C5 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
C6 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
**************************************************
C1 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
C2 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
C3 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
C4 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
C5 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
C6 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
**************************************************
C1 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
C2 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
C3 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
C4 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
C5 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
C6 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
**************************************************
C1 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
C2 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
C3 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
C4 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
C5 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
C6 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
**************************************************
C1 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
C2 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
C3 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
C4 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
C5 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
C6 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
**************************************************
C1 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
C2 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
C3 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
C4 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
C5 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
C6 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
*******************************************
>C1
ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C2
ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C3
ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C4
ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C5
---ATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGTTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C6
---ATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C1
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C2
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C3
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C4
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C5
oMTGASVRSTRQRAAISTLLETVDDFRSAQEFHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C6
oMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 396 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789376
Setting output file names to "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 888400249
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0247538408
Seed = 2048378856
Swapseed = 1579789376
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 7 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 6 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -882.113382 -- -24.965149
Chain 2 -- -882.382161 -- -24.965149
Chain 3 -- -882.369513 -- -24.965149
Chain 4 -- -882.379803 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -882.382161 -- -24.965149
Chain 2 -- -882.368708 -- -24.965149
Chain 3 -- -882.382211 -- -24.965149
Chain 4 -- -882.368708 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-882.113] (-882.382) (-882.370) (-882.380) * [-882.382] (-882.369) (-882.382) (-882.369)
500 -- [-558.236] (-560.032) (-560.401) (-555.905) * (-558.655) (-564.314) [-552.674] (-557.428) -- 0:00:00
1000 -- (-555.845) (-558.802) [-555.879] (-563.887) * (-555.838) (-558.115) (-557.892) [-560.027] -- 0:00:00
1500 -- (-554.384) [-558.288] (-556.871) (-557.186) * (-553.132) (-555.339) (-558.049) [-551.550] -- 0:00:00
2000 -- (-556.616) (-556.160) [-553.206] (-550.206) * (-557.961) (-559.811) [-553.338] (-562.011) -- 0:00:00
2500 -- (-568.787) (-553.772) [-551.897] (-556.850) * (-554.981) [-552.008] (-555.608) (-555.623) -- 0:00:00
3000 -- (-567.720) [-557.903] (-553.060) (-557.678) * (-555.831) [-554.391] (-557.070) (-551.730) -- 0:00:00
3500 -- [-554.791] (-553.217) (-553.935) (-555.032) * [-557.095] (-554.741) (-558.614) (-555.021) -- 0:00:00
4000 -- [-557.463] (-568.150) (-556.428) (-550.119) * (-552.500) [-557.599] (-553.037) (-562.669) -- 0:00:00
4500 -- [-557.523] (-557.933) (-558.749) (-554.398) * (-551.619) (-561.197) [-555.932] (-558.579) -- 0:03:41
5000 -- [-561.272] (-555.797) (-560.293) (-552.553) * (-560.836) (-555.390) [-556.318] (-553.642) -- 0:03:19
Average standard deviation of split frequencies: 0.082309
5500 -- (-554.402) (-558.126) [-560.311] (-565.903) * (-559.388) [-563.207] (-550.857) (-560.547) -- 0:03:00
6000 -- (-559.844) (-558.161) [-555.502] (-557.778) * (-555.695) (-552.570) (-553.823) [-553.610] -- 0:02:45
6500 -- (-556.542) [-561.538] (-560.448) (-565.512) * [-553.377] (-559.355) (-560.627) (-558.804) -- 0:02:32
7000 -- [-561.395] (-553.955) (-561.132) (-552.549) * (-553.173) (-555.543) (-562.002) [-556.329] -- 0:02:21
7500 -- [-558.970] (-552.191) (-553.303) (-559.123) * [-552.708] (-552.797) (-560.662) (-556.779) -- 0:02:12
8000 -- [-555.115] (-549.194) (-561.652) (-563.462) * [-557.120] (-564.094) (-552.397) (-558.230) -- 0:02:04
8500 -- (-552.117) (-558.642) (-556.769) [-558.755] * [-553.039] (-551.865) (-556.277) (-555.411) -- 0:01:56
9000 -- (-553.511) [-562.696] (-557.124) (-555.580) * (-555.072) [-559.171] (-557.425) (-557.838) -- 0:01:50
9500 -- (-553.528) (-554.828) (-561.336) [-550.948] * (-561.729) [-555.320] (-557.534) (-564.390) -- 0:01:44
10000 -- (-562.128) (-553.478) [-552.078] (-563.111) * (-559.087) [-561.284] (-557.464) (-554.865) -- 0:01:39
Average standard deviation of split frequencies: 0.079970
10500 -- (-552.523) (-554.369) [-553.491] (-553.186) * (-563.615) (-561.702) [-556.281] (-559.345) -- 0:01:34
11000 -- (-555.293) (-555.250) (-556.830) [-549.328] * (-561.256) (-559.288) [-552.328] (-551.658) -- 0:01:29
11500 -- (-560.250) (-552.425) [-554.285] (-553.378) * (-554.365) (-562.936) (-557.043) [-555.055] -- 0:01:25
12000 -- (-556.631) [-553.929] (-552.910) (-559.005) * (-557.584) (-551.992) [-557.666] (-553.344) -- 0:01:22
12500 -- (-555.171) (-551.715) [-551.136] (-563.602) * (-559.315) [-557.737] (-559.112) (-557.178) -- 0:01:19
13000 -- (-562.762) [-554.355] (-553.126) (-555.030) * [-566.477] (-553.862) (-560.464) (-563.193) -- 0:01:15
13500 -- (-555.242) [-560.401] (-555.085) (-558.456) * (-560.109) (-558.454) (-557.543) [-551.375] -- 0:01:13
14000 -- (-558.502) (-557.642) (-555.342) [-555.483] * [-557.572] (-555.472) (-573.425) (-552.344) -- 0:01:10
14500 -- [-553.261] (-551.007) (-552.530) (-567.723) * [-556.196] (-555.897) (-560.765) (-551.636) -- 0:01:07
15000 -- (-559.426) (-549.229) [-549.813] (-563.013) * (-550.788) [-559.060] (-569.287) (-551.706) -- 0:01:05
Average standard deviation of split frequencies: 0.073657
15500 -- [-553.133] (-549.146) (-558.663) (-557.920) * (-553.955) [-552.827] (-568.938) (-550.422) -- 0:01:03
16000 -- [-555.634] (-552.589) (-557.672) (-555.505) * [-552.900] (-562.163) (-556.045) (-551.731) -- 0:01:01
16500 -- (-555.746) [-551.997] (-558.313) (-569.730) * (-569.134) (-550.492) (-563.764) [-552.779] -- 0:00:59
17000 -- (-553.984) [-549.493] (-556.656) (-557.641) * (-556.121) [-560.026] (-557.334) (-551.440) -- 0:00:57
17500 -- (-559.783) [-549.575] (-555.459) (-559.293) * (-565.890) (-552.087) (-557.536) [-551.373] -- 0:01:52
18000 -- (-559.543) (-551.388) [-557.716] (-557.222) * [-563.311] (-554.549) (-558.641) (-553.711) -- 0:01:49
18500 -- [-553.197] (-552.135) (-558.678) (-551.819) * [-557.185] (-557.706) (-561.053) (-549.686) -- 0:01:46
19000 -- [-551.497] (-552.649) (-553.986) (-552.833) * [-557.274] (-554.777) (-559.853) (-551.324) -- 0:01:43
19500 -- [-554.706] (-551.650) (-560.690) (-568.746) * [-556.230] (-561.433) (-558.702) (-549.408) -- 0:01:40
20000 -- (-554.403) [-551.971] (-554.901) (-565.597) * [-553.541] (-551.956) (-555.740) (-551.027) -- 0:01:38
Average standard deviation of split frequencies: 0.068430
20500 -- (-556.589) (-549.975) (-565.802) [-555.042] * (-557.229) (-551.096) [-552.245] (-552.804) -- 0:01:35
21000 -- (-556.020) (-551.739) [-549.301] (-558.232) * [-556.742] (-554.502) (-555.740) (-554.897) -- 0:01:33
21500 -- (-557.712) [-550.379] (-562.733) (-573.030) * (-556.817) (-558.272) [-554.227] (-551.602) -- 0:01:31
22000 -- (-560.837) (-551.829) (-563.790) [-555.308] * (-566.333) (-554.899) [-556.166] (-549.795) -- 0:01:28
22500 -- (-554.499) [-550.545] (-552.036) (-560.150) * (-555.456) (-551.989) [-555.147] (-551.761) -- 0:01:26
23000 -- (-567.049) (-553.438) (-556.309) [-553.016] * [-553.415] (-551.676) (-559.292) (-551.567) -- 0:01:24
23500 -- (-566.680) (-549.647) (-557.865) [-551.548] * (-556.257) (-554.455) [-560.265] (-551.950) -- 0:01:23
24000 -- (-558.698) (-550.642) [-552.494] (-562.029) * [-552.563] (-551.581) (-558.343) (-550.235) -- 0:01:21
24500 -- [-560.652] (-548.892) (-554.541) (-563.175) * (-555.935) [-549.509] (-558.021) (-554.519) -- 0:01:19
25000 -- (-556.359) (-550.050) (-557.246) [-549.075] * (-557.063) (-554.335) [-553.917] (-551.308) -- 0:01:18
Average standard deviation of split frequencies: 0.047486
25500 -- (-554.682) (-553.862) (-567.466) [-552.754] * (-555.601) (-551.781) [-554.213] (-550.276) -- 0:01:16
26000 -- (-552.241) [-551.789] (-555.388) (-558.579) * (-560.043) (-550.749) [-551.167] (-552.521) -- 0:01:14
26500 -- (-561.285) (-553.495) [-553.109] (-553.372) * (-558.852) (-549.330) (-557.438) [-550.978] -- 0:01:13
27000 -- (-554.763) [-552.226] (-561.888) (-551.014) * (-554.360) (-550.321) [-559.028] (-553.366) -- 0:01:12
27500 -- (-565.238) (-549.823) [-563.499] (-553.124) * (-554.636) [-550.675] (-553.774) (-553.629) -- 0:01:10
28000 -- (-556.771) (-549.924) [-554.989] (-553.084) * [-558.367] (-549.043) (-555.956) (-555.948) -- 0:01:09
28500 -- (-557.737) (-549.910) [-556.353] (-552.019) * (-561.477) (-550.226) [-559.135] (-551.868) -- 0:01:08
29000 -- (-557.243) (-550.067) [-558.550] (-550.804) * (-559.259) (-549.721) (-567.898) [-552.966] -- 0:01:06
29500 -- (-555.406) (-553.126) (-566.237) [-551.577] * (-560.601) (-551.494) [-555.980] (-551.588) -- 0:01:05
30000 -- (-556.630) (-550.053) (-563.037) [-550.901] * (-555.147) (-555.155) [-553.421] (-555.230) -- 0:01:04
Average standard deviation of split frequencies: 0.043689
30500 -- (-559.933) (-550.655) (-556.234) [-549.119] * (-555.417) (-551.241) (-556.095) [-552.840] -- 0:01:35
31000 -- (-556.849) (-551.554) (-555.073) [-551.554] * (-559.875) (-551.414) [-558.737] (-554.371) -- 0:01:33
31500 -- [-555.034] (-552.708) (-555.758) (-549.956) * (-554.437) [-549.367] (-562.017) (-550.039) -- 0:01:32
32000 -- [-551.168] (-549.319) (-557.328) (-551.151) * (-558.836) [-550.538] (-566.103) (-548.793) -- 0:01:30
32500 -- (-550.568) [-549.819] (-559.771) (-553.099) * (-560.786) (-553.967) [-549.541] (-550.349) -- 0:01:29
33000 -- (-557.818) (-552.769) [-556.974] (-551.504) * (-561.965) [-550.057] (-552.482) (-549.323) -- 0:01:27
33500 -- (-562.550) (-553.433) [-554.581] (-550.539) * (-554.945) (-551.598) (-564.723) [-549.982] -- 0:01:26
34000 -- [-557.592] (-552.548) (-563.871) (-550.574) * (-566.401) (-551.159) (-558.041) [-550.236] -- 0:01:25
34500 -- (-557.287) (-551.415) (-560.361) [-551.514] * (-557.186) [-551.713] (-559.743) (-552.233) -- 0:01:23
35000 -- [-550.011] (-554.261) (-559.049) (-555.963) * (-561.353) (-554.459) [-554.568] (-551.043) -- 0:01:22
Average standard deviation of split frequencies: 0.045176
35500 -- [-562.123] (-556.905) (-559.859) (-553.423) * (-562.879) [-552.754] (-562.741) (-553.174) -- 0:01:21
36000 -- (-561.311) (-553.000) [-553.484] (-553.651) * (-551.639) [-553.997] (-553.036) (-552.861) -- 0:01:20
36500 -- (-552.294) [-550.179] (-564.714) (-551.858) * (-552.589) (-553.378) [-556.697] (-554.021) -- 0:01:19
37000 -- [-556.691] (-551.800) (-553.640) (-551.575) * (-553.835) (-552.659) [-557.396] (-555.149) -- 0:01:18
37500 -- (-555.146) [-552.418] (-552.823) (-551.695) * (-551.560) (-550.011) (-555.925) [-554.236] -- 0:01:17
38000 -- (-552.966) (-551.642) (-555.807) [-550.861] * (-550.009) (-555.026) (-557.448) [-551.691] -- 0:01:15
38500 -- [-549.888] (-551.581) (-554.466) (-552.767) * (-548.347) (-551.878) [-556.236] (-550.475) -- 0:01:14
39000 -- [-551.259] (-551.484) (-548.643) (-551.015) * [-550.020] (-550.922) (-562.636) (-550.118) -- 0:01:13
39500 -- (-557.191) (-549.159) [-548.994] (-550.614) * [-549.971] (-551.743) (-556.504) (-550.292) -- 0:01:12
40000 -- [-558.289] (-552.644) (-551.571) (-553.875) * [-552.723] (-551.965) (-564.190) (-552.968) -- 0:01:12
Average standard deviation of split frequencies: 0.049128
40500 -- [-558.789] (-551.718) (-550.976) (-553.169) * (-557.889) (-552.059) [-555.119] (-551.366) -- 0:01:11
41000 -- [-551.761] (-549.549) (-548.560) (-551.209) * (-558.684) (-551.790) (-559.803) [-552.796] -- 0:01:10
41500 -- (-557.609) [-549.645] (-554.883) (-552.566) * (-555.022) [-550.530] (-555.260) (-552.164) -- 0:01:09
42000 -- [-557.435] (-550.208) (-549.329) (-551.729) * [-549.767] (-553.450) (-557.071) (-551.366) -- 0:01:08
42500 -- [-552.692] (-552.840) (-550.137) (-551.388) * (-551.681) (-554.550) [-556.047] (-552.053) -- 0:01:07
43000 -- (-553.728) [-550.041] (-552.093) (-552.273) * (-555.213) (-550.620) (-562.090) [-550.068] -- 0:01:06
43500 -- [-552.677] (-550.147) (-548.699) (-551.459) * [-551.807] (-552.949) (-560.056) (-551.933) -- 0:01:05
44000 -- (-562.715) [-548.458] (-550.286) (-550.577) * [-550.657] (-550.999) (-556.372) (-551.232) -- 0:01:05
44500 -- (-560.650) (-550.268) [-550.156] (-557.773) * (-551.150) [-550.539] (-558.563) (-552.946) -- 0:01:25
45000 -- [-556.704] (-548.645) (-549.282) (-552.398) * (-553.585) (-551.260) [-553.285] (-551.042) -- 0:01:24
Average standard deviation of split frequencies: 0.039209
45500 -- [-551.149] (-550.094) (-549.422) (-551.823) * (-551.759) (-550.412) [-552.723] (-552.303) -- 0:01:23
46000 -- [-556.553] (-551.511) (-554.128) (-550.628) * (-550.531) (-550.559) (-554.780) [-552.867] -- 0:01:22
46500 -- (-561.775) (-550.377) [-551.972] (-550.919) * (-551.479) (-551.225) (-582.530) [-551.486] -- 0:01:22
47000 -- [-557.773] (-550.611) (-550.577) (-554.154) * (-550.748) [-550.491] (-583.235) (-552.240) -- 0:01:21
47500 -- (-554.300) [-550.436] (-553.382) (-554.243) * [-550.211] (-559.769) (-568.905) (-551.467) -- 0:01:20
48000 -- (-555.177) (-552.171) (-551.959) [-551.999] * [-548.811] (-555.736) (-568.921) (-550.410) -- 0:01:19
48500 -- (-549.291) [-549.759] (-549.003) (-553.333) * [-553.030] (-555.114) (-562.828) (-553.295) -- 0:01:18
49000 -- [-549.869] (-552.914) (-551.627) (-550.719) * (-551.205) [-554.145] (-550.390) (-555.168) -- 0:01:17
49500 -- (-555.828) (-552.779) [-547.662] (-550.946) * [-549.692] (-556.048) (-550.034) (-554.713) -- 0:01:16
50000 -- [-557.332] (-554.389) (-552.442) (-550.645) * [-550.235] (-551.679) (-551.034) (-557.396) -- 0:01:16
Average standard deviation of split frequencies: 0.034890
50500 -- (-558.408) [-551.449] (-550.614) (-552.022) * (-549.420) (-553.730) (-551.786) [-554.481] -- 0:01:15
51000 -- (-556.315) (-553.216) [-552.380] (-548.920) * (-553.646) (-550.974) (-551.225) [-554.035] -- 0:01:14
51500 -- [-554.687] (-553.287) (-551.606) (-556.907) * (-558.225) (-554.574) [-550.908] (-556.070) -- 0:01:13
52000 -- (-555.890) (-551.438) (-549.530) [-549.178] * (-551.786) (-553.650) (-550.787) [-552.747] -- 0:01:12
52500 -- (-552.048) (-551.504) [-552.524] (-549.273) * [-552.466] (-553.655) (-549.692) (-552.845) -- 0:01:12
53000 -- (-560.327) (-551.118) (-552.524) [-551.239] * [-549.207] (-552.540) (-550.978) (-551.314) -- 0:01:11
53500 -- (-554.887) [-550.386] (-555.010) (-549.240) * (-553.851) (-553.365) [-553.695] (-552.017) -- 0:01:10
54000 -- [-552.437] (-552.604) (-551.531) (-549.676) * (-551.763) (-557.797) [-551.916] (-551.795) -- 0:01:10
54500 -- [-557.446] (-550.882) (-551.914) (-552.763) * (-553.723) [-553.350] (-552.211) (-553.650) -- 0:01:09
55000 -- (-555.866) (-552.237) (-552.139) [-552.184] * (-548.376) (-554.547) (-552.538) [-552.420] -- 0:01:08
Average standard deviation of split frequencies: 0.032068
55500 -- (-560.791) [-550.528] (-551.217) (-555.239) * (-552.594) (-552.154) (-552.947) [-551.153] -- 0:01:08
56000 -- [-553.846] (-553.147) (-557.130) (-550.696) * [-549.314] (-551.644) (-550.506) (-550.625) -- 0:01:07
56500 -- [-556.700] (-554.055) (-554.644) (-552.539) * (-550.477) (-550.844) [-550.520] (-552.619) -- 0:01:06
57000 -- [-554.328] (-552.679) (-552.365) (-549.209) * (-557.322) (-550.636) (-554.578) [-552.387] -- 0:01:06
57500 -- (-551.437) (-552.568) (-552.306) [-551.281] * (-554.577) [-550.831] (-552.921) (-552.687) -- 0:01:05
58000 -- [-556.053] (-551.821) (-553.473) (-552.673) * (-552.556) [-551.795] (-553.478) (-551.906) -- 0:01:21
58500 -- (-561.352) [-552.405] (-555.416) (-550.044) * [-550.497] (-552.773) (-550.231) (-552.374) -- 0:01:20
59000 -- (-554.366) [-551.144] (-553.678) (-551.249) * [-551.542] (-550.812) (-554.544) (-553.193) -- 0:01:19
59500 -- (-555.490) [-551.454] (-553.100) (-552.509) * (-554.730) (-550.943) [-551.164] (-551.211) -- 0:01:19
60000 -- (-553.045) (-553.188) (-549.604) [-551.960] * (-550.882) (-552.824) [-550.500] (-551.269) -- 0:01:18
Average standard deviation of split frequencies: 0.036632
60500 -- [-561.063] (-550.652) (-556.476) (-551.987) * [-551.515] (-551.905) (-553.684) (-551.141) -- 0:01:17
61000 -- (-562.569) (-550.342) (-551.660) [-552.812] * (-549.839) (-552.348) [-552.126] (-552.317) -- 0:01:16
61500 -- (-552.198) (-550.378) [-551.891] (-551.569) * [-550.653] (-551.276) (-551.198) (-552.366) -- 0:01:16
62000 -- (-553.816) (-550.710) [-551.480] (-551.434) * [-549.538] (-551.247) (-552.870) (-552.026) -- 0:01:15
62500 -- [-551.249] (-551.936) (-549.201) (-555.000) * [-552.487] (-553.328) (-554.327) (-550.541) -- 0:01:15
63000 -- [-558.317] (-556.427) (-550.714) (-552.776) * (-553.161) [-556.879] (-551.817) (-550.689) -- 0:01:14
63500 -- (-552.129) (-554.302) [-549.895] (-549.642) * [-550.372] (-557.090) (-551.253) (-553.510) -- 0:01:13
64000 -- [-553.355] (-550.592) (-553.435) (-553.496) * (-551.422) [-550.951] (-553.654) (-552.135) -- 0:01:13
64500 -- [-560.300] (-550.316) (-555.620) (-552.715) * [-550.855] (-552.086) (-552.536) (-554.814) -- 0:01:12
65000 -- (-553.973) (-552.277) [-551.948] (-551.412) * (-550.272) (-553.344) (-553.220) [-549.658] -- 0:01:11
Average standard deviation of split frequencies: 0.028570
65500 -- [-555.720] (-549.542) (-551.811) (-549.122) * (-552.040) (-550.310) [-553.629] (-550.895) -- 0:01:11
66000 -- [-558.410] (-554.469) (-554.024) (-551.320) * (-551.429) (-551.522) [-550.377] (-553.892) -- 0:01:10
66500 -- (-555.836) (-550.309) [-549.275] (-552.327) * (-550.173) (-549.461) (-549.614) [-551.921] -- 0:01:10
67000 -- (-561.669) [-553.314] (-548.828) (-551.254) * (-552.478) (-553.433) (-551.184) [-549.886] -- 0:01:09
67500 -- [-551.980] (-551.651) (-549.583) (-550.102) * (-553.178) (-550.793) (-550.729) [-552.300] -- 0:01:09
68000 -- (-555.049) (-549.754) [-548.757] (-554.641) * (-549.414) (-559.253) [-551.527] (-551.895) -- 0:01:08
68500 -- (-556.345) [-550.315] (-552.750) (-550.040) * [-548.957] (-552.186) (-551.899) (-552.645) -- 0:01:07
69000 -- (-562.729) (-554.456) (-555.238) [-550.088] * (-552.208) (-550.099) [-552.691] (-552.213) -- 0:01:07
69500 -- (-561.074) (-550.344) (-559.373) [-551.784] * (-548.683) [-551.186] (-552.377) (-553.174) -- 0:01:06
70000 -- (-550.332) [-552.463] (-554.112) (-550.949) * (-551.147) [-551.467] (-552.358) (-557.206) -- 0:01:06
Average standard deviation of split frequencies: 0.025813
70500 -- (-550.961) [-550.584] (-552.973) (-550.493) * (-553.847) [-550.232] (-551.023) (-552.290) -- 0:01:05
71000 -- [-548.425] (-550.200) (-556.225) (-553.137) * (-548.679) (-555.093) [-551.288] (-554.264) -- 0:01:05
71500 -- (-550.304) [-550.640] (-553.034) (-553.444) * (-553.532) [-552.074] (-551.361) (-553.612) -- 0:01:04
72000 -- (-551.368) (-552.369) [-551.473] (-551.140) * (-553.430) (-556.530) (-551.957) [-551.967] -- 0:01:17
72500 -- (-551.618) [-551.656] (-554.349) (-551.058) * (-551.110) (-552.596) (-552.814) [-551.801] -- 0:01:16
73000 -- (-550.337) (-550.388) [-554.187] (-551.377) * (-551.382) [-551.403] (-552.473) (-552.466) -- 0:01:16
73500 -- [-549.565] (-554.933) (-552.106) (-551.010) * (-551.553) (-551.656) [-551.919] (-551.925) -- 0:01:15
74000 -- (-551.942) (-555.510) (-552.643) [-552.984] * [-551.596] (-551.819) (-554.856) (-552.380) -- 0:01:15
74500 -- (-549.910) (-554.011) (-552.379) [-554.251] * [-551.946] (-552.227) (-551.689) (-551.737) -- 0:01:14
75000 -- (-550.698) (-549.772) (-553.079) [-551.382] * (-551.096) (-554.064) [-550.161] (-553.547) -- 0:01:14
Average standard deviation of split frequencies: 0.026583
75500 -- [-551.105] (-551.421) (-551.849) (-551.566) * [-550.854] (-550.215) (-550.153) (-553.990) -- 0:01:13
76000 -- (-551.543) (-551.913) [-551.523] (-551.365) * [-552.892] (-551.086) (-550.603) (-553.411) -- 0:01:12
76500 -- [-550.151] (-553.169) (-551.144) (-554.254) * (-555.146) [-553.987] (-550.734) (-552.656) -- 0:01:12
77000 -- (-550.044) (-550.809) [-555.270] (-553.953) * (-550.379) (-550.579) (-550.009) [-551.267] -- 0:01:11
77500 -- (-551.296) (-553.479) [-553.294] (-553.818) * (-549.706) [-550.861] (-550.635) (-555.889) -- 0:01:11
78000 -- (-550.986) (-551.201) [-551.180] (-551.798) * (-549.186) [-550.221] (-559.469) (-552.779) -- 0:01:10
78500 -- (-551.618) [-548.048] (-550.573) (-551.687) * (-552.310) (-556.192) [-554.457] (-552.876) -- 0:01:10
79000 -- (-555.960) (-548.982) [-552.973] (-550.733) * (-551.849) (-550.763) [-550.802] (-553.040) -- 0:01:09
79500 -- (-553.418) (-552.867) (-552.654) [-555.212] * (-551.445) [-550.707] (-551.774) (-552.726) -- 0:01:09
80000 -- (-554.323) (-549.039) [-552.234] (-553.714) * (-550.521) [-551.775] (-552.200) (-549.567) -- 0:01:09
Average standard deviation of split frequencies: 0.024252
80500 -- (-555.811) (-550.567) [-550.348] (-550.760) * (-551.395) [-552.932] (-557.418) (-550.797) -- 0:01:08
81000 -- (-552.135) [-554.358] (-551.342) (-553.799) * [-549.095] (-551.170) (-551.535) (-552.344) -- 0:01:08
81500 -- (-550.663) (-551.703) (-553.758) [-550.537] * [-552.069] (-551.737) (-551.214) (-550.568) -- 0:01:07
82000 -- [-550.551] (-552.381) (-552.413) (-551.575) * (-551.566) (-549.465) [-549.605] (-554.362) -- 0:01:07
82500 -- (-552.937) (-553.141) [-548.203] (-551.571) * (-548.739) (-548.508) (-551.334) [-551.393] -- 0:01:06
83000 -- (-551.851) (-552.392) [-550.353] (-550.918) * (-549.758) (-549.193) (-549.515) [-552.860] -- 0:01:06
83500 -- (-551.195) (-549.434) (-551.143) [-552.308] * (-550.462) [-552.379] (-550.685) (-557.020) -- 0:01:05
84000 -- (-549.434) (-552.951) [-552.196] (-552.696) * (-548.875) (-553.273) (-551.745) [-551.390] -- 0:01:05
84500 -- (-552.394) (-550.797) (-551.973) [-550.418] * (-552.949) (-553.587) [-553.002] (-551.427) -- 0:01:05
85000 -- [-554.265] (-550.950) (-556.995) (-550.084) * [-549.806] (-549.740) (-552.722) (-555.059) -- 0:01:04
Average standard deviation of split frequencies: 0.026311
85500 -- [-555.794] (-551.313) (-554.420) (-552.554) * [-550.729] (-549.107) (-552.762) (-558.452) -- 0:01:04
86000 -- (-552.545) (-552.101) (-552.190) [-550.933] * (-550.642) [-549.106] (-554.225) (-552.021) -- 0:01:14
86500 -- (-552.342) (-550.887) [-551.858] (-551.174) * (-549.792) [-553.104] (-553.481) (-555.068) -- 0:01:13
87000 -- (-552.078) (-552.595) [-550.916] (-551.989) * [-553.907] (-553.097) (-551.868) (-551.858) -- 0:01:13
87500 -- [-554.244] (-549.645) (-552.839) (-551.021) * [-549.963] (-553.779) (-553.222) (-553.557) -- 0:01:13
88000 -- (-551.673) (-551.767) [-552.482] (-552.305) * (-550.126) (-551.515) [-554.470] (-550.059) -- 0:01:12
88500 -- (-554.331) (-551.515) (-548.683) [-551.789] * (-552.260) [-551.983] (-551.491) (-549.859) -- 0:01:12
89000 -- [-549.803] (-551.420) (-549.063) (-550.161) * (-551.368) (-553.235) (-551.137) [-548.717] -- 0:01:11
89500 -- (-561.198) (-553.047) (-549.683) [-550.265] * [-553.031] (-552.746) (-552.650) (-550.854) -- 0:01:11
90000 -- (-553.124) (-552.097) (-553.993) [-551.057] * (-551.303) (-553.458) [-552.943] (-551.968) -- 0:01:10
Average standard deviation of split frequencies: 0.024177
90500 -- (-557.088) (-551.397) (-552.232) [-551.683] * [-551.469] (-551.738) (-552.426) (-549.186) -- 0:01:10
91000 -- (-554.630) (-550.498) [-551.069] (-551.405) * [-553.337] (-549.737) (-549.829) (-553.987) -- 0:01:09
91500 -- [-551.898] (-551.027) (-552.226) (-553.055) * (-551.425) [-551.764] (-555.099) (-553.099) -- 0:01:09
92000 -- (-553.750) [-551.657] (-551.510) (-554.865) * (-548.443) [-552.639] (-553.410) (-551.616) -- 0:01:09
92500 -- (-554.472) (-551.389) [-549.097] (-550.773) * (-550.641) (-552.564) [-555.191] (-552.572) -- 0:01:08
93000 -- (-550.348) [-554.346] (-550.992) (-549.116) * (-555.715) [-551.168] (-550.221) (-549.963) -- 0:01:08
93500 -- (-551.726) (-551.349) (-549.515) [-550.339] * (-549.952) (-552.344) (-550.078) [-550.049] -- 0:01:07
94000 -- [-552.074] (-553.845) (-549.680) (-556.472) * [-550.694] (-552.203) (-552.004) (-551.311) -- 0:01:07
94500 -- (-551.277) (-551.458) [-548.756] (-557.566) * (-551.467) (-555.407) [-550.417] (-550.073) -- 0:01:07
95000 -- [-548.766] (-552.167) (-549.997) (-552.930) * (-548.770) (-552.438) (-550.169) [-552.068] -- 0:01:06
Average standard deviation of split frequencies: 0.021193
95500 -- (-551.040) [-552.449] (-553.291) (-550.727) * (-550.737) [-552.014] (-551.170) (-551.342) -- 0:01:06
96000 -- (-549.275) (-552.365) (-552.633) [-550.344] * (-551.917) [-552.566] (-549.345) (-550.267) -- 0:01:05
96500 -- [-551.634] (-551.793) (-551.046) (-553.239) * (-549.732) [-549.567] (-551.424) (-551.277) -- 0:01:05
97000 -- [-552.584] (-551.619) (-552.113) (-552.444) * [-548.821] (-553.929) (-550.877) (-551.635) -- 0:01:05
97500 -- (-553.365) (-551.482) [-551.333] (-558.793) * (-548.522) [-552.795] (-550.062) (-552.220) -- 0:01:04
98000 -- [-551.676] (-551.194) (-555.095) (-555.755) * [-551.597] (-551.114) (-552.807) (-549.935) -- 0:01:04
98500 -- (-554.570) [-552.240] (-555.268) (-552.892) * (-553.414) [-548.354] (-551.805) (-550.444) -- 0:01:04
99000 -- (-550.892) (-551.935) [-551.300] (-553.150) * (-553.904) [-550.664] (-551.452) (-550.907) -- 0:01:03
99500 -- (-549.664) [-552.135] (-552.521) (-550.566) * [-553.510] (-551.477) (-554.794) (-552.855) -- 0:01:03
100000 -- (-550.650) [-551.441] (-553.437) (-554.207) * (-549.101) [-550.056] (-552.054) (-551.180) -- 0:01:12
Average standard deviation of split frequencies: 0.019772
100500 -- [-550.677] (-555.718) (-550.729) (-549.959) * [-548.926] (-550.876) (-552.278) (-551.416) -- 0:01:11
101000 -- [-550.733] (-554.674) (-555.024) (-553.372) * [-551.535] (-550.082) (-550.913) (-550.857) -- 0:01:11
101500 -- [-552.783] (-555.438) (-551.235) (-552.150) * (-553.173) (-551.777) (-551.681) [-552.116] -- 0:01:10
102000 -- (-553.082) (-552.887) [-550.571] (-553.525) * (-552.891) [-551.547] (-553.874) (-550.099) -- 0:01:10
102500 -- [-550.585] (-553.138) (-550.838) (-554.721) * (-552.090) [-551.136] (-550.635) (-550.929) -- 0:01:10
103000 -- (-552.223) (-552.871) [-551.232] (-555.849) * [-551.715] (-550.145) (-549.830) (-552.681) -- 0:01:09
103500 -- (-553.424) (-553.445) (-551.821) [-549.962] * (-552.697) [-551.672] (-548.971) (-551.362) -- 0:01:09
104000 -- (-550.888) (-552.979) [-551.919] (-548.141) * (-550.914) (-553.776) [-548.761] (-553.940) -- 0:01:08
104500 -- [-552.599] (-557.997) (-552.714) (-551.867) * (-549.159) [-552.531] (-550.939) (-552.040) -- 0:01:08
105000 -- [-553.020] (-553.421) (-551.624) (-551.333) * (-550.882) (-552.995) [-549.268] (-550.343) -- 0:01:08
Average standard deviation of split frequencies: 0.018011
105500 -- (-553.271) [-553.778] (-549.191) (-554.283) * [-550.006] (-553.679) (-548.130) (-550.636) -- 0:01:07
106000 -- (-553.192) (-552.197) (-549.857) [-552.679] * (-551.079) [-549.057] (-549.557) (-555.168) -- 0:01:07
106500 -- [-552.604] (-551.281) (-550.779) (-549.603) * (-553.208) [-551.932] (-549.565) (-552.330) -- 0:01:07
107000 -- [-550.987] (-550.660) (-550.904) (-549.807) * (-549.495) [-551.633] (-547.745) (-554.463) -- 0:01:06
107500 -- (-552.878) [-550.336] (-551.679) (-547.872) * (-551.756) (-551.771) [-550.988] (-549.396) -- 0:01:06
108000 -- [-551.249] (-552.629) (-552.350) (-549.644) * (-552.433) [-551.805] (-559.663) (-551.666) -- 0:01:06
108500 -- [-553.056] (-551.593) (-550.418) (-550.488) * [-550.559] (-551.064) (-551.893) (-557.788) -- 0:01:05
109000 -- (-555.712) (-551.623) (-550.834) [-554.142] * (-550.861) (-552.437) (-552.299) [-550.985] -- 0:01:05
109500 -- (-550.347) [-550.221] (-551.879) (-550.716) * (-550.186) (-551.835) (-550.137) [-552.241] -- 0:01:05
110000 -- (-551.124) [-550.399] (-550.069) (-549.486) * [-549.366] (-551.553) (-552.118) (-555.892) -- 0:01:04
Average standard deviation of split frequencies: 0.019056
110500 -- (-556.131) (-552.096) (-551.006) [-553.036] * (-548.826) (-551.559) [-550.386] (-550.614) -- 0:01:04
111000 -- [-554.769] (-553.016) (-551.163) (-549.391) * (-548.055) (-550.008) (-550.038) [-550.360] -- 0:01:04
111500 -- (-551.898) (-551.002) (-551.995) [-548.517] * (-549.931) (-553.564) [-549.639] (-550.343) -- 0:01:03
112000 -- (-552.207) [-553.758] (-552.057) (-551.516) * (-553.235) [-551.373] (-552.837) (-549.504) -- 0:01:03
112500 -- (-552.621) [-549.550] (-550.740) (-551.363) * (-551.741) (-550.200) (-552.915) [-551.931] -- 0:01:03
113000 -- (-552.023) (-552.184) [-549.907] (-548.947) * (-549.920) (-552.243) (-550.353) [-548.942] -- 0:01:02
113500 -- (-551.022) (-550.808) [-550.709] (-550.724) * (-552.343) [-550.441] (-553.528) (-553.242) -- 0:01:02
114000 -- (-549.916) [-550.436] (-554.077) (-551.832) * (-548.929) [-552.562] (-550.416) (-554.230) -- 0:01:09
114500 -- [-548.935] (-549.726) (-552.830) (-550.508) * (-550.072) (-551.781) (-550.358) [-549.011] -- 0:01:09
115000 -- (-549.296) [-557.576] (-553.185) (-550.732) * [-550.052] (-551.221) (-550.057) (-550.764) -- 0:01:09
Average standard deviation of split frequencies: 0.018739
115500 -- (-552.921) (-557.486) [-551.683] (-550.659) * [-549.840] (-550.375) (-551.014) (-551.198) -- 0:01:08
116000 -- [-549.443] (-552.581) (-552.297) (-555.251) * [-549.892] (-552.486) (-550.414) (-552.398) -- 0:01:08
116500 -- (-550.892) (-551.896) (-553.409) [-550.406] * (-548.160) (-556.196) [-551.502] (-550.759) -- 0:01:08
117000 -- (-551.808) [-551.944] (-551.733) (-550.072) * [-552.395] (-552.400) (-548.019) (-552.113) -- 0:01:07
117500 -- (-553.036) (-553.025) (-551.485) [-548.869] * (-547.543) (-550.486) [-548.574] (-551.961) -- 0:01:07
118000 -- (-551.120) (-551.121) (-552.251) [-548.031] * (-550.934) (-550.639) (-550.103) [-551.470] -- 0:01:07
118500 -- (-555.674) (-556.163) [-552.228] (-552.445) * (-550.750) (-551.624) [-548.580] (-551.034) -- 0:01:06
119000 -- (-550.432) (-552.481) (-552.811) [-551.739] * (-547.566) (-554.352) [-548.498] (-557.272) -- 0:01:06
119500 -- [-551.757] (-550.765) (-552.625) (-554.186) * (-549.059) (-553.443) [-549.871] (-555.252) -- 0:01:06
120000 -- [-549.551] (-554.294) (-554.383) (-552.139) * [-554.405] (-552.192) (-549.659) (-551.697) -- 0:01:06
Average standard deviation of split frequencies: 0.018711
120500 -- (-550.367) [-552.173] (-557.999) (-548.995) * (-548.320) [-553.254] (-547.552) (-554.989) -- 0:01:05
121000 -- (-551.317) [-552.269] (-554.638) (-550.045) * [-548.633] (-556.624) (-547.585) (-555.219) -- 0:01:05
121500 -- [-551.094] (-555.065) (-553.252) (-551.847) * [-549.120] (-552.184) (-548.214) (-551.072) -- 0:01:05
122000 -- (-553.784) (-553.274) [-554.129] (-551.548) * [-549.995] (-551.578) (-550.183) (-551.904) -- 0:01:04
122500 -- (-553.905) [-554.073] (-555.528) (-550.235) * (-549.187) (-552.513) [-550.665] (-551.837) -- 0:01:04
123000 -- (-551.001) (-549.697) (-552.741) [-554.174] * [-550.785] (-552.072) (-549.121) (-552.412) -- 0:01:04
123500 -- (-551.197) [-552.401] (-551.873) (-548.689) * (-553.894) [-550.683] (-550.394) (-552.484) -- 0:01:03
124000 -- (-551.329) (-550.827) (-551.248) [-548.775] * (-550.962) (-551.278) (-554.690) [-552.766] -- 0:01:03
124500 -- (-555.070) (-552.439) (-550.456) [-550.683] * [-548.801] (-552.777) (-552.255) (-553.483) -- 0:01:03
125000 -- (-552.470) (-551.510) [-551.308] (-551.273) * (-550.316) (-552.572) [-550.896] (-552.608) -- 0:01:03
Average standard deviation of split frequencies: 0.016649
125500 -- [-552.931] (-550.661) (-552.063) (-551.378) * (-552.234) [-552.288] (-550.042) (-554.905) -- 0:01:02
126000 -- (-554.030) [-550.933] (-554.884) (-549.001) * (-550.214) (-554.056) [-549.241] (-550.716) -- 0:01:02
126500 -- (-554.488) (-551.214) (-553.318) [-554.215] * (-554.351) [-550.898] (-550.560) (-552.292) -- 0:01:02
127000 -- (-550.667) (-550.836) [-552.863] (-553.022) * (-550.979) (-550.977) (-555.037) [-552.402] -- 0:01:01
127500 -- (-550.215) (-551.206) (-551.831) [-552.105] * (-549.199) [-550.461] (-551.837) (-554.343) -- 0:01:01
128000 -- (-548.790) [-550.556] (-551.943) (-551.120) * (-549.698) (-552.724) [-549.245] (-553.429) -- 0:01:01
128500 -- (-549.442) (-552.389) (-552.394) [-550.351] * (-551.862) [-551.884] (-549.347) (-556.614) -- 0:01:07
129000 -- (-553.105) (-554.022) (-551.174) [-549.366] * (-551.994) (-549.857) [-550.034] (-552.592) -- 0:01:07
129500 -- (-552.002) [-550.738] (-551.523) (-552.148) * (-556.722) (-553.339) [-550.276] (-550.628) -- 0:01:07
130000 -- (-550.843) (-554.425) (-550.168) [-552.335] * (-549.966) [-551.674] (-549.686) (-554.387) -- 0:01:06
Average standard deviation of split frequencies: 0.017497
130500 -- (-551.363) [-551.621] (-552.790) (-549.575) * [-549.668] (-550.434) (-549.986) (-550.867) -- 0:01:06
131000 -- (-550.357) [-550.617] (-551.076) (-550.907) * (-554.993) (-552.802) (-551.024) [-549.800] -- 0:01:06
131500 -- [-549.853] (-551.730) (-550.745) (-551.562) * [-553.053] (-548.406) (-552.343) (-552.088) -- 0:01:06
132000 -- (-554.330) (-554.129) [-551.122] (-557.067) * [-550.840] (-551.368) (-553.203) (-551.363) -- 0:01:05
132500 -- (-550.357) (-553.559) [-553.231] (-550.366) * (-552.936) (-550.107) [-550.161] (-550.900) -- 0:01:05
133000 -- [-550.730] (-549.196) (-549.967) (-550.746) * (-551.024) (-554.393) (-556.479) [-552.727] -- 0:01:05
133500 -- (-553.422) (-550.208) (-553.592) [-551.716] * [-551.131] (-549.651) (-550.025) (-555.017) -- 0:01:04
134000 -- (-550.986) (-550.255) (-553.600) [-552.153] * (-552.392) [-551.298] (-551.141) (-551.429) -- 0:01:04
134500 -- (-550.661) [-550.443] (-556.361) (-554.830) * (-553.035) (-550.629) [-551.585] (-550.741) -- 0:01:04
135000 -- [-550.867] (-554.566) (-554.262) (-552.771) * [-550.225] (-550.389) (-551.493) (-553.895) -- 0:01:04
Average standard deviation of split frequencies: 0.019237
135500 -- (-549.735) (-551.231) [-551.908] (-549.588) * [-548.925] (-548.965) (-553.241) (-551.120) -- 0:01:03
136000 -- (-554.428) [-553.619] (-549.387) (-551.715) * (-552.047) (-551.349) [-552.905] (-553.253) -- 0:01:03
136500 -- (-553.821) [-552.091] (-554.517) (-551.644) * (-553.181) (-551.206) [-554.014] (-558.905) -- 0:01:03
137000 -- (-560.524) (-551.770) [-552.027] (-554.862) * (-551.697) (-554.825) [-550.966] (-554.467) -- 0:01:02
137500 -- (-554.729) (-552.875) [-552.102] (-552.511) * (-551.311) (-551.292) [-551.191] (-554.087) -- 0:01:02
138000 -- (-551.594) (-550.444) (-551.762) [-556.955] * (-550.452) [-550.932] (-549.815) (-551.590) -- 0:01:02
138500 -- [-552.536] (-548.469) (-549.414) (-552.437) * (-550.643) (-551.456) (-552.955) [-550.870] -- 0:01:02
139000 -- (-554.949) (-549.949) (-551.096) [-552.819] * (-551.191) (-549.858) (-551.673) [-551.868] -- 0:01:01
139500 -- (-554.953) (-553.365) [-552.128] (-552.862) * (-551.705) (-552.334) [-552.035] (-553.953) -- 0:01:01
140000 -- (-552.621) (-549.439) [-552.020] (-553.413) * (-551.932) [-550.937] (-550.653) (-560.088) -- 0:01:01
Average standard deviation of split frequencies: 0.017687
140500 -- (-550.311) [-549.189] (-550.996) (-551.442) * [-551.348] (-553.863) (-555.302) (-552.437) -- 0:01:01
141000 -- (-552.972) (-551.381) (-551.393) [-551.156] * (-550.132) (-553.380) [-550.125] (-552.806) -- 0:01:00
141500 -- [-551.542] (-548.711) (-552.904) (-550.446) * (-553.785) (-551.123) [-550.136] (-553.631) -- 0:01:00
142000 -- (-550.928) (-552.452) [-553.464] (-554.443) * (-552.280) (-553.668) [-549.340] (-553.314) -- 0:01:00
142500 -- (-552.356) [-550.868] (-553.067) (-554.912) * (-552.067) (-551.186) (-550.781) [-549.273] -- 0:01:06
143000 -- (-551.831) [-548.376] (-550.428) (-551.092) * [-549.849] (-553.527) (-549.075) (-552.491) -- 0:01:05
143500 -- (-557.841) (-550.473) [-554.479] (-552.583) * [-553.715] (-552.506) (-550.442) (-550.333) -- 0:01:05
144000 -- (-551.799) (-554.965) [-550.819] (-553.933) * (-552.256) (-555.958) [-549.059] (-549.965) -- 0:01:05
144500 -- (-549.867) (-552.045) (-551.587) [-554.485] * (-551.890) (-549.870) [-551.070] (-550.914) -- 0:01:05
145000 -- (-549.871) [-548.460] (-554.609) (-552.123) * (-551.228) (-552.857) (-551.607) [-549.937] -- 0:01:04
Average standard deviation of split frequencies: 0.015634
145500 -- [-549.286] (-550.846) (-553.068) (-555.134) * (-555.808) (-552.894) [-549.573] (-551.794) -- 0:01:04
146000 -- [-551.470] (-551.134) (-552.780) (-550.504) * (-551.141) (-552.538) [-549.964] (-550.071) -- 0:01:04
146500 -- (-554.339) (-552.395) (-557.792) [-552.687] * (-551.617) [-553.487] (-550.585) (-551.302) -- 0:01:04
147000 -- [-554.659] (-554.647) (-551.406) (-552.712) * (-554.271) (-553.075) [-548.821] (-550.064) -- 0:01:03
147500 -- (-549.528) (-551.354) (-555.839) [-551.019] * (-554.300) (-552.417) (-551.121) [-554.675] -- 0:01:03
148000 -- (-549.326) (-553.393) (-553.764) [-557.546] * (-551.342) (-549.597) (-550.903) [-552.084] -- 0:01:03
148500 -- [-552.590] (-552.317) (-550.997) (-554.303) * [-551.014] (-550.680) (-550.905) (-555.816) -- 0:01:03
149000 -- (-549.790) (-555.439) (-549.700) [-551.367] * [-554.373] (-551.794) (-553.265) (-552.220) -- 0:01:02
149500 -- (-547.943) (-552.034) (-552.885) [-550.480] * [-551.378] (-555.133) (-551.309) (-553.300) -- 0:01:02
150000 -- [-548.596] (-551.450) (-551.986) (-551.299) * [-552.297] (-549.876) (-552.187) (-553.415) -- 0:01:02
Average standard deviation of split frequencies: 0.016303
150500 -- (-550.328) (-550.602) [-552.125] (-550.296) * (-553.832) [-550.646] (-551.469) (-553.775) -- 0:01:02
151000 -- (-550.855) [-551.592] (-553.340) (-551.978) * (-554.263) (-551.968) [-553.505] (-552.277) -- 0:01:01
151500 -- (-551.499) [-552.043] (-551.199) (-552.026) * [-553.912] (-551.358) (-551.316) (-550.159) -- 0:01:01
152000 -- [-550.934] (-552.584) (-550.549) (-552.044) * (-552.610) [-549.705] (-554.953) (-549.799) -- 0:01:01
152500 -- (-556.722) [-557.055] (-555.584) (-549.646) * (-556.767) [-553.012] (-551.318) (-552.913) -- 0:01:01
153000 -- (-552.170) (-551.630) (-553.055) [-551.656] * [-550.759] (-550.317) (-550.444) (-549.613) -- 0:01:00
153500 -- (-549.234) (-549.211) [-553.583] (-550.084) * (-553.420) (-550.397) [-553.657] (-549.247) -- 0:01:00
154000 -- (-553.261) [-550.698] (-553.856) (-548.574) * (-550.274) [-551.174] (-555.517) (-550.992) -- 0:01:00
154500 -- [-550.297] (-551.546) (-552.292) (-552.635) * (-551.015) (-549.406) [-548.998] (-553.122) -- 0:01:00
155000 -- (-549.291) (-551.937) (-551.422) [-554.030] * [-552.018] (-554.311) (-550.844) (-551.754) -- 0:00:59
Average standard deviation of split frequencies: 0.016063
155500 -- [-548.933] (-550.446) (-551.313) (-552.036) * (-550.975) [-553.268] (-552.107) (-550.126) -- 0:00:59
156000 -- (-558.501) [-551.786] (-551.326) (-551.560) * (-552.899) (-553.128) [-552.781] (-548.434) -- 0:00:59
156500 -- [-552.761] (-552.267) (-551.203) (-548.963) * (-553.249) [-551.474] (-553.961) (-555.058) -- 0:01:04
157000 -- (-550.347) (-552.198) [-549.184] (-553.902) * (-550.999) [-550.133] (-554.486) (-549.868) -- 0:01:04
157500 -- [-551.826] (-559.773) (-551.266) (-551.552) * (-553.885) (-551.273) (-550.306) [-550.868] -- 0:01:04
158000 -- (-551.740) [-553.667] (-551.301) (-556.425) * [-551.046] (-550.580) (-553.323) (-553.752) -- 0:01:03
158500 -- (-551.796) (-550.714) [-552.803] (-549.844) * (-552.078) (-551.958) [-557.936] (-551.801) -- 0:01:03
159000 -- (-550.450) (-553.108) (-548.534) [-549.968] * (-552.525) [-553.054] (-558.215) (-548.387) -- 0:01:03
159500 -- (-551.763) (-550.495) [-549.748] (-552.202) * (-551.784) [-554.155] (-551.347) (-552.951) -- 0:01:03
160000 -- (-551.227) (-551.250) [-551.868] (-551.584) * (-551.916) (-557.436) (-552.191) [-552.204] -- 0:01:02
Average standard deviation of split frequencies: 0.015597
160500 -- [-550.632] (-548.748) (-551.641) (-551.690) * (-553.341) [-554.519] (-551.578) (-551.354) -- 0:01:02
161000 -- (-553.482) (-555.092) (-553.867) [-548.373] * [-551.682] (-550.067) (-554.826) (-551.758) -- 0:01:02
161500 -- (-549.973) (-551.548) (-552.509) [-550.052] * (-551.635) (-548.635) (-549.878) [-552.338] -- 0:01:02
162000 -- (-550.533) [-552.851] (-551.727) (-551.118) * (-553.859) [-550.612] (-551.071) (-552.919) -- 0:01:02
162500 -- [-549.863] (-548.903) (-550.767) (-550.143) * (-550.920) (-550.193) [-552.666] (-553.458) -- 0:01:01
163000 -- [-552.636] (-548.852) (-548.908) (-550.151) * [-554.904] (-551.674) (-550.971) (-552.368) -- 0:01:01
163500 -- [-552.210] (-548.952) (-551.686) (-552.661) * (-554.271) [-552.632] (-551.315) (-551.617) -- 0:01:01
164000 -- (-549.302) [-550.063] (-552.311) (-549.387) * (-552.545) (-550.925) [-551.487] (-551.182) -- 0:01:01
164500 -- [-551.091] (-550.722) (-553.845) (-547.494) * (-550.956) (-548.703) (-549.765) [-551.690] -- 0:01:00
165000 -- (-549.893) [-549.870] (-553.728) (-552.297) * (-552.537) (-551.161) (-549.903) [-553.802] -- 0:01:00
Average standard deviation of split frequencies: 0.016329
165500 -- (-556.889) [-550.312] (-552.906) (-553.227) * (-550.647) [-551.058] (-551.308) (-555.694) -- 0:01:00
166000 -- (-552.177) (-551.447) (-556.451) [-550.631] * [-551.880] (-550.402) (-550.549) (-551.771) -- 0:01:00
166500 -- (-550.608) [-551.454] (-552.366) (-548.883) * [-552.098] (-553.538) (-551.145) (-551.378) -- 0:01:00
167000 -- (-552.213) [-550.499] (-550.107) (-549.643) * [-553.887] (-552.650) (-552.331) (-549.090) -- 0:00:59
167500 -- (-550.342) (-549.785) [-551.917] (-552.138) * [-550.249] (-553.645) (-549.962) (-553.598) -- 0:00:59
168000 -- [-551.251] (-549.643) (-558.400) (-550.054) * (-553.011) (-552.760) [-550.466] (-552.770) -- 0:00:59
168500 -- [-551.877] (-553.955) (-550.992) (-550.479) * (-554.558) (-551.973) [-550.013] (-549.410) -- 0:00:59
169000 -- (-552.079) (-556.339) [-550.763] (-549.278) * (-551.457) (-552.590) (-550.192) [-552.028] -- 0:00:59
169500 -- (-552.210) (-550.839) (-553.048) [-550.303] * (-551.866) [-553.511] (-552.652) (-554.161) -- 0:00:58
170000 -- (-554.502) (-552.093) [-553.089] (-551.429) * [-551.388] (-551.271) (-551.899) (-558.164) -- 0:00:58
Average standard deviation of split frequencies: 0.016282
170500 -- (-552.004) [-553.090] (-551.266) (-549.298) * (-552.169) (-553.593) [-551.247] (-549.027) -- 0:01:03
171000 -- (-548.701) (-553.218) (-550.569) [-550.255] * (-553.769) (-552.316) [-549.538] (-553.878) -- 0:01:03
171500 -- [-548.700] (-553.371) (-549.376) (-550.956) * (-550.420) [-551.896] (-552.430) (-550.032) -- 0:01:02
172000 -- (-550.978) (-552.460) (-553.946) [-552.551] * [-549.080] (-554.580) (-550.737) (-552.356) -- 0:01:02
172500 -- (-550.033) (-551.222) [-552.345] (-550.478) * (-551.760) (-551.797) [-549.961] (-552.794) -- 0:01:02
173000 -- (-550.252) (-552.227) (-549.757) [-548.175] * [-549.993] (-550.519) (-551.327) (-555.204) -- 0:01:02
173500 -- (-552.484) (-550.255) (-554.894) [-549.667] * (-551.164) (-554.430) (-551.324) [-550.184] -- 0:01:01
174000 -- (-553.787) (-549.534) [-552.807] (-554.062) * (-550.162) (-553.042) [-551.391] (-550.866) -- 0:01:01
174500 -- (-549.881) (-553.144) (-550.786) [-550.248] * (-551.664) (-553.723) (-550.571) [-553.135] -- 0:01:01
175000 -- (-552.240) (-549.361) [-552.106] (-550.685) * (-550.427) [-551.174] (-548.979) (-549.216) -- 0:01:01
Average standard deviation of split frequencies: 0.015789
175500 -- (-550.988) (-549.217) (-552.032) [-551.945] * (-551.926) (-552.013) [-553.226] (-550.114) -- 0:01:01
176000 -- (-552.166) (-551.670) (-553.082) [-553.811] * [-555.251] (-553.736) (-550.188) (-551.711) -- 0:01:00
176500 -- (-549.068) (-551.220) (-551.189) [-553.631] * (-550.826) (-552.322) (-550.379) [-549.226] -- 0:01:00
177000 -- [-549.228] (-550.639) (-553.454) (-548.490) * [-551.576] (-551.632) (-549.342) (-550.887) -- 0:01:00
177500 -- (-552.612) [-550.424] (-554.520) (-550.443) * (-552.937) (-554.333) (-550.497) [-551.005] -- 0:01:00
178000 -- (-551.518) (-550.477) (-551.077) [-551.681] * (-554.508) (-551.195) (-552.307) [-550.918] -- 0:01:00
178500 -- [-551.574] (-550.610) (-551.483) (-550.503) * (-552.512) (-549.673) (-552.593) [-549.163] -- 0:00:59
179000 -- (-548.158) (-553.959) (-550.417) [-550.154] * (-552.456) (-553.021) [-548.849] (-549.920) -- 0:00:59
179500 -- [-550.132] (-548.663) (-551.666) (-548.833) * (-552.267) (-552.724) [-550.203] (-551.872) -- 0:00:59
180000 -- (-549.272) (-554.539) (-552.332) [-551.617] * [-551.024] (-551.562) (-550.665) (-553.589) -- 0:00:59
Average standard deviation of split frequencies: 0.016342
180500 -- (-551.153) (-552.205) (-551.946) [-551.712] * (-551.333) [-552.316] (-555.563) (-551.178) -- 0:00:59
181000 -- [-555.540] (-553.749) (-553.360) (-550.910) * (-552.065) [-551.759] (-551.115) (-552.812) -- 0:00:58
181500 -- (-551.767) [-556.178] (-552.088) (-551.538) * [-551.334] (-552.493) (-551.025) (-554.645) -- 0:00:58
182000 -- (-550.182) (-552.655) (-551.878) [-551.593] * (-551.340) (-552.571) [-551.413] (-554.532) -- 0:00:58
182500 -- (-551.325) (-550.334) [-549.494] (-551.774) * [-549.436] (-551.714) (-549.408) (-549.266) -- 0:00:58
183000 -- (-550.873) [-551.527] (-551.731) (-553.433) * (-554.437) (-553.495) [-549.913] (-551.376) -- 0:00:58
183500 -- [-551.966] (-552.536) (-552.176) (-553.164) * (-554.363) [-551.219] (-549.177) (-551.248) -- 0:00:57
184000 -- [-550.752] (-551.975) (-550.692) (-551.896) * (-553.420) (-561.215) (-550.957) [-553.698] -- 0:00:57
184500 -- (-552.194) (-551.391) [-549.570] (-555.248) * (-552.927) (-552.132) (-555.616) [-549.843] -- 0:01:01
185000 -- (-549.252) (-554.259) (-550.512) [-553.455] * [-555.237] (-551.642) (-550.310) (-550.875) -- 0:01:01
Average standard deviation of split frequencies: 0.016007
185500 -- (-551.149) (-558.622) (-549.501) [-550.921] * [-552.053] (-550.540) (-549.786) (-550.372) -- 0:01:01
186000 -- (-552.065) (-554.420) [-550.904] (-552.556) * (-551.209) (-551.261) [-551.335] (-552.223) -- 0:01:01
186500 -- (-552.909) (-552.851) (-551.583) [-550.328] * (-552.560) (-551.645) [-551.064] (-549.226) -- 0:01:01
187000 -- (-551.103) [-553.706] (-554.725) (-550.569) * [-550.891] (-554.018) (-549.938) (-553.613) -- 0:01:00
187500 -- (-550.918) (-554.123) (-552.427) [-554.259] * (-552.779) (-552.017) (-549.142) [-549.897] -- 0:01:00
188000 -- (-550.277) (-552.156) (-550.516) [-549.483] * (-550.786) [-550.774] (-550.673) (-552.863) -- 0:01:00
188500 -- (-548.536) (-551.558) (-553.007) [-550.017] * [-549.758] (-550.800) (-556.268) (-549.657) -- 0:01:00
189000 -- [-549.268] (-551.843) (-552.737) (-552.524) * (-550.547) [-551.278] (-551.725) (-553.970) -- 0:01:00
189500 -- (-550.037) (-550.443) (-550.910) [-550.247] * [-550.596] (-550.971) (-550.128) (-548.471) -- 0:00:59
190000 -- (-555.726) [-551.928] (-551.478) (-550.703) * [-551.611] (-550.512) (-550.940) (-554.920) -- 0:00:59
Average standard deviation of split frequencies: 0.016526
190500 -- (-554.943) (-552.075) [-550.752] (-551.181) * (-550.340) (-549.592) [-550.202] (-553.819) -- 0:00:59
191000 -- (-557.866) [-548.889] (-551.690) (-552.343) * (-551.338) (-549.919) [-548.772] (-550.854) -- 0:00:59
191500 -- (-552.218) [-550.200] (-551.912) (-553.652) * (-550.132) (-554.890) (-550.702) [-552.223] -- 0:00:59
192000 -- (-549.068) [-550.102] (-550.965) (-550.753) * (-551.989) (-549.184) (-550.659) [-551.611] -- 0:00:58
192500 -- [-550.195] (-551.929) (-550.181) (-551.536) * (-552.318) [-549.738] (-550.912) (-551.086) -- 0:00:58
193000 -- (-550.195) (-551.437) [-552.818] (-549.738) * (-548.257) [-551.424] (-549.053) (-551.499) -- 0:00:58
193500 -- (-552.663) [-550.735] (-550.965) (-553.186) * (-550.422) [-549.810] (-551.896) (-553.833) -- 0:00:58
194000 -- (-551.180) [-550.489] (-552.614) (-553.126) * (-550.848) (-550.764) [-552.467] (-553.070) -- 0:00:58
194500 -- [-549.563] (-552.004) (-551.458) (-552.363) * (-547.849) (-552.951) (-550.871) [-549.090] -- 0:00:57
195000 -- [-550.568] (-552.102) (-550.651) (-551.341) * [-550.511] (-554.789) (-549.407) (-552.573) -- 0:00:57
Average standard deviation of split frequencies: 0.014832
195500 -- (-553.450) [-551.656] (-551.690) (-552.641) * [-549.334] (-550.144) (-548.552) (-550.647) -- 0:00:57
196000 -- (-553.449) [-551.924] (-555.584) (-553.809) * (-551.274) (-551.244) (-551.615) [-551.328] -- 0:00:57
196500 -- [-551.963] (-557.275) (-551.227) (-553.079) * (-551.167) (-549.990) (-548.834) [-551.023] -- 0:00:57
197000 -- (-550.527) (-551.390) [-550.741] (-556.015) * (-550.452) (-553.007) [-550.591] (-551.331) -- 0:00:57
197500 -- (-551.645) [-550.881] (-551.620) (-552.667) * [-549.666] (-554.763) (-552.235) (-549.833) -- 0:00:56
198000 -- [-549.938] (-549.577) (-557.232) (-553.576) * (-552.666) [-552.169] (-550.374) (-551.920) -- 0:00:56
198500 -- (-551.753) [-550.313] (-552.145) (-553.132) * (-549.681) (-551.172) (-550.266) [-550.034] -- 0:01:00
199000 -- (-550.455) (-550.717) [-550.218] (-553.372) * (-550.340) [-550.401] (-550.277) (-548.542) -- 0:01:00
199500 -- [-554.793] (-554.918) (-554.069) (-552.599) * (-554.311) [-548.129] (-553.950) (-549.722) -- 0:01:00
200000 -- (-553.992) (-553.423) (-552.320) [-549.249] * (-551.993) [-549.909] (-550.864) (-550.958) -- 0:00:59
Average standard deviation of split frequencies: 0.013965
200500 -- (-556.865) (-554.185) [-553.899] (-551.738) * [-550.219] (-555.635) (-552.878) (-550.369) -- 0:00:59
201000 -- (-551.962) (-553.424) [-552.716] (-552.071) * (-550.588) [-554.265] (-553.103) (-550.803) -- 0:00:59
201500 -- (-553.130) [-552.028] (-554.865) (-550.956) * (-553.637) (-549.333) [-550.671] (-551.516) -- 0:00:59
202000 -- (-551.731) (-552.953) [-552.680] (-550.316) * (-553.229) [-552.687] (-551.640) (-552.725) -- 0:00:59
202500 -- (-552.638) (-552.098) [-548.676] (-552.961) * [-553.805] (-549.246) (-551.544) (-551.511) -- 0:00:59
203000 -- (-551.572) (-552.710) [-550.696] (-551.186) * (-550.063) (-551.790) (-550.823) [-550.456] -- 0:00:58
203500 -- (-550.193) [-548.365] (-554.365) (-552.206) * (-549.290) [-550.181] (-552.409) (-550.729) -- 0:00:58
204000 -- (-550.030) (-551.756) (-552.305) [-551.065] * [-552.347] (-550.746) (-553.171) (-552.990) -- 0:00:58
204500 -- (-549.908) (-550.183) [-552.714] (-550.460) * (-551.756) [-553.601] (-550.103) (-553.755) -- 0:00:58
205000 -- (-551.830) [-550.170] (-551.237) (-554.616) * (-550.608) (-552.588) [-555.438] (-551.637) -- 0:00:58
Average standard deviation of split frequencies: 0.014453
205500 -- (-549.509) [-551.386] (-552.888) (-550.997) * [-548.602] (-551.636) (-552.392) (-552.135) -- 0:00:57
206000 -- (-553.008) (-550.200) (-548.731) [-550.718] * (-550.012) (-550.217) [-548.778] (-551.374) -- 0:00:57
206500 -- (-550.174) [-552.940] (-549.180) (-555.558) * [-550.786] (-553.211) (-552.413) (-550.204) -- 0:00:57
207000 -- [-551.211] (-551.039) (-550.876) (-549.993) * (-549.445) [-550.803] (-550.262) (-549.160) -- 0:00:57
207500 -- (-551.446) [-550.407] (-552.413) (-548.376) * (-554.315) [-551.654] (-552.348) (-554.444) -- 0:00:57
208000 -- (-552.995) [-550.292] (-551.475) (-551.350) * (-552.231) (-548.661) (-548.704) [-549.414] -- 0:00:57
208500 -- (-548.895) (-550.578) [-550.406] (-551.399) * (-551.018) (-551.587) (-549.125) [-549.786] -- 0:00:56
209000 -- [-550.316] (-551.743) (-551.487) (-549.671) * [-550.526] (-551.684) (-553.525) (-553.963) -- 0:00:56
209500 -- (-549.965) [-550.652] (-551.856) (-552.392) * (-548.942) (-551.078) [-554.788] (-550.276) -- 0:00:56
210000 -- (-549.918) [-551.118] (-552.584) (-552.207) * [-550.120] (-552.886) (-556.491) (-549.857) -- 0:00:56
Average standard deviation of split frequencies: 0.015166
210500 -- (-549.723) (-551.067) (-551.727) [-551.155] * (-555.428) (-550.060) [-553.790] (-552.537) -- 0:00:56
211000 -- (-552.273) [-551.430] (-550.717) (-551.217) * (-549.777) (-550.974) (-553.381) [-552.135] -- 0:00:56
211500 -- (-550.530) [-556.171] (-548.546) (-552.545) * [-549.544] (-551.843) (-549.471) (-552.208) -- 0:00:55
212000 -- [-549.034] (-556.002) (-551.865) (-553.977) * (-549.605) (-550.041) (-549.726) [-551.762] -- 0:00:55
212500 -- (-552.494) [-553.901] (-555.130) (-550.922) * (-551.345) (-554.335) [-549.555] (-551.492) -- 0:00:59
213000 -- [-554.579] (-557.012) (-554.556) (-550.528) * (-551.009) [-549.302] (-550.970) (-550.752) -- 0:00:59
213500 -- (-557.079) (-550.834) (-553.083) [-551.309] * (-551.123) [-551.161] (-549.801) (-551.056) -- 0:00:58
214000 -- (-552.596) (-553.475) (-553.205) [-552.021] * (-555.396) (-551.572) (-554.491) [-554.193] -- 0:00:58
214500 -- (-551.684) (-551.786) [-548.965] (-553.177) * (-551.262) (-553.469) [-553.429] (-551.936) -- 0:00:58
215000 -- (-554.978) (-553.287) [-550.433] (-557.045) * (-548.568) (-555.674) (-554.554) [-551.523] -- 0:00:58
Average standard deviation of split frequencies: 0.015883
215500 -- (-550.511) (-550.921) [-550.628] (-549.135) * [-550.179] (-556.339) (-554.522) (-551.940) -- 0:00:58
216000 -- [-548.186] (-551.895) (-550.163) (-550.508) * (-549.750) [-551.644] (-555.584) (-549.129) -- 0:00:58
216500 -- (-552.069) (-554.398) [-549.937] (-550.987) * (-551.111) (-550.906) (-552.810) [-550.283] -- 0:00:57
217000 -- (-550.954) [-549.745] (-548.848) (-553.099) * (-554.278) (-551.030) (-551.892) [-552.166] -- 0:00:57
217500 -- (-551.322) [-552.792] (-548.981) (-555.212) * (-551.492) (-548.808) [-551.239] (-552.355) -- 0:00:57
218000 -- (-550.676) [-552.192] (-550.021) (-554.947) * (-549.940) (-550.544) [-551.663] (-552.519) -- 0:00:57
218500 -- [-550.334] (-550.592) (-550.194) (-552.622) * (-552.229) (-552.844) (-550.834) [-552.461] -- 0:00:57
219000 -- (-549.167) (-550.485) (-550.660) [-551.885] * (-552.189) (-550.431) [-549.264] (-553.135) -- 0:00:57
219500 -- (-549.976) (-548.823) (-550.689) [-552.532] * (-549.816) (-550.768) (-552.889) [-553.025] -- 0:00:56
220000 -- [-549.652] (-551.120) (-556.183) (-551.009) * [-548.466] (-552.198) (-550.675) (-552.629) -- 0:00:56
Average standard deviation of split frequencies: 0.016022
220500 -- (-550.041) [-551.160] (-550.636) (-549.781) * (-550.030) (-549.943) (-551.050) [-548.935] -- 0:00:56
221000 -- (-551.982) (-550.283) [-551.189] (-552.105) * (-550.859) (-550.976) (-551.464) [-549.949] -- 0:00:56
221500 -- [-549.896] (-551.062) (-550.242) (-550.876) * (-549.685) [-550.400] (-553.048) (-549.160) -- 0:00:56
222000 -- (-549.694) (-553.850) (-550.369) [-552.384] * (-550.893) (-554.165) [-550.540] (-551.747) -- 0:00:56
222500 -- (-551.953) [-553.006] (-550.215) (-553.484) * (-553.100) [-551.654] (-551.782) (-554.913) -- 0:00:55
223000 -- (-549.043) (-553.685) (-555.619) [-551.469] * (-554.196) [-552.014] (-550.495) (-551.217) -- 0:00:55
223500 -- [-550.969] (-550.832) (-552.119) (-551.197) * (-552.269) (-552.300) (-548.973) [-550.141] -- 0:00:55
224000 -- (-548.671) (-551.812) [-554.418] (-552.524) * [-551.995] (-550.448) (-552.619) (-553.211) -- 0:00:55
224500 -- (-549.388) (-552.513) [-551.398] (-552.995) * (-551.026) (-551.820) [-553.597] (-551.808) -- 0:00:55
225000 -- (-552.633) [-550.855] (-551.537) (-552.383) * (-549.284) (-550.260) [-551.458] (-553.574) -- 0:00:55
Average standard deviation of split frequencies: 0.015479
225500 -- (-553.094) [-552.295] (-553.502) (-550.476) * [-549.338] (-550.033) (-551.679) (-552.354) -- 0:00:54
226000 -- (-551.336) (-550.913) (-553.978) [-548.303] * [-549.002] (-552.611) (-550.960) (-552.494) -- 0:00:54
226500 -- (-555.605) [-551.833] (-553.777) (-551.153) * (-549.948) (-550.232) (-550.916) [-551.482] -- 0:00:58
227000 -- (-552.952) (-551.488) [-552.677] (-552.216) * [-549.091] (-549.131) (-551.895) (-556.002) -- 0:00:57
227500 -- (-555.443) (-551.988) [-549.727] (-552.874) * (-549.543) [-548.734] (-551.920) (-553.558) -- 0:00:57
228000 -- (-551.654) [-552.472] (-552.197) (-550.495) * (-550.451) (-552.589) [-551.872] (-548.188) -- 0:00:57
228500 -- (-551.207) [-551.281] (-553.036) (-550.907) * (-553.290) [-551.937] (-551.229) (-550.239) -- 0:00:57
229000 -- (-550.584) (-550.916) [-551.228] (-554.004) * (-550.841) (-554.646) [-554.861] (-554.059) -- 0:00:57
229500 -- (-550.757) (-551.196) [-552.818] (-553.326) * (-550.863) (-549.521) (-552.369) [-552.488] -- 0:00:57
230000 -- (-551.398) (-553.012) (-552.683) [-551.535] * (-552.214) [-553.367] (-551.932) (-550.470) -- 0:00:56
Average standard deviation of split frequencies: 0.016576
230500 -- [-549.111] (-554.866) (-553.900) (-549.966) * (-551.067) (-551.909) [-551.393] (-553.310) -- 0:00:56
231000 -- (-549.309) (-551.715) (-554.057) [-550.802] * (-555.049) [-552.416] (-552.755) (-549.206) -- 0:00:56
231500 -- (-551.657) (-551.182) [-553.185] (-548.845) * (-550.012) (-550.288) (-550.928) [-548.945] -- 0:00:56
232000 -- (-550.358) (-550.074) (-555.884) [-552.429] * [-552.518] (-548.143) (-551.192) (-553.137) -- 0:00:56
232500 -- (-552.595) (-553.607) [-550.803] (-548.805) * [-549.812] (-548.978) (-550.403) (-548.975) -- 0:00:56
233000 -- (-552.328) [-553.709] (-552.950) (-550.879) * (-551.457) (-552.522) (-552.237) [-550.038] -- 0:00:55
233500 -- (-553.124) (-551.477) [-552.881] (-549.093) * (-549.514) (-555.262) (-551.559) [-553.289] -- 0:00:55
234000 -- (-552.302) (-551.562) (-552.272) [-550.735] * (-552.385) [-556.638] (-555.582) (-550.279) -- 0:00:55
234500 -- (-551.455) (-551.331) [-550.864] (-554.219) * (-550.601) (-552.897) [-552.724] (-553.798) -- 0:00:55
235000 -- [-551.772] (-551.558) (-552.983) (-550.500) * (-551.833) (-552.199) [-551.757] (-552.494) -- 0:00:55
Average standard deviation of split frequencies: 0.017533
235500 -- (-553.447) [-551.018] (-550.907) (-550.374) * (-554.623) (-549.957) (-551.323) [-549.779] -- 0:00:55
236000 -- [-550.571] (-549.736) (-550.808) (-550.472) * (-552.849) (-549.678) (-553.262) [-550.094] -- 0:00:55
236500 -- (-553.290) (-552.935) (-550.296) [-551.310] * [-553.762] (-548.665) (-551.195) (-548.943) -- 0:00:54
237000 -- [-550.222] (-550.125) (-550.749) (-552.606) * (-554.133) (-550.369) [-551.505] (-551.858) -- 0:00:54
237500 -- (-550.569) (-552.193) [-550.259] (-552.146) * (-555.298) (-549.989) (-555.236) [-549.303] -- 0:00:54
238000 -- [-551.357] (-553.551) (-554.014) (-556.253) * [-551.216] (-551.480) (-554.813) (-552.758) -- 0:00:54
238500 -- (-553.277) (-553.084) (-552.971) [-552.144] * [-551.110] (-550.803) (-551.579) (-549.104) -- 0:00:54
239000 -- (-550.307) (-552.160) (-551.303) [-550.760] * (-553.666) (-549.935) (-552.261) [-548.998] -- 0:00:54
239500 -- [-552.537] (-551.731) (-550.367) (-551.102) * (-553.188) (-549.455) [-552.272] (-549.989) -- 0:00:53
240000 -- [-549.777] (-553.057) (-550.527) (-548.495) * (-554.969) (-553.292) (-551.540) [-550.982] -- 0:00:53
Average standard deviation of split frequencies: 0.016976
240500 -- (-552.685) [-552.862] (-551.097) (-550.968) * (-553.220) (-556.412) (-551.461) [-551.628] -- 0:00:56
241000 -- (-553.027) [-551.300] (-553.441) (-549.570) * [-554.387] (-557.164) (-552.659) (-550.122) -- 0:00:56
241500 -- (-555.957) (-552.736) [-552.634] (-550.712) * (-552.117) (-554.720) (-558.316) [-550.520] -- 0:00:56
242000 -- (-555.230) [-550.373] (-552.384) (-553.648) * (-555.991) (-557.448) [-551.860] (-552.448) -- 0:00:56
242500 -- (-555.557) (-553.365) [-550.818] (-550.614) * (-550.417) (-549.479) [-552.513] (-554.465) -- 0:00:56
243000 -- [-551.546] (-552.485) (-554.472) (-552.164) * [-552.724] (-548.132) (-553.917) (-556.678) -- 0:00:56
243500 -- (-554.256) (-553.852) (-554.861) [-550.971] * (-551.307) [-549.960] (-550.609) (-554.832) -- 0:00:55
244000 -- (-553.180) [-553.454] (-549.701) (-551.992) * (-547.868) (-552.971) [-550.189] (-551.219) -- 0:00:55
244500 -- [-553.110] (-551.068) (-553.287) (-551.465) * (-553.873) (-550.543) [-552.218] (-548.955) -- 0:00:55
245000 -- (-552.125) [-552.674] (-551.919) (-550.404) * [-548.803] (-550.261) (-551.466) (-553.117) -- 0:00:55
Average standard deviation of split frequencies: 0.015756
245500 -- (-550.224) (-552.604) [-550.956] (-552.607) * (-548.207) [-555.535] (-555.490) (-555.082) -- 0:00:55
246000 -- [-554.333] (-555.117) (-551.457) (-550.253) * [-550.136] (-556.504) (-554.151) (-551.506) -- 0:00:55
246500 -- (-552.608) (-552.681) [-549.670] (-552.025) * (-551.619) (-554.610) [-550.790] (-551.153) -- 0:00:55
247000 -- (-557.433) (-549.789) (-548.855) [-554.075] * (-549.886) [-551.626] (-551.093) (-551.392) -- 0:00:54
247500 -- (-555.724) (-556.169) [-548.671] (-550.015) * (-551.169) [-557.681] (-552.471) (-551.436) -- 0:00:54
248000 -- (-553.102) [-553.033] (-553.342) (-553.861) * (-550.687) (-550.090) (-550.548) [-553.080] -- 0:00:54
248500 -- [-550.664] (-554.114) (-551.407) (-550.082) * (-552.143) [-551.933] (-554.932) (-552.150) -- 0:00:54
249000 -- (-551.829) [-549.161] (-551.655) (-554.460) * (-550.175) [-553.121] (-553.938) (-551.145) -- 0:00:54
249500 -- (-551.228) (-549.251) (-555.945) [-550.308] * [-548.488] (-550.974) (-551.581) (-553.141) -- 0:00:54
250000 -- (-552.206) (-548.939) [-550.834] (-553.268) * (-552.511) [-550.222] (-550.582) (-551.487) -- 0:00:54
Average standard deviation of split frequencies: 0.014522
250500 -- [-551.291] (-554.306) (-553.997) (-552.829) * [-551.469] (-551.775) (-550.779) (-552.787) -- 0:00:53
251000 -- (-553.575) (-553.160) [-555.678] (-551.451) * (-551.431) [-552.494] (-553.436) (-550.076) -- 0:00:53
251500 -- (-552.050) (-552.089) [-549.011] (-554.008) * [-549.563] (-550.313) (-555.302) (-556.537) -- 0:00:53
252000 -- (-552.275) [-550.703] (-550.325) (-555.349) * (-550.011) (-552.545) (-554.856) [-550.857] -- 0:00:53
252500 -- [-551.851] (-553.521) (-550.070) (-555.091) * (-548.854) (-548.780) [-552.493] (-553.102) -- 0:00:53
253000 -- (-550.371) (-551.857) [-551.367] (-553.075) * (-552.045) (-553.527) [-552.316] (-552.067) -- 0:00:53
253500 -- (-555.630) [-549.552] (-553.145) (-551.310) * (-551.425) [-550.127] (-551.382) (-552.421) -- 0:00:53
254000 -- (-554.668) (-549.406) [-550.861] (-550.827) * (-551.483) (-550.318) [-549.065] (-558.679) -- 0:00:52
254500 -- (-550.189) [-552.771] (-555.817) (-551.248) * (-553.713) (-551.189) (-549.551) [-557.856] -- 0:00:55
255000 -- (-552.686) (-550.757) (-550.202) [-549.262] * (-553.306) (-552.176) (-550.821) [-556.002] -- 0:00:55
Average standard deviation of split frequencies: 0.013606
255500 -- (-551.452) [-549.190] (-553.818) (-557.566) * [-550.150] (-550.940) (-551.170) (-554.182) -- 0:00:55
256000 -- (-551.998) (-551.895) (-551.601) [-550.921] * (-551.705) (-551.347) [-554.078] (-553.044) -- 0:00:55
256500 -- (-550.654) [-549.268] (-551.646) (-550.851) * (-549.625) (-550.441) (-551.188) [-550.376] -- 0:00:55
257000 -- (-551.207) (-552.133) (-552.668) [-550.935] * (-550.258) (-550.903) (-553.616) [-551.272] -- 0:00:54
257500 -- [-551.500] (-550.884) (-556.856) (-549.060) * (-549.556) (-553.265) (-554.489) [-548.455] -- 0:00:54
258000 -- (-549.026) (-551.629) (-553.607) [-552.332] * (-550.542) (-551.865) (-552.037) [-550.978] -- 0:00:54
258500 -- (-551.804) (-552.622) [-552.499] (-558.190) * (-555.859) (-550.307) [-553.202] (-549.970) -- 0:00:54
259000 -- (-551.385) [-555.187] (-550.960) (-549.306) * (-552.257) [-551.373] (-551.038) (-552.421) -- 0:00:54
259500 -- [-549.766] (-552.258) (-552.655) (-549.898) * [-549.883] (-555.063) (-552.881) (-552.495) -- 0:00:54
260000 -- (-550.446) (-553.870) [-552.327] (-551.066) * (-548.680) [-557.240] (-551.490) (-552.360) -- 0:00:54
Average standard deviation of split frequencies: 0.013563
260500 -- (-557.439) (-553.262) (-550.555) [-551.388] * [-550.702] (-549.937) (-552.832) (-551.087) -- 0:00:53
261000 -- [-549.944] (-550.593) (-551.944) (-552.881) * (-551.978) (-548.705) (-550.342) [-549.851] -- 0:00:53
261500 -- [-549.033] (-550.999) (-550.851) (-550.857) * [-551.327] (-553.074) (-553.039) (-550.542) -- 0:00:53
262000 -- [-549.747] (-550.250) (-550.677) (-555.843) * [-550.159] (-552.130) (-551.420) (-551.398) -- 0:00:53
262500 -- (-550.529) [-550.396] (-549.461) (-552.460) * (-552.210) (-550.963) (-557.127) [-550.942] -- 0:00:53
263000 -- [-551.177] (-554.424) (-550.414) (-552.815) * (-553.642) [-551.943] (-554.192) (-551.782) -- 0:00:53
263500 -- (-550.667) [-550.587] (-550.723) (-553.250) * [-551.417] (-552.551) (-554.688) (-551.692) -- 0:00:53
264000 -- (-549.227) (-550.689) (-553.331) [-549.359] * (-548.407) (-551.033) [-549.792] (-551.822) -- 0:00:52
264500 -- [-549.558] (-551.302) (-553.475) (-552.579) * (-550.614) (-554.235) [-552.542] (-550.788) -- 0:00:52
265000 -- [-551.802] (-552.925) (-552.990) (-553.169) * (-548.881) (-557.305) (-555.112) [-552.408] -- 0:00:52
Average standard deviation of split frequencies: 0.014644
265500 -- [-549.059] (-552.387) (-549.872) (-550.501) * (-549.669) (-551.767) [-554.531] (-553.255) -- 0:00:52
266000 -- (-551.272) [-552.161] (-549.623) (-551.462) * (-551.740) (-552.410) [-553.971] (-554.033) -- 0:00:52
266500 -- (-548.501) (-550.216) (-550.064) [-550.940] * (-550.168) (-550.690) (-553.599) [-551.887] -- 0:00:52
267000 -- (-549.658) [-549.669] (-552.512) (-550.848) * (-552.096) [-551.321] (-549.684) (-553.916) -- 0:00:52
267500 -- [-549.057] (-550.076) (-552.897) (-550.902) * (-549.156) (-551.788) [-550.700] (-553.412) -- 0:00:52
268000 -- (-551.084) (-551.126) [-553.979] (-554.066) * (-550.153) (-552.354) (-551.413) [-552.591] -- 0:00:51
268500 -- (-549.049) (-551.089) [-551.108] (-550.678) * [-552.320] (-550.738) (-557.443) (-552.884) -- 0:00:54
269000 -- (-549.108) (-551.621) [-553.628] (-552.931) * (-554.605) [-552.952] (-555.725) (-552.098) -- 0:00:54
269500 -- (-549.420) (-552.912) [-552.300] (-549.971) * (-552.756) (-553.677) (-551.893) [-551.169] -- 0:00:54
270000 -- [-556.755] (-550.098) (-551.690) (-552.485) * (-552.787) [-552.521] (-553.364) (-550.821) -- 0:00:54
Average standard deviation of split frequencies: 0.014417
270500 -- (-551.182) (-550.781) [-553.118] (-550.579) * (-552.058) [-553.584] (-552.238) (-551.357) -- 0:00:53
271000 -- (-548.351) (-549.727) (-553.346) [-550.554] * (-552.399) (-554.984) [-551.272] (-550.166) -- 0:00:53
271500 -- (-551.994) [-551.760] (-550.729) (-552.524) * (-551.508) (-550.674) (-553.930) [-550.812] -- 0:00:53
272000 -- (-551.420) [-552.058] (-551.924) (-553.682) * (-551.118) (-550.039) [-550.291] (-551.511) -- 0:00:53
272500 -- (-550.405) (-553.550) (-553.531) [-552.201] * (-551.593) (-550.583) (-549.906) [-552.358] -- 0:00:53
273000 -- (-549.975) (-551.783) (-550.576) [-551.296] * (-553.680) (-552.084) [-550.762] (-550.563) -- 0:00:53
273500 -- (-552.431) (-550.099) [-551.770] (-551.791) * (-552.395) (-552.834) (-550.172) [-551.506] -- 0:00:53
274000 -- [-554.410] (-551.000) (-550.411) (-553.652) * [-554.542] (-556.874) (-550.048) (-552.471) -- 0:00:52
274500 -- (-552.263) (-551.476) (-551.726) [-552.277] * [-551.268] (-553.177) (-549.837) (-557.017) -- 0:00:52
275000 -- (-550.288) [-552.022] (-553.010) (-550.458) * [-550.470] (-553.746) (-553.547) (-555.273) -- 0:00:52
Average standard deviation of split frequencies: 0.014669
275500 -- (-552.569) (-550.410) [-550.221] (-551.344) * (-550.014) [-551.950] (-551.016) (-554.654) -- 0:00:52
276000 -- (-550.960) (-557.795) [-550.728] (-552.899) * (-552.881) (-553.875) [-554.315] (-551.896) -- 0:00:52
276500 -- (-550.681) (-551.744) (-552.573) [-554.573] * (-549.764) [-551.109] (-553.216) (-551.117) -- 0:00:52
277000 -- (-549.893) (-555.054) (-553.407) [-549.500] * (-552.536) (-550.423) (-551.587) [-553.520] -- 0:00:52
277500 -- [-550.028] (-556.417) (-552.838) (-551.369) * (-550.498) (-551.568) (-552.453) [-551.788] -- 0:00:52
278000 -- (-552.586) (-550.043) (-553.187) [-553.093] * [-551.970] (-554.015) (-553.169) (-552.090) -- 0:00:51
278500 -- (-552.525) [-552.912] (-551.207) (-553.344) * [-550.392] (-550.340) (-553.830) (-551.527) -- 0:00:51
279000 -- (-550.664) (-550.591) (-553.377) [-549.090] * (-550.165) (-552.323) (-550.279) [-549.630] -- 0:00:51
279500 -- (-549.404) [-550.505] (-556.033) (-550.942) * (-552.009) (-550.458) [-551.803] (-549.849) -- 0:00:51
280000 -- [-549.486] (-550.517) (-554.198) (-556.699) * (-550.895) [-551.327] (-552.768) (-554.455) -- 0:00:51
Average standard deviation of split frequencies: 0.013733
280500 -- (-551.640) (-551.337) (-553.501) [-554.292] * (-554.145) (-551.027) [-550.783] (-551.275) -- 0:00:51
281000 -- (-552.221) [-550.782] (-557.362) (-551.700) * (-551.015) [-551.440] (-550.348) (-550.026) -- 0:00:51
281500 -- (-552.445) (-554.405) (-554.917) [-550.604] * [-551.139] (-549.899) (-550.469) (-551.908) -- 0:00:51
282000 -- (-551.523) (-555.397) (-554.219) [-550.862] * (-551.965) [-550.060] (-552.633) (-548.181) -- 0:00:50
282500 -- (-549.622) [-551.008] (-552.014) (-553.552) * (-551.534) (-552.499) (-550.009) [-549.110] -- 0:00:53
283000 -- [-549.989] (-551.817) (-553.001) (-550.730) * (-550.577) (-549.358) [-552.933] (-550.062) -- 0:00:53
283500 -- [-552.158] (-550.089) (-552.639) (-550.511) * (-550.978) (-551.339) [-555.633] (-549.254) -- 0:00:53
284000 -- (-554.098) (-550.354) [-551.898] (-552.084) * (-553.019) [-551.256] (-558.315) (-552.932) -- 0:00:52
284500 -- (-551.909) [-550.130] (-553.382) (-551.128) * (-552.183) (-555.306) (-549.606) [-550.137] -- 0:00:52
285000 -- (-555.941) [-550.487] (-556.105) (-551.895) * (-552.347) (-554.052) [-550.856] (-552.118) -- 0:00:52
Average standard deviation of split frequencies: 0.014156
285500 -- (-551.973) (-554.275) (-551.639) [-550.447] * (-553.292) (-551.233) [-550.530] (-563.343) -- 0:00:52
286000 -- (-551.903) (-549.250) (-550.593) [-553.924] * (-550.862) (-550.441) (-551.101) [-552.109] -- 0:00:52
286500 -- [-548.725] (-555.023) (-552.106) (-556.377) * (-556.054) (-551.605) (-551.128) [-550.295] -- 0:00:52
287000 -- [-549.492] (-553.484) (-551.723) (-552.452) * (-550.809) (-551.768) (-551.709) [-551.507] -- 0:00:52
287500 -- [-551.311] (-549.545) (-556.137) (-550.861) * (-551.582) [-551.702] (-550.162) (-552.384) -- 0:00:52
288000 -- [-548.775] (-554.018) (-553.296) (-551.726) * [-551.116] (-549.538) (-552.058) (-554.058) -- 0:00:51
288500 -- (-551.282) [-550.323] (-554.481) (-552.391) * (-551.946) (-552.508) (-552.126) [-554.246] -- 0:00:51
289000 -- [-549.477] (-549.996) (-552.912) (-553.916) * (-550.971) (-553.516) [-552.811] (-552.149) -- 0:00:51
289500 -- (-550.854) [-548.573] (-553.785) (-552.049) * [-550.762] (-551.306) (-551.975) (-551.447) -- 0:00:51
290000 -- (-555.930) [-548.114] (-551.508) (-552.407) * (-551.387) (-552.522) [-551.597] (-550.775) -- 0:00:51
Average standard deviation of split frequencies: 0.014501
290500 -- [-550.982] (-548.919) (-553.145) (-554.589) * (-551.122) (-549.498) [-550.645] (-551.292) -- 0:00:51
291000 -- (-552.714) (-552.090) [-549.390] (-548.549) * [-550.189] (-550.348) (-551.948) (-551.880) -- 0:00:51
291500 -- (-552.389) (-551.313) [-551.245] (-557.113) * (-551.132) [-553.239] (-551.908) (-552.857) -- 0:00:51
292000 -- (-550.110) [-551.207] (-552.231) (-554.184) * (-554.883) (-550.484) (-548.501) [-551.738] -- 0:00:50
292500 -- (-552.955) (-550.610) (-551.173) [-548.902] * (-551.134) (-556.209) [-551.004] (-552.937) -- 0:00:50
293000 -- (-550.663) (-551.601) [-551.535] (-553.616) * (-550.754) [-551.333] (-557.106) (-553.460) -- 0:00:50
293500 -- (-551.578) [-550.581] (-553.355) (-551.839) * (-553.702) (-556.317) (-558.125) [-550.724] -- 0:00:50
294000 -- (-549.922) [-551.133] (-550.667) (-551.297) * (-550.452) (-549.810) [-551.491] (-551.229) -- 0:00:50
294500 -- [-552.647] (-553.283) (-553.341) (-550.194) * [-550.493] (-548.881) (-550.283) (-550.199) -- 0:00:50
295000 -- (-553.669) (-549.568) (-551.054) [-550.964] * (-551.484) [-550.063] (-550.881) (-553.894) -- 0:00:50
Average standard deviation of split frequencies: 0.014895
295500 -- (-551.235) (-551.261) (-555.657) [-549.213] * (-549.929) (-552.464) [-551.361] (-552.911) -- 0:00:50
296000 -- (-550.111) (-553.811) (-550.865) [-551.320] * [-550.250] (-550.314) (-551.559) (-553.279) -- 0:00:52
296500 -- (-554.169) (-550.660) [-551.450] (-548.594) * (-554.490) (-548.870) [-550.505] (-549.639) -- 0:00:52
297000 -- (-550.472) (-550.026) (-551.548) [-549.057] * (-551.713) [-550.281] (-553.212) (-551.438) -- 0:00:52
297500 -- [-554.063] (-549.504) (-552.259) (-550.960) * (-553.542) (-550.935) (-554.527) [-550.481] -- 0:00:51
298000 -- [-551.996] (-550.179) (-552.504) (-553.055) * (-551.568) (-551.210) (-554.307) [-551.917] -- 0:00:51
298500 -- [-550.012] (-551.528) (-557.188) (-554.469) * (-550.799) (-549.528) [-550.858] (-550.564) -- 0:00:51
299000 -- (-554.097) [-550.460] (-553.958) (-556.305) * (-550.675) (-551.791) [-552.519] (-554.203) -- 0:00:51
299500 -- (-553.830) [-551.401] (-551.929) (-554.070) * (-549.870) [-551.385] (-551.907) (-552.828) -- 0:00:51
300000 -- (-556.328) (-550.568) (-556.228) [-548.545] * (-548.889) (-550.211) [-550.443] (-553.402) -- 0:00:51
Average standard deviation of split frequencies: 0.014849
300500 -- [-555.180] (-550.620) (-553.596) (-552.861) * (-551.717) [-552.487] (-554.040) (-551.493) -- 0:00:51
301000 -- (-551.215) (-550.579) [-551.689] (-552.315) * [-551.631] (-552.296) (-553.150) (-550.707) -- 0:00:51
301500 -- (-550.784) (-553.053) [-551.050] (-549.471) * (-555.548) (-552.866) [-558.540] (-549.493) -- 0:00:50
302000 -- (-548.907) [-551.613] (-551.050) (-549.953) * (-551.408) (-550.696) (-552.114) [-551.137] -- 0:00:50
302500 -- (-548.841) [-551.214] (-551.711) (-553.717) * (-551.789) (-550.233) [-548.885] (-548.730) -- 0:00:50
303000 -- (-549.709) [-550.463] (-556.480) (-550.201) * [-551.664] (-551.983) (-555.395) (-548.778) -- 0:00:50
303500 -- (-551.932) (-551.767) (-553.479) [-552.799] * (-551.368) [-552.871] (-555.130) (-553.179) -- 0:00:50
304000 -- (-549.660) (-549.090) (-551.604) [-549.849] * (-550.656) [-551.183] (-553.637) (-550.121) -- 0:00:50
304500 -- [-551.272] (-550.476) (-551.258) (-552.104) * [-555.537] (-551.479) (-551.321) (-552.149) -- 0:00:50
305000 -- (-548.216) (-549.568) [-550.555] (-549.278) * [-550.467] (-555.258) (-551.125) (-554.373) -- 0:00:50
Average standard deviation of split frequencies: 0.015405
305500 -- [-549.255] (-550.127) (-551.253) (-547.675) * [-551.005] (-554.001) (-550.683) (-551.255) -- 0:00:50
306000 -- [-553.067] (-550.203) (-549.973) (-550.964) * (-550.870) (-551.340) (-553.066) [-549.802] -- 0:00:49
306500 -- (-552.243) (-550.274) [-550.130] (-549.498) * [-550.487] (-551.916) (-552.952) (-549.925) -- 0:00:49
307000 -- (-552.459) [-548.777] (-550.938) (-551.198) * (-554.837) [-550.206] (-549.835) (-551.784) -- 0:00:49
307500 -- (-550.469) (-552.511) (-550.807) [-548.894] * (-551.065) (-556.153) (-551.444) [-550.884] -- 0:00:49
308000 -- [-549.649] (-551.062) (-551.746) (-550.369) * (-551.750) (-550.162) [-550.930] (-551.793) -- 0:00:49
308500 -- (-550.491) (-553.665) [-548.961] (-550.238) * [-552.533] (-550.978) (-550.540) (-550.413) -- 0:00:49
309000 -- (-550.652) (-552.174) [-550.449] (-552.995) * (-553.631) [-551.582] (-550.635) (-551.425) -- 0:00:49
309500 -- (-551.684) [-552.301] (-549.796) (-551.379) * (-554.825) (-550.446) [-551.034] (-549.460) -- 0:00:51
310000 -- (-553.287) [-551.895] (-550.140) (-549.142) * (-549.993) (-553.713) (-549.700) [-551.028] -- 0:00:51
Average standard deviation of split frequencies: 0.014103
310500 -- (-547.937) (-549.808) (-553.932) [-552.805] * (-556.271) [-549.648] (-548.630) (-551.526) -- 0:00:51
311000 -- [-551.231] (-550.517) (-550.351) (-552.955) * [-553.101] (-549.448) (-551.333) (-550.135) -- 0:00:50
311500 -- (-556.256) (-551.464) (-553.077) [-555.631] * (-551.221) (-551.034) [-549.094] (-550.020) -- 0:00:50
312000 -- (-552.052) (-550.707) (-550.157) [-556.560] * (-550.731) (-551.190) [-549.215] (-547.841) -- 0:00:50
312500 -- (-560.129) [-550.945] (-549.918) (-550.925) * [-551.055] (-551.568) (-551.469) (-552.688) -- 0:00:50
313000 -- (-553.748) [-549.054] (-553.146) (-553.435) * [-551.290] (-550.944) (-549.058) (-551.325) -- 0:00:50
313500 -- (-554.883) (-550.310) [-551.087] (-551.508) * (-550.142) (-550.116) (-551.551) [-550.693] -- 0:00:50
314000 -- [-551.871] (-556.618) (-550.775) (-550.385) * (-549.214) [-550.865] (-551.346) (-550.460) -- 0:00:50
314500 -- [-550.949] (-552.431) (-551.514) (-551.360) * [-551.969] (-551.428) (-549.706) (-548.594) -- 0:00:50
315000 -- (-550.480) (-554.938) [-551.014] (-557.277) * (-550.722) (-550.621) [-549.499] (-551.894) -- 0:00:50
Average standard deviation of split frequencies: 0.014669
315500 -- [-550.120] (-553.484) (-549.770) (-554.659) * (-552.033) [-552.184] (-551.353) (-554.349) -- 0:00:49
316000 -- (-552.217) (-553.130) (-550.008) [-551.757] * [-551.699] (-551.032) (-548.868) (-550.342) -- 0:00:49
316500 -- (-550.368) (-554.810) (-551.620) [-553.742] * (-552.207) (-553.322) (-547.726) [-552.907] -- 0:00:49
317000 -- (-550.051) [-552.321] (-552.229) (-553.371) * (-552.134) (-551.760) [-548.585] (-554.302) -- 0:00:49
317500 -- (-549.528) (-552.788) (-557.391) [-552.159] * (-552.465) (-550.876) [-551.659] (-553.842) -- 0:00:49
318000 -- [-552.062] (-549.146) (-552.049) (-551.591) * (-548.879) (-552.343) [-549.700] (-551.980) -- 0:00:49
318500 -- (-550.062) (-551.601) [-551.008] (-554.716) * (-555.741) (-555.885) [-550.178] (-556.486) -- 0:00:49
319000 -- [-550.860] (-550.571) (-553.024) (-551.439) * (-551.653) (-552.784) [-552.096] (-554.803) -- 0:00:49
319500 -- [-550.855] (-551.322) (-550.705) (-554.090) * [-548.334] (-552.216) (-554.225) (-548.404) -- 0:00:48
320000 -- (-558.929) (-558.856) [-552.532] (-554.191) * (-550.304) (-553.270) (-551.135) [-550.364] -- 0:00:48
Average standard deviation of split frequencies: 0.014517
320500 -- (-548.942) (-553.231) (-548.899) [-552.280] * (-553.184) (-552.118) [-550.318] (-557.122) -- 0:00:48
321000 -- (-555.135) [-552.074] (-550.154) (-554.683) * (-551.021) [-550.340] (-549.350) (-551.688) -- 0:00:48
321500 -- (-549.711) (-550.881) (-548.691) [-551.435] * [-551.376] (-554.260) (-552.129) (-550.856) -- 0:00:48
322000 -- [-552.124] (-552.747) (-549.655) (-549.936) * [-548.888] (-555.386) (-554.707) (-555.004) -- 0:00:48
322500 -- [-549.694] (-552.179) (-552.051) (-556.086) * (-550.492) (-551.853) [-554.117] (-554.467) -- 0:00:48
323000 -- (-552.099) (-550.149) (-549.695) [-553.049] * (-553.484) [-550.087] (-554.060) (-553.031) -- 0:00:48
323500 -- (-552.050) [-549.734] (-549.195) (-552.241) * (-551.499) (-551.580) (-553.744) [-550.839] -- 0:00:50
324000 -- [-550.249] (-555.412) (-550.753) (-550.125) * (-554.313) [-551.153] (-550.633) (-556.541) -- 0:00:50
324500 -- (-552.989) [-554.317] (-551.675) (-550.704) * (-547.661) (-550.366) [-552.144] (-550.556) -- 0:00:49
325000 -- (-556.300) (-550.472) [-553.217] (-552.980) * [-552.154] (-555.042) (-554.286) (-552.712) -- 0:00:49
Average standard deviation of split frequencies: 0.014035
325500 -- [-551.788] (-558.717) (-551.118) (-552.405) * (-554.655) (-554.748) [-550.978] (-554.444) -- 0:00:49
326000 -- [-549.882] (-553.379) (-549.997) (-551.229) * (-552.722) [-551.525] (-554.342) (-551.935) -- 0:00:49
326500 -- (-551.514) (-552.720) [-552.329] (-551.368) * (-551.492) [-554.864] (-549.805) (-551.708) -- 0:00:49
327000 -- [-551.334] (-553.605) (-552.617) (-558.966) * [-549.395] (-552.828) (-553.013) (-550.446) -- 0:00:49
327500 -- [-552.314] (-553.293) (-555.249) (-551.767) * (-550.175) [-549.875] (-550.151) (-553.844) -- 0:00:49
328000 -- (-554.780) (-552.260) (-551.669) [-550.209] * [-552.524] (-550.912) (-551.898) (-551.301) -- 0:00:49
328500 -- [-550.274] (-556.148) (-549.138) (-551.507) * (-550.958) (-551.682) (-552.085) [-551.335] -- 0:00:49
329000 -- (-551.143) (-552.273) (-555.178) [-553.678] * (-552.648) (-552.724) [-552.489] (-554.554) -- 0:00:48
329500 -- [-551.654] (-551.491) (-550.599) (-551.716) * (-552.322) (-550.913) [-551.805] (-554.832) -- 0:00:48
330000 -- (-551.945) (-550.560) [-552.698] (-552.614) * [-549.353] (-554.291) (-552.162) (-555.300) -- 0:00:48
Average standard deviation of split frequencies: 0.014078
330500 -- (-551.340) (-552.325) (-550.310) [-550.317] * (-554.051) (-552.382) [-550.727] (-551.828) -- 0:00:48
331000 -- (-550.829) (-553.172) [-550.026] (-552.097) * (-553.301) [-552.288] (-552.434) (-551.941) -- 0:00:48
331500 -- (-552.660) [-553.699] (-550.894) (-555.911) * (-550.399) (-554.910) (-554.188) [-549.517] -- 0:00:48
332000 -- (-552.949) (-550.519) (-555.015) [-550.427] * (-551.658) [-554.247] (-550.344) (-552.279) -- 0:00:48
332500 -- (-556.162) (-553.757) (-552.360) [-550.773] * (-554.313) [-550.609] (-555.594) (-550.840) -- 0:00:48
333000 -- (-549.169) (-550.440) [-550.628] (-552.352) * (-552.709) (-551.228) (-552.217) [-551.779] -- 0:00:48
333500 -- (-551.310) [-551.959] (-551.463) (-550.332) * [-548.398] (-552.016) (-551.190) (-554.271) -- 0:00:47
334000 -- (-552.112) (-556.245) [-552.246] (-553.051) * (-554.269) (-552.920) (-552.330) [-550.852] -- 0:00:47
334500 -- [-551.611] (-549.031) (-551.550) (-550.989) * [-553.025] (-551.602) (-551.421) (-550.715) -- 0:00:47
335000 -- [-550.622] (-549.779) (-551.832) (-552.389) * (-549.723) (-552.204) [-553.501] (-548.937) -- 0:00:47
Average standard deviation of split frequencies: 0.013065
335500 -- (-550.200) (-549.992) [-556.387] (-551.505) * (-550.842) (-552.799) (-553.469) [-551.512] -- 0:00:47
336000 -- (-549.279) [-549.521] (-553.485) (-551.467) * [-551.723] (-551.431) (-555.123) (-555.138) -- 0:00:47
336500 -- (-552.309) (-549.338) (-551.023) [-553.241] * (-550.338) [-551.543] (-549.804) (-551.018) -- 0:00:47
337000 -- [-550.424] (-551.654) (-550.833) (-551.495) * (-548.960) [-551.859] (-554.763) (-552.223) -- 0:00:47
337500 -- [-550.425] (-552.116) (-550.725) (-553.910) * [-550.352] (-554.031) (-551.647) (-551.373) -- 0:00:49
338000 -- (-550.224) (-553.025) (-554.918) [-552.794] * (-549.346) (-552.568) (-549.976) [-552.116] -- 0:00:48
338500 -- (-551.051) (-551.640) (-551.678) [-552.042] * (-552.129) [-551.997] (-552.836) (-551.989) -- 0:00:48
339000 -- (-550.348) [-549.825] (-551.948) (-552.817) * (-549.901) (-555.284) (-553.126) [-554.016] -- 0:00:48
339500 -- (-549.361) [-552.851] (-553.756) (-550.590) * (-550.148) (-552.011) [-551.294] (-550.264) -- 0:00:48
340000 -- (-551.840) [-553.474] (-552.506) (-554.218) * [-549.849] (-550.972) (-552.971) (-550.176) -- 0:00:48
Average standard deviation of split frequencies: 0.013319
340500 -- (-552.186) [-553.471] (-551.647) (-552.990) * (-555.446) (-556.040) [-551.726] (-550.690) -- 0:00:48
341000 -- (-549.868) (-555.032) (-553.860) [-550.597] * [-550.842] (-554.205) (-554.642) (-550.759) -- 0:00:48
341500 -- (-550.641) (-557.048) (-554.455) [-550.049] * [-549.907] (-553.668) (-552.145) (-551.247) -- 0:00:48
342000 -- (-551.023) [-558.390] (-555.383) (-550.268) * [-550.176] (-553.064) (-553.347) (-548.886) -- 0:00:48
342500 -- (-551.979) [-550.120] (-550.543) (-550.544) * (-557.373) [-550.310] (-554.110) (-551.133) -- 0:00:47
343000 -- (-552.465) (-551.063) [-550.633] (-554.692) * (-550.796) (-550.480) (-554.634) [-549.610] -- 0:00:47
343500 -- (-554.267) (-554.335) [-551.622] (-551.811) * [-549.945] (-556.172) (-549.818) (-550.515) -- 0:00:47
344000 -- [-554.198] (-554.777) (-554.699) (-554.511) * (-550.678) (-557.965) (-550.474) [-548.912] -- 0:00:47
344500 -- [-551.104] (-551.309) (-551.979) (-553.496) * (-550.128) [-551.751] (-549.577) (-554.380) -- 0:00:47
345000 -- (-552.185) [-550.581] (-555.165) (-553.084) * [-553.294] (-553.085) (-551.958) (-554.390) -- 0:00:47
Average standard deviation of split frequencies: 0.012517
345500 -- [-551.393] (-550.585) (-552.539) (-554.675) * (-551.737) [-553.076] (-551.149) (-552.029) -- 0:00:47
346000 -- (-556.258) (-550.950) [-551.643] (-553.544) * (-551.171) (-550.281) (-552.735) [-552.850] -- 0:00:47
346500 -- [-550.669] (-552.027) (-552.402) (-549.411) * [-552.504] (-555.986) (-551.934) (-551.286) -- 0:00:47
347000 -- (-550.978) (-551.475) (-550.292) [-551.929] * (-549.191) (-552.368) (-550.806) [-549.631] -- 0:00:47
347500 -- (-548.845) [-551.493] (-551.101) (-551.212) * (-552.705) (-552.334) (-551.033) [-548.986] -- 0:00:46
348000 -- (-552.718) [-552.074] (-550.622) (-552.485) * (-557.774) [-550.972] (-555.627) (-554.853) -- 0:00:46
348500 -- (-551.820) (-554.384) (-549.500) [-551.990] * (-552.438) [-548.884] (-552.030) (-552.084) -- 0:00:46
349000 -- (-553.186) [-551.112] (-549.966) (-549.993) * [-551.294] (-549.837) (-553.273) (-550.704) -- 0:00:46
349500 -- (-551.032) [-550.776] (-552.490) (-551.407) * (-552.590) (-553.194) (-549.824) [-553.118] -- 0:00:46
350000 -- (-550.756) (-551.119) (-554.313) [-550.161] * (-551.318) [-554.108] (-554.368) (-552.199) -- 0:00:46
Average standard deviation of split frequencies: 0.012183
350500 -- [-551.442] (-551.681) (-554.146) (-551.160) * (-556.587) (-551.661) [-551.582] (-553.859) -- 0:00:46
351000 -- [-551.967] (-553.899) (-551.790) (-550.384) * (-554.128) [-550.825] (-551.274) (-551.346) -- 0:00:46
351500 -- [-548.427] (-551.683) (-551.370) (-553.050) * [-551.019] (-550.567) (-550.779) (-551.791) -- 0:00:47
352000 -- (-548.938) (-552.960) [-549.457] (-552.722) * (-550.444) (-551.990) [-549.789] (-551.066) -- 0:00:47
352500 -- (-550.604) (-552.136) [-553.879] (-553.215) * (-550.031) (-552.996) [-548.535] (-554.231) -- 0:00:47
353000 -- [-551.351] (-549.373) (-552.479) (-549.789) * (-551.039) (-552.153) (-551.027) [-551.620] -- 0:00:47
353500 -- [-549.667] (-551.349) (-550.908) (-553.829) * (-553.006) (-552.079) [-549.706] (-553.481) -- 0:00:47
354000 -- (-547.539) (-551.493) [-552.483] (-551.436) * [-549.091] (-551.085) (-552.725) (-554.283) -- 0:00:47
354500 -- (-551.374) (-554.832) (-551.605) [-551.346] * [-550.180] (-552.643) (-550.560) (-549.635) -- 0:00:47
355000 -- [-550.190] (-551.087) (-551.222) (-551.417) * [-551.618] (-550.936) (-550.606) (-549.218) -- 0:00:47
Average standard deviation of split frequencies: 0.011835
355500 -- (-551.054) (-551.562) (-552.060) [-551.621] * (-552.496) (-551.848) (-552.907) [-551.564] -- 0:00:47
356000 -- (-549.862) [-550.164] (-554.920) (-553.588) * [-554.047] (-553.508) (-550.228) (-552.302) -- 0:00:47
356500 -- (-550.486) (-552.383) [-551.104] (-549.628) * (-552.356) (-551.145) [-551.534] (-550.926) -- 0:00:46
357000 -- (-552.064) [-552.410] (-552.513) (-550.844) * (-549.941) [-550.993] (-551.147) (-551.744) -- 0:00:46
357500 -- (-550.365) [-550.509] (-553.664) (-549.907) * (-553.264) [-551.610] (-551.378) (-552.127) -- 0:00:46
358000 -- [-550.075] (-550.192) (-551.226) (-551.426) * (-553.121) (-548.900) [-550.255] (-554.191) -- 0:00:46
358500 -- (-550.604) (-553.652) (-549.882) [-551.778] * (-549.771) [-551.040] (-550.957) (-552.371) -- 0:00:46
359000 -- (-550.264) [-550.142] (-551.501) (-552.204) * (-549.826) [-548.877] (-551.627) (-550.226) -- 0:00:46
359500 -- (-554.714) [-550.583] (-551.803) (-552.357) * (-550.163) (-549.812) (-552.522) [-551.791] -- 0:00:46
360000 -- (-553.122) [-550.407] (-557.801) (-550.174) * (-551.318) [-551.386] (-555.372) (-551.165) -- 0:00:46
Average standard deviation of split frequencies: 0.011845
360500 -- (-553.833) (-553.452) [-552.113] (-552.727) * [-550.481] (-549.611) (-551.358) (-550.870) -- 0:00:46
361000 -- (-551.148) (-553.216) [-550.275] (-552.528) * (-549.378) (-550.241) [-550.906] (-550.413) -- 0:00:46
361500 -- (-551.541) (-559.018) (-550.532) [-554.138] * (-553.161) (-551.800) [-552.127] (-551.455) -- 0:00:45
362000 -- (-550.246) (-550.844) [-553.430] (-556.711) * (-552.303) [-551.474] (-553.633) (-552.113) -- 0:00:45
362500 -- (-550.987) (-556.206) [-549.689] (-551.658) * [-551.322] (-551.477) (-555.369) (-552.279) -- 0:00:45
363000 -- (-552.512) [-554.189] (-549.031) (-551.360) * (-550.766) (-550.806) [-550.308] (-550.510) -- 0:00:45
363500 -- [-551.935] (-558.951) (-550.513) (-552.399) * [-549.573] (-550.465) (-552.440) (-550.851) -- 0:00:45
364000 -- (-551.497) (-552.117) (-550.066) [-550.228] * (-557.339) [-550.819] (-550.432) (-552.627) -- 0:00:45
364500 -- (-551.509) (-553.435) (-550.807) [-550.804] * (-552.802) [-552.129] (-556.670) (-553.477) -- 0:00:45
365000 -- (-549.718) (-550.605) [-548.769] (-552.412) * [-552.836] (-549.640) (-551.557) (-558.520) -- 0:00:45
Average standard deviation of split frequencies: 0.012155
365500 -- [-549.426] (-551.105) (-554.526) (-551.622) * [-556.881] (-550.736) (-551.264) (-552.969) -- 0:00:46
366000 -- (-557.768) (-553.322) [-549.940] (-552.384) * (-554.055) [-553.483] (-553.989) (-551.898) -- 0:00:46
366500 -- (-551.292) [-556.824] (-549.054) (-551.501) * (-551.623) [-551.161] (-550.125) (-551.849) -- 0:00:46
367000 -- [-550.499] (-551.005) (-550.886) (-555.652) * [-551.687] (-552.498) (-553.011) (-557.839) -- 0:00:46
367500 -- (-551.013) [-551.565] (-551.356) (-550.108) * (-551.523) [-553.336] (-549.326) (-552.594) -- 0:00:46
368000 -- [-550.480] (-552.326) (-550.361) (-555.068) * (-550.199) (-551.745) (-551.655) [-551.985] -- 0:00:46
368500 -- [-549.456] (-554.911) (-552.855) (-556.072) * (-552.576) (-554.255) [-551.077] (-553.093) -- 0:00:46
369000 -- [-552.075] (-557.425) (-549.827) (-552.472) * (-552.676) (-553.520) [-554.285] (-553.696) -- 0:00:46
369500 -- (-550.358) (-552.806) [-549.478] (-553.724) * (-551.130) (-556.131) [-551.650] (-551.425) -- 0:00:46
370000 -- (-549.982) [-550.985] (-550.668) (-550.879) * (-552.110) (-551.776) [-550.793] (-555.250) -- 0:00:45
Average standard deviation of split frequencies: 0.012161
370500 -- (-550.616) (-551.568) (-551.741) [-553.449] * (-556.316) (-549.459) [-550.803] (-552.614) -- 0:00:45
371000 -- [-549.944] (-550.597) (-551.822) (-550.179) * (-551.717) [-549.763] (-549.785) (-551.795) -- 0:00:45
371500 -- (-550.309) (-549.997) (-550.487) [-549.844] * [-553.246] (-551.289) (-550.688) (-550.979) -- 0:00:45
372000 -- [-552.643] (-552.372) (-548.731) (-550.299) * (-551.352) [-551.167] (-550.180) (-552.166) -- 0:00:45
372500 -- (-550.478) [-552.583] (-549.547) (-551.374) * [-548.306] (-551.009) (-551.382) (-552.847) -- 0:00:45
373000 -- (-552.648) [-550.695] (-550.375) (-550.558) * [-551.917] (-551.612) (-550.007) (-550.547) -- 0:00:45
373500 -- (-548.644) (-551.384) (-552.600) [-552.425] * (-550.693) (-550.762) [-550.169] (-552.838) -- 0:00:45
374000 -- (-551.218) (-550.631) (-553.157) [-550.678] * (-551.263) (-553.890) [-550.041] (-550.679) -- 0:00:45
374500 -- (-551.248) (-549.361) [-549.426] (-552.905) * (-552.053) [-551.366] (-548.913) (-550.082) -- 0:00:45
375000 -- (-551.937) (-553.079) [-551.298] (-552.839) * (-551.181) (-552.826) [-550.530] (-551.527) -- 0:00:45
Average standard deviation of split frequencies: 0.013791
375500 -- [-551.167] (-556.618) (-551.329) (-556.890) * (-553.421) (-552.140) [-549.515] (-551.336) -- 0:00:44
376000 -- (-549.817) (-553.589) (-554.032) [-553.194] * [-551.391] (-555.865) (-548.909) (-553.148) -- 0:00:44
376500 -- (-553.911) (-550.290) (-551.836) [-552.096] * [-548.975] (-549.816) (-549.066) (-554.031) -- 0:00:44
377000 -- [-548.816] (-549.772) (-551.415) (-551.526) * (-549.961) (-551.403) (-549.142) [-551.261] -- 0:00:44
377500 -- [-554.254] (-551.979) (-555.471) (-551.172) * [-553.441] (-552.279) (-552.277) (-551.788) -- 0:00:44
378000 -- (-556.260) [-551.964] (-557.632) (-549.858) * (-550.794) [-552.227] (-552.149) (-552.373) -- 0:00:44
378500 -- (-550.950) [-552.618] (-549.614) (-551.670) * (-552.503) (-552.460) [-548.640] (-551.291) -- 0:00:44
379000 -- (-551.748) [-550.414] (-552.399) (-553.100) * (-553.288) (-553.361) [-548.802] (-550.955) -- 0:00:44
379500 -- (-549.301) [-549.099] (-553.813) (-552.551) * [-553.465] (-550.899) (-549.730) (-550.031) -- 0:00:45
380000 -- (-552.244) (-551.412) (-552.311) [-551.191] * (-550.013) [-551.500] (-554.671) (-550.964) -- 0:00:45
Average standard deviation of split frequencies: 0.013854
380500 -- (-554.620) (-549.147) (-549.577) [-550.913] * (-552.704) (-549.695) (-547.955) [-550.056] -- 0:00:45
381000 -- (-552.355) (-552.273) [-550.672] (-555.503) * (-550.724) (-548.802) [-550.576] (-553.251) -- 0:00:45
381500 -- (-551.044) (-552.471) [-552.180] (-550.616) * [-552.044] (-555.201) (-552.612) (-551.418) -- 0:00:45
382000 -- (-552.576) (-554.108) [-550.430] (-551.465) * (-553.445) [-550.397] (-550.580) (-551.470) -- 0:00:45
382500 -- (-550.586) (-552.757) (-552.771) [-551.759] * (-555.644) [-551.950] (-551.640) (-550.201) -- 0:00:45
383000 -- (-551.574) (-549.118) [-552.741] (-556.783) * (-552.457) (-550.288) [-549.146] (-553.277) -- 0:00:45
383500 -- [-552.872] (-549.785) (-552.710) (-556.792) * [-552.147] (-552.188) (-551.172) (-551.508) -- 0:00:45
384000 -- (-555.455) (-553.403) [-552.210] (-551.918) * (-552.715) [-556.328] (-549.237) (-554.506) -- 0:00:44
384500 -- (-550.930) (-550.559) (-551.031) [-554.970] * (-553.917) [-551.699] (-552.640) (-556.023) -- 0:00:44
385000 -- (-551.210) [-550.373] (-550.705) (-551.477) * [-549.665] (-551.124) (-551.277) (-551.755) -- 0:00:44
Average standard deviation of split frequencies: 0.013968
385500 -- [-557.684] (-550.622) (-552.188) (-555.819) * (-551.867) (-551.182) [-552.556] (-550.623) -- 0:00:44
386000 -- (-556.123) (-553.727) [-552.469] (-553.376) * [-551.934] (-549.231) (-550.312) (-550.616) -- 0:00:44
386500 -- (-551.302) [-551.731] (-549.120) (-555.623) * (-550.811) (-558.509) [-550.876] (-551.158) -- 0:00:44
387000 -- [-552.899] (-551.616) (-549.694) (-553.116) * (-551.758) (-552.921) [-554.280] (-551.909) -- 0:00:44
387500 -- [-554.359] (-553.994) (-555.574) (-552.247) * (-549.968) [-551.406] (-552.780) (-552.115) -- 0:00:44
388000 -- [-551.890] (-554.433) (-558.787) (-554.359) * (-554.694) (-551.298) (-552.021) [-551.812] -- 0:00:44
388500 -- [-550.465] (-551.916) (-553.899) (-553.531) * (-551.682) (-551.843) (-550.474) [-550.297] -- 0:00:44
389000 -- (-553.334) [-550.432] (-548.430) (-554.178) * (-550.516) [-552.997] (-549.965) (-553.926) -- 0:00:43
389500 -- (-550.977) (-550.629) [-548.578] (-551.923) * (-552.463) (-552.305) (-551.048) [-551.177] -- 0:00:43
390000 -- [-551.937] (-551.518) (-551.403) (-551.064) * [-553.661] (-552.481) (-551.829) (-553.549) -- 0:00:43
Average standard deviation of split frequencies: 0.013273
390500 -- (-553.871) (-555.321) (-552.238) [-554.558] * [-550.981] (-554.235) (-550.068) (-551.077) -- 0:00:43
391000 -- (-550.263) (-551.095) [-547.921] (-551.512) * (-551.525) [-554.130] (-549.722) (-551.534) -- 0:00:43
391500 -- (-550.574) (-549.981) (-551.082) [-549.842] * (-551.557) (-551.003) [-548.799] (-552.954) -- 0:00:43
392000 -- [-552.108] (-548.132) (-552.689) (-551.154) * [-552.019] (-553.651) (-551.870) (-554.615) -- 0:00:43
392500 -- (-553.152) (-553.061) [-549.848] (-554.264) * (-551.306) (-555.968) [-549.774] (-552.811) -- 0:00:43
393000 -- (-550.493) (-551.222) [-550.141] (-553.133) * (-552.860) (-550.901) [-550.693] (-556.350) -- 0:00:43
393500 -- (-549.690) (-549.303) [-549.740] (-551.105) * (-556.122) [-551.063] (-551.701) (-553.397) -- 0:00:44
394000 -- [-550.568] (-549.534) (-548.003) (-551.363) * (-551.338) (-552.332) (-552.599) [-550.121] -- 0:00:44
394500 -- (-549.500) [-551.830] (-550.114) (-551.623) * (-551.468) (-550.971) (-551.203) [-549.264] -- 0:00:44
395000 -- (-551.660) (-554.288) (-551.664) [-552.460] * [-550.614] (-551.932) (-553.150) (-551.693) -- 0:00:44
Average standard deviation of split frequencies: 0.013392
395500 -- (-549.190) (-553.336) (-549.935) [-551.933] * (-555.707) [-552.472] (-548.179) (-553.454) -- 0:00:44
396000 -- [-551.451] (-550.326) (-550.675) (-550.652) * (-551.401) (-550.936) (-550.707) [-550.717] -- 0:00:44
396500 -- (-550.970) (-551.481) [-550.869] (-550.083) * [-550.453] (-550.994) (-549.188) (-555.314) -- 0:00:44
397000 -- [-550.336] (-551.123) (-549.403) (-552.095) * (-553.572) (-550.347) [-555.361] (-549.753) -- 0:00:44
397500 -- (-549.950) (-552.379) [-551.208] (-551.680) * (-553.670) (-551.968) (-548.214) [-550.416] -- 0:00:43
398000 -- (-554.307) [-549.262] (-551.110) (-552.049) * (-556.916) (-554.092) (-549.133) [-549.162] -- 0:00:43
398500 -- (-553.484) (-551.063) [-548.618] (-553.617) * (-552.151) [-552.312] (-552.846) (-554.821) -- 0:00:43
399000 -- (-551.746) (-550.822) [-548.097] (-551.812) * (-548.651) [-549.597] (-552.333) (-552.512) -- 0:00:43
399500 -- [-551.629] (-550.268) (-549.243) (-553.430) * (-549.824) (-553.218) [-551.262] (-553.081) -- 0:00:43
400000 -- (-550.521) (-549.358) [-549.813] (-554.089) * [-550.678] (-550.704) (-552.934) (-553.960) -- 0:00:43
Average standard deviation of split frequencies: 0.013898
400500 -- (-551.002) (-553.736) [-551.176] (-551.493) * (-553.925) (-552.569) [-553.068] (-552.705) -- 0:00:43
401000 -- (-555.981) (-549.596) [-549.327] (-552.092) * (-555.063) (-550.122) (-548.742) [-553.208] -- 0:00:43
401500 -- (-550.415) (-550.261) (-549.454) [-555.780] * (-553.161) (-551.323) [-550.540] (-552.090) -- 0:00:43
402000 -- (-551.219) (-551.945) [-551.005] (-554.128) * (-551.668) [-549.498] (-551.023) (-550.879) -- 0:00:43
402500 -- (-550.154) (-557.577) [-551.115] (-553.569) * (-555.127) (-550.892) [-552.360] (-552.251) -- 0:00:43
403000 -- (-553.812) (-552.405) [-549.561] (-553.771) * (-552.902) (-549.652) [-553.922] (-551.410) -- 0:00:42
403500 -- (-554.748) (-556.111) [-551.449] (-551.485) * (-551.852) [-551.109] (-551.325) (-552.698) -- 0:00:42
404000 -- (-553.741) [-553.043] (-550.452) (-551.169) * (-551.563) (-554.580) (-551.575) [-550.734] -- 0:00:42
404500 -- (-553.508) (-553.081) [-553.053] (-552.349) * [-551.045] (-549.318) (-549.344) (-551.128) -- 0:00:42
405000 -- (-551.120) (-552.046) [-555.057] (-551.619) * (-553.155) (-553.476) [-549.760] (-551.693) -- 0:00:42
Average standard deviation of split frequencies: 0.013062
405500 -- (-551.959) [-550.485] (-551.206) (-554.199) * [-550.724] (-548.976) (-549.841) (-555.402) -- 0:00:42
406000 -- (-552.325) (-552.669) [-553.114] (-551.056) * (-551.687) (-551.175) [-552.114] (-551.629) -- 0:00:42
406500 -- (-554.935) (-555.690) (-553.002) [-550.389] * [-555.477] (-556.833) (-548.716) (-551.590) -- 0:00:42
407000 -- (-552.884) (-550.813) [-551.405] (-552.971) * (-555.078) (-549.066) (-550.113) [-551.361] -- 0:00:42
407500 -- [-549.164] (-554.221) (-550.733) (-550.511) * (-552.415) (-550.525) (-548.218) [-550.252] -- 0:00:43
408000 -- (-550.479) (-550.654) [-549.960] (-551.238) * (-552.956) (-555.487) (-552.116) [-551.344] -- 0:00:43
408500 -- (-555.040) (-550.637) (-549.512) [-552.349] * (-551.381) (-550.417) [-550.532] (-551.791) -- 0:00:43
409000 -- (-551.216) (-550.019) [-550.247] (-552.286) * [-550.296] (-550.052) (-554.159) (-554.236) -- 0:00:43
409500 -- (-550.105) (-549.676) (-550.789) [-550.117] * (-553.273) [-550.401] (-550.524) (-550.919) -- 0:00:43
410000 -- [-551.743] (-550.896) (-551.160) (-551.381) * (-552.433) [-554.318] (-551.388) (-552.828) -- 0:00:43
Average standard deviation of split frequencies: 0.012842
410500 -- [-549.570] (-551.455) (-550.873) (-550.534) * [-551.807] (-556.605) (-550.525) (-551.834) -- 0:00:43
411000 -- [-548.116] (-550.856) (-549.819) (-553.937) * (-551.058) (-552.457) (-553.128) [-550.275] -- 0:00:42
411500 -- [-549.562] (-552.798) (-551.236) (-551.045) * (-550.685) (-553.119) [-550.512] (-550.150) -- 0:00:42
412000 -- (-550.419) (-550.789) [-551.813] (-551.734) * [-554.007] (-551.547) (-555.599) (-550.293) -- 0:00:42
412500 -- (-552.464) (-555.803) (-552.572) [-553.176] * (-549.203) [-550.525] (-553.933) (-550.514) -- 0:00:42
413000 -- (-555.586) (-555.200) [-551.553] (-552.748) * (-551.327) (-551.264) (-552.501) [-550.609] -- 0:00:42
413500 -- [-547.896] (-553.787) (-551.697) (-553.121) * (-549.313) (-552.594) (-552.372) [-555.872] -- 0:00:42
414000 -- (-550.193) (-554.026) [-550.556] (-555.120) * (-550.917) (-553.596) (-558.278) [-551.032] -- 0:00:42
414500 -- (-551.897) (-552.182) [-549.991] (-551.020) * [-551.132] (-549.443) (-552.691) (-551.039) -- 0:00:42
415000 -- (-549.496) [-550.641] (-549.544) (-552.903) * (-551.735) (-552.600) (-554.478) [-551.702] -- 0:00:42
Average standard deviation of split frequencies: 0.014023
415500 -- (-551.154) (-552.818) (-554.561) [-549.622] * (-553.091) (-550.752) [-548.064] (-550.231) -- 0:00:42
416000 -- (-554.507) (-551.269) (-557.746) [-552.364] * (-549.555) (-554.528) [-552.087] (-552.345) -- 0:00:42
416500 -- [-552.076] (-554.900) (-552.882) (-551.607) * (-551.409) (-551.713) (-552.992) [-552.073] -- 0:00:42
417000 -- [-550.442] (-554.804) (-551.829) (-551.738) * [-550.972] (-553.311) (-550.732) (-552.762) -- 0:00:41
417500 -- [-552.307] (-554.281) (-551.845) (-551.289) * [-552.717] (-550.589) (-548.959) (-549.572) -- 0:00:41
418000 -- (-552.137) (-557.392) (-553.399) [-553.861] * (-554.391) (-550.056) (-548.680) [-551.107] -- 0:00:41
418500 -- (-551.040) (-555.630) [-548.507] (-556.887) * [-552.229] (-552.141) (-554.816) (-552.894) -- 0:00:41
419000 -- [-552.921] (-552.138) (-549.500) (-551.489) * (-556.118) (-551.550) (-552.027) [-553.954] -- 0:00:41
419500 -- (-550.557) (-553.093) [-550.368] (-551.000) * (-550.294) [-551.688] (-551.301) (-552.461) -- 0:00:41
420000 -- [-552.344] (-552.332) (-550.030) (-553.684) * (-552.338) [-553.110] (-550.381) (-554.001) -- 0:00:41
Average standard deviation of split frequencies: 0.012327
420500 -- (-549.268) [-550.925] (-549.907) (-552.766) * (-553.090) [-551.566] (-552.009) (-552.015) -- 0:00:41
421000 -- (-551.651) [-550.497] (-556.259) (-551.298) * (-551.150) (-549.839) [-552.678] (-550.596) -- 0:00:41
421500 -- [-549.179] (-556.698) (-550.565) (-552.642) * (-555.109) (-553.366) (-551.839) [-549.993] -- 0:00:42
422000 -- (-550.061) [-552.865] (-554.379) (-556.766) * [-553.617] (-553.794) (-554.011) (-549.933) -- 0:00:42
422500 -- [-550.174] (-551.188) (-551.565) (-552.655) * (-550.474) (-548.948) (-551.969) [-551.406] -- 0:00:42
423000 -- (-553.323) [-552.578] (-552.718) (-551.966) * [-552.033] (-552.385) (-556.179) (-550.337) -- 0:00:42
423500 -- [-552.381] (-553.592) (-550.631) (-549.663) * (-552.030) [-554.231] (-556.772) (-551.548) -- 0:00:42
424000 -- (-551.458) [-552.154] (-553.891) (-554.019) * (-552.659) [-550.296] (-560.564) (-549.069) -- 0:00:42
424500 -- (-551.884) (-550.761) [-552.204] (-551.071) * (-553.688) (-554.720) [-553.081] (-550.369) -- 0:00:42
425000 -- (-552.662) (-551.015) (-551.825) [-552.378] * (-554.089) (-554.089) (-550.440) [-550.634] -- 0:00:41
Average standard deviation of split frequencies: 0.012242
425500 -- (-550.701) (-552.053) (-551.446) [-550.535] * (-552.343) (-551.621) [-550.586] (-556.529) -- 0:00:41
426000 -- (-550.174) (-553.300) [-551.132] (-551.035) * [-552.502] (-552.118) (-550.810) (-552.041) -- 0:00:41
426500 -- (-552.595) [-550.966] (-555.133) (-553.722) * (-552.541) (-555.488) [-552.243] (-556.987) -- 0:00:41
427000 -- (-551.010) [-550.595] (-551.699) (-552.087) * (-553.843) [-551.725] (-551.477) (-558.526) -- 0:00:41
427500 -- (-550.152) (-551.160) (-554.698) [-550.772] * (-550.034) (-550.718) [-551.977] (-556.336) -- 0:00:41
428000 -- (-550.771) (-553.019) [-550.030] (-553.066) * [-550.895] (-552.509) (-551.129) (-550.314) -- 0:00:41
428500 -- [-552.131] (-551.116) (-551.514) (-552.344) * (-551.250) (-551.055) (-554.830) [-553.202] -- 0:00:41
429000 -- [-551.320] (-551.378) (-550.440) (-550.530) * (-551.141) (-550.270) [-550.695] (-551.838) -- 0:00:41
429500 -- (-550.842) (-551.719) (-551.148) [-550.210] * [-549.298] (-549.265) (-551.149) (-548.626) -- 0:00:41
430000 -- (-553.966) (-551.007) [-549.325] (-549.881) * (-552.659) (-552.199) [-550.058] (-551.384) -- 0:00:41
Average standard deviation of split frequencies: 0.012519
430500 -- (-551.161) [-550.667] (-553.088) (-555.027) * [-557.048] (-549.683) (-550.974) (-551.972) -- 0:00:41
431000 -- (-553.746) (-549.883) [-550.715] (-551.407) * (-553.376) [-551.943] (-551.050) (-548.952) -- 0:00:40
431500 -- [-551.436] (-550.992) (-552.148) (-552.148) * [-552.535] (-549.347) (-551.174) (-551.440) -- 0:00:40
432000 -- [-550.926] (-552.573) (-552.984) (-555.292) * [-551.193] (-552.383) (-555.595) (-552.163) -- 0:00:40
432500 -- (-554.844) (-551.668) [-550.734] (-552.299) * (-552.252) [-556.260] (-551.014) (-552.339) -- 0:00:40
433000 -- (-551.608) (-551.521) (-549.312) [-551.761] * (-553.188) (-555.168) [-551.548] (-551.545) -- 0:00:40
433500 -- (-551.913) (-552.989) [-550.011] (-552.948) * (-556.163) (-550.961) [-552.114] (-552.090) -- 0:00:40
434000 -- (-557.588) (-553.476) (-554.661) [-553.561] * [-550.137] (-550.096) (-551.838) (-555.535) -- 0:00:40
434500 -- (-554.301) (-554.804) [-551.137] (-552.481) * [-550.426] (-552.554) (-551.376) (-551.135) -- 0:00:40
435000 -- (-549.947) [-551.836] (-549.365) (-551.310) * (-551.203) (-550.623) (-551.543) [-553.334] -- 0:00:40
Average standard deviation of split frequencies: 0.013447
435500 -- (-555.372) (-552.029) (-550.588) [-559.990] * (-551.691) (-550.257) [-550.461] (-551.930) -- 0:00:41
436000 -- (-552.655) (-551.403) (-552.559) [-553.220] * (-551.893) [-550.698] (-551.623) (-554.860) -- 0:00:41
436500 -- (-553.101) (-551.659) [-552.512] (-555.128) * (-552.564) [-549.161] (-554.012) (-552.183) -- 0:00:41
437000 -- [-554.746] (-549.211) (-550.645) (-554.045) * (-552.157) (-550.681) [-552.671] (-552.211) -- 0:00:41
437500 -- (-550.997) (-549.778) [-550.258] (-553.717) * (-552.638) (-550.708) (-550.797) [-552.295] -- 0:00:41
438000 -- (-549.782) [-550.611] (-550.052) (-551.381) * (-553.372) [-549.795] (-550.977) (-553.151) -- 0:00:41
438500 -- [-552.723] (-550.457) (-550.623) (-549.553) * (-554.069) [-553.583] (-554.163) (-551.835) -- 0:00:40
439000 -- (-550.377) (-549.211) (-553.434) [-551.887] * (-550.993) [-550.874] (-550.573) (-553.198) -- 0:00:40
439500 -- (-550.894) (-549.495) (-551.463) [-550.856] * [-556.918] (-550.771) (-551.244) (-551.792) -- 0:00:40
440000 -- (-550.418) (-551.433) [-550.956] (-550.684) * [-557.001] (-556.498) (-556.470) (-551.283) -- 0:00:40
Average standard deviation of split frequencies: 0.012703
440500 -- [-550.890] (-550.866) (-550.731) (-551.570) * (-549.026) (-549.289) (-552.382) [-550.083] -- 0:00:40
441000 -- (-548.007) [-549.748] (-549.656) (-552.095) * (-549.668) (-553.673) (-550.983) [-551.658] -- 0:00:40
441500 -- (-549.585) (-549.562) [-550.642] (-552.720) * (-552.368) (-551.952) (-550.399) [-550.734] -- 0:00:40
442000 -- (-549.799) (-550.837) (-551.181) [-550.935] * (-552.070) [-553.805] (-550.426) (-552.267) -- 0:00:40
442500 -- (-550.968) (-549.952) [-552.071] (-551.714) * (-553.108) (-555.021) [-549.633] (-551.922) -- 0:00:40
443000 -- [-548.772] (-551.400) (-551.716) (-553.460) * (-554.100) (-552.554) [-550.613] (-550.838) -- 0:00:40
443500 -- [-555.464] (-552.601) (-551.639) (-549.238) * (-551.872) (-551.284) [-549.399] (-551.205) -- 0:00:40
444000 -- [-549.112] (-548.571) (-551.377) (-550.125) * (-550.474) (-551.932) (-551.908) [-550.529] -- 0:00:40
444500 -- (-548.387) [-551.793] (-551.281) (-551.085) * (-554.316) [-551.641] (-550.565) (-552.789) -- 0:00:39
445000 -- (-549.254) (-552.076) [-548.093] (-549.235) * (-550.673) [-551.267] (-549.849) (-551.874) -- 0:00:39
Average standard deviation of split frequencies: 0.012551
445500 -- [-549.878] (-549.963) (-548.514) (-551.569) * (-551.739) (-552.903) (-551.068) [-551.261] -- 0:00:39
446000 -- (-551.462) [-551.688] (-550.848) (-550.650) * [-550.258] (-552.344) (-551.903) (-550.166) -- 0:00:39
446500 -- (-552.104) [-549.766] (-549.842) (-553.341) * (-551.288) [-550.547] (-550.626) (-551.784) -- 0:00:39
447000 -- (-550.278) [-550.361] (-550.973) (-549.770) * (-550.226) [-550.748] (-550.061) (-552.890) -- 0:00:39
447500 -- [-549.836] (-552.024) (-551.542) (-551.207) * (-551.082) (-551.606) (-549.429) [-550.148] -- 0:00:39
448000 -- (-552.838) (-551.137) (-552.376) [-548.675] * (-551.304) (-552.111) [-549.510] (-548.783) -- 0:00:39
448500 -- (-550.356) (-551.100) (-551.485) [-552.891] * (-549.383) (-551.696) (-551.181) [-553.270] -- 0:00:39
449000 -- (-552.548) (-551.700) [-554.002] (-552.894) * (-551.367) (-551.052) (-551.300) [-550.079] -- 0:00:39
449500 -- (-550.430) [-553.796] (-550.311) (-553.075) * (-553.509) (-551.968) (-551.096) [-549.812] -- 0:00:40
450000 -- (-550.762) (-550.827) [-550.832] (-550.345) * [-552.809] (-555.352) (-556.280) (-553.926) -- 0:00:40
Average standard deviation of split frequencies: 0.012552
450500 -- [-552.144] (-550.753) (-550.804) (-554.387) * (-554.168) [-550.136] (-549.773) (-550.514) -- 0:00:40
451000 -- (-549.956) (-552.075) (-550.835) [-550.634] * (-552.338) (-554.628) [-550.168] (-552.367) -- 0:00:40
451500 -- (-551.075) (-550.445) (-553.679) [-550.290] * (-552.214) (-552.435) [-548.550] (-552.523) -- 0:00:40
452000 -- (-551.695) (-551.935) [-550.378] (-551.338) * (-556.503) (-552.509) [-551.442] (-556.109) -- 0:00:40
452500 -- (-553.850) (-551.182) (-549.977) [-550.486] * (-552.197) (-551.590) [-555.394] (-556.038) -- 0:00:39
453000 -- (-553.839) [-549.877] (-550.723) (-552.341) * [-549.803] (-552.614) (-554.280) (-552.088) -- 0:00:39
453500 -- (-550.727) (-548.336) [-551.612] (-551.771) * (-551.693) (-550.782) [-550.383] (-550.782) -- 0:00:39
454000 -- (-558.449) (-550.063) (-549.903) [-554.288] * (-552.064) (-553.508) (-548.184) [-551.260] -- 0:00:39
454500 -- (-552.172) [-550.522] (-550.284) (-551.050) * (-557.313) [-551.757] (-552.000) (-553.213) -- 0:00:39
455000 -- (-552.265) (-550.040) (-550.345) [-551.349] * (-557.931) [-552.766] (-551.993) (-551.206) -- 0:00:39
Average standard deviation of split frequencies: 0.013051
455500 -- (-551.612) (-555.149) (-551.228) [-550.510] * (-549.014) (-555.093) [-551.083] (-550.050) -- 0:00:39
456000 -- (-548.801) [-551.050] (-551.960) (-552.083) * (-550.678) [-556.794] (-549.557) (-550.992) -- 0:00:39
456500 -- [-549.995] (-553.976) (-554.068) (-551.247) * (-550.187) (-551.273) [-550.075] (-552.566) -- 0:00:39
457000 -- [-550.048] (-555.469) (-553.642) (-551.701) * (-552.615) [-550.269] (-551.733) (-552.281) -- 0:00:39
457500 -- [-552.013] (-551.385) (-552.886) (-549.866) * (-553.105) [-552.932] (-550.512) (-551.567) -- 0:00:39
458000 -- [-549.639] (-556.204) (-556.868) (-551.788) * [-551.855] (-549.651) (-549.813) (-549.514) -- 0:00:39
458500 -- (-551.116) [-551.219] (-555.336) (-551.309) * (-550.773) (-553.093) (-548.298) [-549.935] -- 0:00:38
459000 -- (-550.246) [-552.201] (-551.701) (-549.781) * (-552.194) [-558.284] (-551.815) (-548.863) -- 0:00:38
459500 -- (-554.781) (-552.281) (-550.606) [-549.382] * (-553.633) [-548.926] (-551.781) (-550.927) -- 0:00:38
460000 -- (-550.315) (-551.294) (-553.757) [-552.477] * (-550.341) (-551.810) [-550.979] (-551.970) -- 0:00:38
Average standard deviation of split frequencies: 0.013559
460500 -- (-551.895) (-553.714) (-556.407) [-551.276] * [-550.141] (-551.990) (-556.970) (-551.472) -- 0:00:38
461000 -- (-551.238) [-551.426] (-556.466) (-550.641) * [-549.447] (-552.527) (-551.864) (-550.714) -- 0:00:38
461500 -- (-551.139) (-548.866) [-555.286] (-550.034) * (-550.293) [-549.135] (-551.499) (-553.746) -- 0:00:38
462000 -- [-550.281] (-553.317) (-554.910) (-551.715) * (-553.150) (-550.926) (-552.418) [-553.523] -- 0:00:38
462500 -- [-550.664] (-551.000) (-550.438) (-553.081) * [-557.237] (-550.474) (-549.183) (-550.452) -- 0:00:38
463000 -- [-550.451] (-557.921) (-550.723) (-552.095) * (-552.169) (-551.886) [-548.316] (-550.241) -- 0:00:38
463500 -- (-550.881) [-553.860] (-551.877) (-552.799) * (-551.951) [-551.114] (-550.187) (-552.708) -- 0:00:39
464000 -- (-554.162) (-549.785) [-550.832] (-552.684) * (-551.265) [-554.118] (-550.769) (-552.040) -- 0:00:39
464500 -- (-557.288) (-556.025) (-551.970) [-552.055] * [-550.506] (-553.272) (-551.177) (-551.635) -- 0:00:39
465000 -- (-550.223) (-550.772) [-551.199] (-552.655) * (-551.659) [-553.045] (-553.557) (-552.103) -- 0:00:39
Average standard deviation of split frequencies: 0.012202
465500 -- (-550.075) (-549.846) (-551.156) [-549.466] * (-550.753) (-548.966) [-551.240] (-549.147) -- 0:00:39
466000 -- (-548.449) [-550.747] (-553.985) (-550.153) * (-552.040) [-549.128] (-550.942) (-553.138) -- 0:00:38
466500 -- (-550.742) (-550.886) [-552.043] (-550.290) * (-551.863) (-550.548) (-551.769) [-550.873] -- 0:00:38
467000 -- (-551.183) (-552.110) (-548.732) [-550.269] * (-550.749) [-551.237] (-550.949) (-550.128) -- 0:00:38
467500 -- (-551.345) (-552.132) [-551.930] (-553.691) * (-553.662) (-553.360) [-549.971] (-550.736) -- 0:00:38
468000 -- (-551.744) (-549.135) [-549.106] (-554.958) * (-552.281) (-552.554) [-551.258] (-554.701) -- 0:00:38
468500 -- (-552.339) (-553.225) [-551.000] (-550.480) * (-554.572) (-551.893) [-550.620] (-552.068) -- 0:00:38
469000 -- (-550.101) (-552.890) (-549.265) [-552.237] * (-550.677) (-553.316) (-550.227) [-552.238] -- 0:00:38
469500 -- (-550.435) [-551.980] (-548.815) (-552.398) * (-550.799) (-548.979) (-554.599) [-551.309] -- 0:00:38
470000 -- (-554.968) (-552.607) [-550.239] (-551.638) * (-554.973) (-552.317) (-553.223) [-549.764] -- 0:00:38
Average standard deviation of split frequencies: 0.011393
470500 -- (-552.088) (-556.022) (-551.685) [-549.195] * (-550.866) (-551.465) (-552.242) [-550.303] -- 0:00:38
471000 -- (-553.778) [-550.370] (-551.108) (-550.612) * (-552.110) (-550.659) (-557.618) [-550.706] -- 0:00:38
471500 -- (-558.562) (-550.785) (-550.668) [-552.186] * [-551.256] (-549.537) (-551.105) (-549.642) -- 0:00:38
472000 -- (-550.331) (-548.955) (-550.614) [-548.827] * [-551.539] (-551.599) (-550.979) (-549.905) -- 0:00:38
472500 -- (-551.386) (-552.586) [-550.234] (-551.514) * (-550.380) (-550.455) [-551.087] (-552.741) -- 0:00:37
473000 -- (-550.936) (-551.772) [-552.919] (-551.301) * (-550.270) [-549.147] (-553.359) (-550.033) -- 0:00:37
473500 -- (-553.139) [-551.707] (-552.331) (-551.099) * [-551.861] (-550.583) (-553.793) (-551.323) -- 0:00:37
474000 -- (-554.820) (-554.542) (-551.642) [-549.135] * (-554.595) [-547.997] (-549.415) (-551.190) -- 0:00:37
474500 -- (-551.488) (-551.988) [-550.014] (-550.452) * (-553.982) (-550.665) [-548.687] (-552.987) -- 0:00:37
475000 -- (-550.842) (-551.172) (-555.722) [-551.128] * [-553.395] (-547.957) (-553.087) (-551.438) -- 0:00:37
Average standard deviation of split frequencies: 0.011946
475500 -- (-551.004) (-553.435) [-549.156] (-553.190) * [-552.139] (-552.805) (-550.370) (-553.832) -- 0:00:37
476000 -- (-550.331) (-555.874) [-551.628] (-548.500) * (-552.516) [-550.190] (-552.032) (-550.982) -- 0:00:37
476500 -- [-550.865] (-551.305) (-549.646) (-549.350) * (-552.835) (-551.735) [-551.285] (-550.798) -- 0:00:37
477000 -- (-550.862) [-550.327] (-552.012) (-549.472) * (-551.110) (-549.769) [-550.922] (-555.657) -- 0:00:37
477500 -- (-551.854) [-549.450] (-551.870) (-557.908) * (-553.572) [-547.980] (-550.562) (-549.274) -- 0:00:37
478000 -- (-552.752) (-552.004) [-550.428] (-547.378) * (-551.839) [-549.605] (-552.209) (-551.171) -- 0:00:38
478500 -- (-551.235) [-549.613] (-549.625) (-548.468) * (-557.352) [-551.422] (-549.879) (-550.701) -- 0:00:38
479000 -- (-552.705) (-552.252) (-550.211) [-551.446] * (-549.624) (-551.110) [-555.233] (-552.632) -- 0:00:38
479500 -- [-550.143] (-550.470) (-550.195) (-554.558) * (-550.879) (-549.826) [-551.265] (-553.802) -- 0:00:37
480000 -- (-552.407) [-555.311] (-553.851) (-552.077) * (-552.964) [-552.314] (-552.221) (-557.792) -- 0:00:37
Average standard deviation of split frequencies: 0.011340
480500 -- (-550.993) (-555.578) [-551.375] (-551.431) * (-550.437) [-549.808] (-552.208) (-552.958) -- 0:00:37
481000 -- (-552.131) (-553.466) (-551.154) [-550.058] * (-550.153) (-553.848) (-551.486) [-553.519] -- 0:00:37
481500 -- (-549.799) [-550.657] (-551.205) (-551.932) * (-549.510) (-554.498) [-548.979] (-552.523) -- 0:00:37
482000 -- [-549.656] (-554.240) (-554.467) (-550.049) * [-550.685] (-553.132) (-550.015) (-555.259) -- 0:00:37
482500 -- (-550.976) [-550.521] (-551.368) (-549.909) * [-551.325] (-549.415) (-549.011) (-551.895) -- 0:00:37
483000 -- (-551.752) (-551.632) [-550.832] (-550.495) * (-552.327) (-548.113) (-555.099) [-555.542] -- 0:00:37
483500 -- (-550.424) (-551.879) [-549.776] (-550.822) * (-554.327) [-548.821] (-551.155) (-554.899) -- 0:00:37
484000 -- (-552.903) (-550.432) (-553.792) [-550.055] * [-549.733] (-552.923) (-548.492) (-549.574) -- 0:00:37
484500 -- [-552.898] (-550.246) (-549.975) (-548.160) * [-550.465] (-549.610) (-552.250) (-552.829) -- 0:00:37
485000 -- [-551.978] (-551.154) (-554.882) (-551.360) * (-551.998) [-551.135] (-550.983) (-553.914) -- 0:00:37
Average standard deviation of split frequencies: 0.011397
485500 -- [-550.368] (-551.826) (-555.405) (-551.605) * [-551.560] (-549.812) (-549.017) (-552.504) -- 0:00:37
486000 -- [-551.473] (-552.022) (-551.690) (-552.957) * (-550.964) [-550.461] (-550.841) (-554.479) -- 0:00:37
486500 -- [-549.834] (-552.209) (-554.885) (-550.835) * (-551.143) [-548.762] (-554.509) (-551.473) -- 0:00:36
487000 -- [-548.826] (-549.253) (-553.589) (-552.872) * [-547.905] (-549.165) (-550.953) (-550.966) -- 0:00:36
487500 -- (-553.470) (-548.919) [-551.435] (-550.621) * [-549.376] (-555.281) (-549.418) (-550.857) -- 0:00:36
488000 -- (-550.174) (-552.158) [-549.996] (-551.134) * (-549.090) [-552.207] (-551.388) (-553.008) -- 0:00:36
488500 -- [-551.047] (-550.923) (-553.563) (-552.010) * [-549.950] (-550.762) (-549.428) (-550.863) -- 0:00:36
489000 -- [-550.240] (-551.952) (-553.731) (-551.718) * (-549.653) [-550.307] (-551.247) (-550.056) -- 0:00:36
489500 -- (-553.548) [-553.317] (-554.730) (-549.092) * [-550.614] (-548.034) (-553.984) (-552.978) -- 0:00:36
490000 -- (-550.812) [-549.605] (-552.169) (-550.893) * (-550.834) (-550.121) [-551.508] (-551.818) -- 0:00:36
Average standard deviation of split frequencies: 0.011709
490500 -- (-550.270) [-549.782] (-551.751) (-552.554) * (-552.276) (-551.964) [-551.887] (-553.993) -- 0:00:36
491000 -- [-549.837] (-549.945) (-549.711) (-550.782) * [-550.088] (-552.705) (-555.711) (-556.412) -- 0:00:36
491500 -- [-551.449] (-550.198) (-552.656) (-550.452) * (-549.077) (-551.870) (-551.089) [-552.059] -- 0:00:36
492000 -- (-549.538) [-550.789] (-553.898) (-549.060) * (-552.218) (-550.792) (-551.737) [-552.364] -- 0:00:37
492500 -- (-549.723) (-551.701) (-553.278) [-550.306] * (-551.804) [-550.429] (-549.948) (-554.097) -- 0:00:37
493000 -- (-548.089) [-552.724] (-552.290) (-551.113) * (-553.345) (-550.597) [-552.324] (-551.567) -- 0:00:37
493500 -- (-549.493) [-550.458] (-549.014) (-555.296) * (-552.705) [-551.115] (-551.136) (-551.191) -- 0:00:36
494000 -- (-550.025) [-550.892] (-552.453) (-552.800) * (-555.268) (-556.242) (-551.817) [-551.045] -- 0:00:36
494500 -- (-550.974) (-548.684) [-549.043] (-553.341) * (-548.122) (-550.914) [-549.327] (-553.148) -- 0:00:36
495000 -- (-549.710) [-551.389] (-550.344) (-552.831) * (-552.348) (-553.606) [-548.125] (-552.591) -- 0:00:36
Average standard deviation of split frequencies: 0.011940
495500 -- [-549.377] (-554.463) (-550.740) (-551.632) * (-550.053) [-550.911] (-556.246) (-555.928) -- 0:00:36
496000 -- (-552.935) [-547.784] (-551.157) (-551.296) * (-549.564) (-551.142) (-552.139) [-553.461] -- 0:00:36
496500 -- (-550.455) [-547.451] (-554.510) (-553.051) * (-551.460) [-549.726] (-551.239) (-549.702) -- 0:00:36
497000 -- [-551.667] (-550.679) (-555.227) (-555.259) * [-549.891] (-549.090) (-551.362) (-552.137) -- 0:00:36
497500 -- (-553.012) (-551.598) (-551.680) [-554.169] * [-550.485] (-551.609) (-551.102) (-551.651) -- 0:00:36
498000 -- [-551.347] (-553.520) (-550.064) (-552.280) * (-549.502) (-552.239) (-548.366) [-554.224] -- 0:00:36
498500 -- [-552.219] (-554.232) (-550.706) (-556.334) * (-549.410) [-554.653] (-554.413) (-550.684) -- 0:00:36
499000 -- [-550.122] (-551.113) (-550.847) (-553.428) * (-548.400) (-551.288) (-550.479) [-551.948] -- 0:00:36
499500 -- (-549.281) (-549.259) [-549.694] (-551.621) * (-551.042) (-556.728) (-552.451) [-549.401] -- 0:00:36
500000 -- (-548.583) (-553.454) [-552.208] (-554.595) * (-549.576) (-555.193) (-550.515) [-554.387] -- 0:00:36
Average standard deviation of split frequencies: 0.011240
500500 -- (-549.984) [-552.634] (-549.945) (-549.138) * [-551.340] (-553.499) (-552.529) (-551.855) -- 0:00:35
501000 -- (-553.009) [-550.311] (-552.722) (-550.865) * (-550.710) [-552.153] (-548.615) (-555.931) -- 0:00:35
501500 -- (-552.194) [-550.674] (-551.907) (-550.219) * (-552.302) [-548.940] (-550.512) (-557.572) -- 0:00:35
502000 -- (-548.734) (-552.499) (-552.342) [-552.368] * (-548.468) (-551.709) [-551.455] (-551.205) -- 0:00:35
502500 -- (-552.456) [-550.275] (-554.429) (-549.297) * (-551.327) [-549.729] (-551.558) (-555.557) -- 0:00:35
503000 -- (-550.420) (-550.985) [-552.072] (-552.449) * (-551.415) [-552.255] (-549.608) (-551.157) -- 0:00:35
503500 -- (-551.220) [-552.778] (-550.980) (-549.972) * (-552.615) (-551.140) (-548.876) [-552.048] -- 0:00:35
504000 -- (-553.179) [-552.309] (-549.750) (-551.062) * (-554.590) (-549.502) [-550.989] (-551.969) -- 0:00:35
504500 -- [-550.614] (-556.007) (-556.438) (-550.789) * (-550.861) [-550.876] (-551.060) (-553.469) -- 0:00:35
505000 -- (-549.923) (-549.784) (-553.323) [-555.274] * (-552.586) (-549.715) (-550.873) [-551.971] -- 0:00:35
Average standard deviation of split frequencies: 0.011673
505500 -- [-550.877] (-552.202) (-551.054) (-553.198) * [-552.573] (-549.517) (-554.161) (-550.666) -- 0:00:35
506000 -- (-550.002) (-551.212) (-551.658) [-550.015] * (-550.110) (-549.006) (-549.611) [-551.603] -- 0:00:36
506500 -- (-548.727) (-553.363) [-552.413] (-554.108) * [-550.182] (-550.581) (-549.113) (-551.236) -- 0:00:36
507000 -- (-549.160) (-551.815) (-551.348) [-551.295] * (-554.793) (-548.598) (-549.711) [-553.811] -- 0:00:35
507500 -- [-549.776] (-552.146) (-548.659) (-551.201) * [-550.625] (-551.511) (-550.830) (-552.346) -- 0:00:35
508000 -- (-553.843) (-553.570) (-548.911) [-556.584] * (-552.044) (-555.991) (-555.568) [-551.345] -- 0:00:35
508500 -- (-553.206) (-550.036) [-549.578] (-553.144) * (-552.916) (-548.951) (-555.943) [-552.981] -- 0:00:35
509000 -- (-550.831) (-555.068) (-550.043) [-553.043] * (-554.702) (-548.799) [-552.090] (-552.864) -- 0:00:35
509500 -- (-548.223) [-551.798] (-552.733) (-551.838) * (-550.632) (-551.131) (-551.400) [-551.130] -- 0:00:35
510000 -- (-549.998) [-551.216] (-553.012) (-550.989) * (-550.927) (-551.038) [-552.047] (-551.994) -- 0:00:35
Average standard deviation of split frequencies: 0.010500
510500 -- (-549.788) (-551.113) (-553.888) [-551.711] * [-550.832] (-549.947) (-551.855) (-552.192) -- 0:00:35
511000 -- [-550.371] (-550.416) (-551.075) (-552.694) * (-550.849) (-554.748) [-552.811] (-551.184) -- 0:00:35
511500 -- (-550.699) (-551.587) [-550.942] (-551.611) * (-553.126) [-553.360] (-556.324) (-551.595) -- 0:00:35
512000 -- [-551.321] (-550.150) (-551.398) (-553.168) * (-550.917) (-553.135) [-550.858] (-554.551) -- 0:00:35
512500 -- (-551.249) (-549.603) (-551.959) [-554.219] * (-552.206) (-551.393) [-555.351] (-551.906) -- 0:00:35
513000 -- (-555.833) (-552.916) [-550.539] (-551.754) * (-550.678) (-554.246) [-551.416] (-550.103) -- 0:00:35
513500 -- (-548.754) (-551.664) (-553.134) [-555.664] * (-550.168) [-553.312] (-549.333) (-549.877) -- 0:00:35
514000 -- [-549.925] (-551.275) (-551.837) (-552.218) * (-551.677) (-554.981) (-552.590) [-549.569] -- 0:00:34
514500 -- (-550.485) (-556.768) (-551.953) [-548.555] * [-557.180] (-550.971) (-550.768) (-549.871) -- 0:00:34
515000 -- (-549.382) (-551.311) [-551.425] (-552.316) * [-549.763] (-553.512) (-554.690) (-552.933) -- 0:00:34
Average standard deviation of split frequencies: 0.009878
515500 -- [-551.848] (-555.789) (-550.356) (-550.710) * [-549.147] (-556.394) (-553.257) (-551.795) -- 0:00:34
516000 -- [-549.270] (-550.720) (-550.594) (-549.710) * (-551.781) [-554.459] (-551.321) (-552.779) -- 0:00:34
516500 -- (-554.638) [-550.938] (-552.208) (-549.568) * (-551.041) (-554.629) (-550.514) [-553.567] -- 0:00:34
517000 -- (-550.432) [-555.485] (-552.188) (-551.039) * (-551.614) (-554.387) (-551.515) [-549.353] -- 0:00:34
517500 -- [-547.969] (-549.193) (-551.536) (-549.769) * [-549.329] (-555.892) (-552.589) (-548.473) -- 0:00:34
518000 -- (-549.133) (-550.587) (-555.127) [-548.982] * [-551.226] (-551.401) (-552.318) (-550.465) -- 0:00:34
518500 -- (-550.518) (-553.198) (-553.537) [-551.928] * (-551.697) [-551.410] (-552.139) (-556.027) -- 0:00:34
519000 -- (-551.081) (-549.786) [-551.114] (-552.327) * [-552.063] (-555.677) (-553.019) (-554.189) -- 0:00:34
519500 -- [-550.420] (-552.503) (-554.431) (-550.658) * (-556.187) (-552.939) (-552.520) [-549.376] -- 0:00:34
520000 -- (-551.295) [-551.525] (-550.541) (-549.405) * (-554.558) (-556.940) [-550.927] (-552.091) -- 0:00:34
Average standard deviation of split frequencies: 0.009507
520500 -- [-551.039] (-550.331) (-550.232) (-550.483) * (-552.903) (-555.923) (-551.598) [-551.455] -- 0:00:35
521000 -- (-550.893) (-551.136) [-549.194] (-551.353) * (-552.041) (-553.157) [-553.405] (-552.176) -- 0:00:34
521500 -- (-556.819) (-553.250) [-550.136] (-550.385) * [-550.802] (-553.875) (-552.136) (-552.908) -- 0:00:34
522000 -- (-553.539) (-552.655) [-553.548] (-548.951) * [-551.678] (-555.038) (-552.438) (-552.989) -- 0:00:34
522500 -- [-548.477] (-551.839) (-549.029) (-551.527) * (-551.120) [-551.566] (-551.354) (-550.415) -- 0:00:34
523000 -- (-549.725) (-552.317) [-548.441] (-553.998) * (-551.370) [-552.601] (-552.835) (-551.759) -- 0:00:34
523500 -- (-549.698) (-550.933) [-549.505] (-554.053) * (-552.242) (-553.865) [-551.892] (-552.483) -- 0:00:34
524000 -- (-555.124) (-554.063) (-550.004) [-555.898] * (-551.876) (-554.251) [-551.183] (-550.509) -- 0:00:34
524500 -- (-555.136) (-553.652) [-549.145] (-558.687) * (-551.366) (-550.367) (-549.668) [-551.806] -- 0:00:34
525000 -- (-550.282) (-553.729) [-551.296] (-554.975) * (-551.636) [-551.791] (-550.771) (-553.854) -- 0:00:34
Average standard deviation of split frequencies: 0.010227
525500 -- [-556.204] (-552.800) (-552.362) (-550.920) * (-554.320) [-552.378] (-553.323) (-550.064) -- 0:00:34
526000 -- (-555.167) (-550.820) (-549.913) [-553.756] * (-552.209) [-550.811] (-552.404) (-550.148) -- 0:00:34
526500 -- (-548.974) (-551.128) (-551.386) [-551.964] * (-553.541) (-550.070) [-552.562] (-551.035) -- 0:00:34
527000 -- (-555.461) [-550.909] (-550.275) (-553.505) * (-555.013) (-551.791) (-550.880) [-550.982] -- 0:00:34
527500 -- [-548.790] (-550.510) (-551.710) (-551.843) * (-553.161) [-555.378] (-551.391) (-551.393) -- 0:00:34
528000 -- (-552.785) (-550.417) [-552.863] (-551.527) * [-551.156] (-556.133) (-553.578) (-552.263) -- 0:00:33
528500 -- (-551.834) [-550.972] (-551.515) (-551.333) * [-552.772] (-552.923) (-551.025) (-552.184) -- 0:00:33
529000 -- (-549.493) (-550.957) [-548.425] (-551.817) * [-551.387] (-550.490) (-552.952) (-549.671) -- 0:00:33
529500 -- (-550.628) [-549.307] (-550.265) (-553.940) * (-553.026) [-552.251] (-553.307) (-551.360) -- 0:00:33
530000 -- (-551.134) (-552.699) (-550.571) [-552.419] * (-556.704) (-551.346) (-551.999) [-552.039] -- 0:00:33
Average standard deviation of split frequencies: 0.010608
530500 -- (-550.978) (-549.752) (-551.930) [-549.608] * (-558.168) (-552.006) (-560.834) [-550.885] -- 0:00:33
531000 -- (-551.515) (-549.243) [-549.947] (-550.477) * [-554.529] (-551.147) (-556.670) (-557.790) -- 0:00:33
531500 -- (-550.093) [-548.865] (-551.072) (-553.723) * [-551.858] (-551.083) (-550.492) (-553.227) -- 0:00:33
532000 -- [-550.344] (-550.421) (-552.105) (-551.792) * [-553.623] (-552.232) (-552.359) (-552.691) -- 0:00:33
532500 -- (-548.838) [-549.783] (-549.781) (-557.127) * [-554.705] (-554.317) (-550.570) (-550.409) -- 0:00:33
533000 -- (-549.798) (-549.900) (-551.177) [-560.119] * [-551.577] (-551.381) (-548.901) (-549.868) -- 0:00:34
533500 -- (-548.403) (-549.013) [-552.932] (-556.375) * (-550.082) (-552.409) (-552.373) [-549.332] -- 0:00:34
534000 -- (-550.872) (-552.639) [-553.013] (-550.446) * (-549.648) (-550.747) (-551.303) [-550.490] -- 0:00:34
534500 -- (-548.703) (-550.933) (-551.155) [-551.281] * [-550.233] (-553.805) (-550.447) (-550.161) -- 0:00:33
535000 -- (-551.292) (-551.313) [-551.525] (-551.004) * (-550.179) (-550.974) (-551.151) [-552.964] -- 0:00:33
Average standard deviation of split frequencies: 0.010114
535500 -- [-548.915] (-550.486) (-554.909) (-550.032) * (-551.418) (-553.891) [-554.639] (-552.140) -- 0:00:33
536000 -- (-553.390) (-550.960) (-549.522) [-549.291] * (-552.195) (-558.122) [-552.239] (-552.926) -- 0:00:33
536500 -- (-548.425) (-549.149) (-550.852) [-550.737] * (-559.547) (-551.455) [-552.145] (-551.803) -- 0:00:33
537000 -- (-552.235) [-551.268] (-551.183) (-551.954) * (-552.472) (-550.624) [-549.856] (-549.861) -- 0:00:33
537500 -- (-550.645) [-548.848] (-554.898) (-555.411) * [-551.205] (-552.426) (-551.421) (-551.724) -- 0:00:33
538000 -- (-550.106) (-550.235) [-550.683] (-553.768) * (-549.988) [-550.819] (-552.643) (-550.660) -- 0:00:33
538500 -- (-548.716) (-553.061) [-549.476] (-553.794) * [-549.267] (-557.377) (-551.709) (-550.947) -- 0:00:33
539000 -- (-549.181) (-553.336) [-550.803] (-551.947) * [-549.822] (-554.313) (-549.634) (-551.972) -- 0:00:33
539500 -- (-551.160) (-552.437) (-553.937) [-550.055] * [-551.949] (-551.683) (-550.006) (-551.016) -- 0:00:33
540000 -- (-548.675) [-549.915] (-551.959) (-551.037) * (-552.294) (-550.659) (-549.599) [-551.627] -- 0:00:33
Average standard deviation of split frequencies: 0.010245
540500 -- [-550.344] (-550.599) (-551.306) (-550.305) * (-551.455) (-552.348) (-550.939) [-551.190] -- 0:00:33
541000 -- [-549.259] (-549.323) (-553.453) (-550.811) * (-551.161) (-552.068) (-554.169) [-550.980] -- 0:00:33
541500 -- (-548.408) (-553.579) (-550.529) [-554.945] * [-553.260] (-554.210) (-552.558) (-552.311) -- 0:00:33
542000 -- (-550.782) (-551.355) (-553.511) [-549.423] * [-551.613] (-552.283) (-550.737) (-550.732) -- 0:00:32
542500 -- (-551.703) [-549.381] (-551.979) (-549.950) * [-551.200] (-551.015) (-554.373) (-551.912) -- 0:00:32
543000 -- (-551.958) [-552.022] (-551.036) (-553.934) * (-555.043) (-551.650) (-551.874) [-550.974] -- 0:00:32
543500 -- (-551.999) (-556.226) (-550.058) [-551.722] * (-552.825) [-551.936] (-550.756) (-550.960) -- 0:00:32
544000 -- [-551.587] (-555.847) (-550.407) (-550.373) * (-550.709) (-552.002) [-550.440] (-553.391) -- 0:00:32
544500 -- (-550.655) [-550.769] (-551.127) (-553.327) * [-553.569] (-551.127) (-552.468) (-553.989) -- 0:00:32
545000 -- (-553.872) (-549.837) (-552.144) [-551.942] * (-555.851) [-550.408] (-552.643) (-550.865) -- 0:00:32
Average standard deviation of split frequencies: 0.010462
545500 -- [-551.001] (-550.246) (-553.824) (-549.547) * (-551.482) (-552.346) [-550.573] (-554.010) -- 0:00:32
546000 -- [-551.746] (-548.737) (-550.570) (-554.658) * (-549.869) (-553.468) [-550.174] (-551.604) -- 0:00:33
546500 -- (-549.316) (-548.162) (-555.055) [-551.867] * (-550.987) (-552.349) [-550.654] (-550.531) -- 0:00:33
547000 -- (-551.120) (-550.064) [-550.714] (-553.126) * (-551.122) (-551.294) (-553.027) [-551.733] -- 0:00:33
547500 -- [-550.613] (-550.764) (-552.806) (-551.818) * (-555.990) (-551.390) [-551.913] (-552.738) -- 0:00:33
548000 -- (-549.844) (-551.440) (-551.980) [-552.240] * [-557.050] (-552.197) (-550.441) (-551.717) -- 0:00:32
548500 -- [-548.919] (-553.781) (-553.554) (-551.123) * (-550.805) (-551.749) (-549.372) [-551.808] -- 0:00:32
549000 -- (-548.548) (-553.188) (-550.702) [-551.073] * (-550.204) (-553.428) (-554.994) [-551.591] -- 0:00:32
549500 -- (-551.389) [-550.940] (-548.934) (-551.206) * (-550.915) (-553.801) [-553.432] (-552.981) -- 0:00:32
550000 -- (-550.453) (-550.656) (-551.286) [-552.738] * [-551.144] (-550.382) (-548.988) (-556.035) -- 0:00:32
Average standard deviation of split frequencies: 0.010726
550500 -- (-548.938) (-549.613) [-553.442] (-556.373) * (-557.066) (-550.893) (-551.595) [-550.803] -- 0:00:32
551000 -- (-553.897) (-553.124) (-550.688) [-551.143] * (-552.326) [-551.588] (-556.543) (-554.002) -- 0:00:32
551500 -- [-551.686] (-551.434) (-551.767) (-552.457) * [-549.375] (-550.353) (-552.205) (-554.846) -- 0:00:32
552000 -- (-551.505) [-551.219] (-551.386) (-551.565) * (-550.679) (-552.016) [-552.390] (-551.469) -- 0:00:32
552500 -- [-551.472] (-550.666) (-554.336) (-552.215) * [-555.382] (-551.703) (-553.914) (-555.272) -- 0:00:32
553000 -- (-550.313) [-551.079] (-550.300) (-553.093) * (-559.881) [-550.101] (-552.587) (-551.758) -- 0:00:32
553500 -- (-548.911) [-550.294] (-553.038) (-551.108) * [-555.409] (-551.796) (-551.930) (-553.578) -- 0:00:32
554000 -- [-548.109] (-551.756) (-549.368) (-554.359) * (-551.052) (-549.906) (-556.199) [-549.127] -- 0:00:32
554500 -- [-554.419] (-555.231) (-555.201) (-552.560) * (-552.042) (-550.774) (-552.649) [-551.192] -- 0:00:32
555000 -- [-550.766] (-556.580) (-552.412) (-553.714) * (-552.505) [-555.594] (-549.362) (-549.828) -- 0:00:32
Average standard deviation of split frequencies: 0.010623
555500 -- (-552.000) (-549.316) (-552.321) [-549.339] * (-551.286) (-551.256) (-549.390) [-551.017] -- 0:00:32
556000 -- (-554.678) [-549.770] (-551.511) (-549.930) * (-551.727) [-551.191] (-549.165) (-551.134) -- 0:00:31
556500 -- (-550.234) [-548.434] (-554.054) (-551.405) * (-552.424) (-552.799) (-550.221) [-550.718] -- 0:00:31
557000 -- [-550.945] (-549.619) (-554.977) (-548.637) * (-551.366) (-553.374) [-549.105] (-552.162) -- 0:00:31
557500 -- [-550.024] (-554.554) (-552.629) (-551.423) * [-552.249] (-552.418) (-550.725) (-549.686) -- 0:00:32
558000 -- (-551.236) [-549.745] (-553.713) (-552.267) * [-550.678] (-554.679) (-552.135) (-551.977) -- 0:00:32
558500 -- (-549.320) (-551.012) (-553.379) [-550.878] * (-552.042) (-551.575) [-548.659] (-552.136) -- 0:00:32
559000 -- (-552.234) (-556.441) (-551.448) [-550.010] * (-551.172) (-551.055) (-549.350) [-549.854] -- 0:00:32
559500 -- (-555.317) (-549.835) (-549.203) [-552.979] * (-550.930) (-553.441) [-553.318] (-551.678) -- 0:00:32
560000 -- (-556.874) [-552.991] (-554.140) (-550.404) * (-550.982) (-551.124) [-551.420] (-552.609) -- 0:00:32
Average standard deviation of split frequencies: 0.010195
560500 -- (-553.662) (-551.634) [-550.038] (-550.755) * [-551.239] (-551.098) (-554.588) (-552.716) -- 0:00:32
561000 -- (-552.441) [-551.760] (-550.743) (-550.722) * (-552.559) [-551.825] (-554.345) (-552.221) -- 0:00:32
561500 -- (-552.236) (-551.743) [-552.526] (-553.069) * (-553.601) (-550.779) [-553.943] (-552.633) -- 0:00:32
562000 -- (-550.755) (-550.529) [-548.811] (-552.257) * [-550.954] (-552.645) (-551.619) (-550.079) -- 0:00:31
562500 -- [-552.107] (-551.363) (-552.107) (-551.657) * (-553.098) (-550.315) [-551.317] (-551.232) -- 0:00:31
563000 -- [-552.936] (-551.317) (-552.083) (-557.072) * (-555.709) [-552.090] (-553.245) (-550.607) -- 0:00:31
563500 -- (-548.585) [-552.048] (-551.165) (-557.395) * (-551.911) (-551.068) (-550.158) [-550.048] -- 0:00:31
564000 -- (-553.569) [-552.772] (-553.172) (-552.618) * (-551.205) [-550.912] (-552.504) (-551.279) -- 0:00:31
564500 -- (-550.348) [-551.641] (-550.723) (-553.472) * [-552.332] (-553.914) (-553.841) (-550.748) -- 0:00:31
565000 -- [-550.885] (-549.424) (-558.948) (-555.445) * (-553.233) (-552.687) [-552.838] (-552.920) -- 0:00:31
Average standard deviation of split frequencies: 0.010099
565500 -- (-551.697) [-552.489] (-552.698) (-556.843) * (-550.674) [-553.900] (-553.955) (-552.646) -- 0:00:31
566000 -- (-551.007) (-549.213) [-553.177] (-550.784) * (-552.103) (-554.368) (-554.002) [-551.560] -- 0:00:31
566500 -- [-553.905] (-552.590) (-550.241) (-550.497) * [-550.599] (-548.740) (-550.463) (-549.969) -- 0:00:31
567000 -- (-555.016) (-552.326) [-551.039] (-550.905) * (-551.929) [-551.087] (-551.153) (-550.439) -- 0:00:31
567500 -- (-551.247) (-552.429) (-552.610) [-551.932] * (-554.824) (-548.489) (-551.923) [-550.433] -- 0:00:31
568000 -- [-552.938] (-550.621) (-549.439) (-554.615) * (-551.255) (-549.408) [-551.434] (-551.867) -- 0:00:31
568500 -- (-554.460) (-551.364) [-549.987] (-551.555) * (-551.639) [-551.607] (-551.278) (-551.194) -- 0:00:31
569000 -- (-552.415) (-550.040) (-551.937) [-551.494] * (-550.870) [-549.631] (-552.027) (-550.247) -- 0:00:31
569500 -- (-550.267) (-551.092) [-552.347] (-549.537) * (-554.240) (-551.320) [-553.364] (-557.030) -- 0:00:30
570000 -- [-551.762] (-551.367) (-551.224) (-551.033) * (-551.683) [-550.856] (-556.640) (-551.100) -- 0:00:31
Average standard deviation of split frequencies: 0.009748
570500 -- (-549.671) (-553.189) [-549.858] (-552.762) * (-553.278) (-553.900) [-551.167] (-550.111) -- 0:00:31
571000 -- (-552.961) (-554.430) (-553.684) [-551.810] * (-551.113) (-554.531) [-552.892] (-555.113) -- 0:00:31
571500 -- [-553.472] (-551.096) (-550.894) (-550.782) * [-551.513] (-552.574) (-551.257) (-555.293) -- 0:00:31
572000 -- (-552.111) (-550.990) [-553.778] (-551.152) * (-552.410) (-552.045) (-554.237) [-552.689] -- 0:00:31
572500 -- (-551.690) (-551.309) [-553.774] (-551.554) * (-551.104) [-552.500] (-550.597) (-551.960) -- 0:00:31
573000 -- (-551.009) (-551.142) [-548.634] (-550.271) * (-558.926) (-551.878) [-550.915] (-552.773) -- 0:00:31
573500 -- [-548.771] (-551.159) (-552.878) (-553.564) * (-552.388) [-551.032] (-550.924) (-552.405) -- 0:00:31
574000 -- (-551.382) [-550.529] (-552.615) (-553.020) * (-553.865) (-550.065) (-552.438) [-551.945] -- 0:00:31
574500 -- (-549.822) (-549.911) [-550.293] (-560.149) * [-552.767] (-550.350) (-553.511) (-553.138) -- 0:00:31
575000 -- (-551.549) [-549.276] (-550.880) (-553.623) * (-552.062) [-556.370] (-555.449) (-552.092) -- 0:00:31
Average standard deviation of split frequencies: 0.010148
575500 -- (-550.455) (-551.571) (-551.788) [-553.138] * (-550.122) [-552.870] (-552.442) (-550.346) -- 0:00:30
576000 -- (-556.674) (-550.496) (-550.732) [-551.631] * (-552.068) (-550.995) (-552.808) [-548.303] -- 0:00:30
576500 -- (-557.261) [-550.268] (-552.559) (-552.440) * [-552.369] (-553.468) (-554.919) (-554.313) -- 0:00:30
577000 -- (-550.677) (-549.684) (-551.732) [-550.840] * (-553.586) [-551.146] (-548.109) (-550.848) -- 0:00:30
577500 -- [-552.408] (-552.120) (-551.991) (-551.440) * [-552.458] (-552.524) (-554.934) (-551.570) -- 0:00:30
578000 -- (-552.618) (-554.038) (-554.880) [-550.765] * (-562.452) (-552.547) [-552.606] (-551.432) -- 0:00:30
578500 -- (-549.479) (-555.515) [-550.964] (-554.374) * (-551.287) (-552.162) [-549.355] (-553.874) -- 0:00:30
579000 -- [-549.880] (-552.973) (-551.573) (-551.378) * (-549.892) (-551.569) [-551.704] (-550.128) -- 0:00:30
579500 -- [-549.881] (-549.729) (-556.487) (-551.014) * (-553.702) [-551.799] (-550.572) (-551.679) -- 0:00:30
580000 -- [-549.129] (-554.344) (-552.440) (-551.734) * (-552.446) [-551.029] (-548.635) (-552.845) -- 0:00:30
Average standard deviation of split frequencies: 0.010391
580500 -- [-548.498] (-554.829) (-551.785) (-554.364) * [-550.409] (-551.479) (-553.310) (-555.677) -- 0:00:30
581000 -- [-549.281] (-552.563) (-551.236) (-550.945) * [-550.108] (-550.438) (-552.055) (-552.033) -- 0:00:31
581500 -- (-551.645) (-552.039) (-550.289) [-550.042] * (-550.259) (-550.725) [-550.882] (-556.149) -- 0:00:30
582000 -- [-549.145] (-552.005) (-551.421) (-548.199) * [-550.526] (-550.515) (-553.714) (-554.407) -- 0:00:30
582500 -- (-549.103) [-552.172] (-549.864) (-551.391) * (-551.961) [-550.655] (-551.925) (-549.727) -- 0:00:30
583000 -- (-550.451) (-552.860) (-549.860) [-553.008] * (-550.898) [-550.384] (-551.441) (-552.538) -- 0:00:30
583500 -- (-554.868) (-552.888) [-552.150] (-551.506) * (-553.079) [-552.585] (-550.253) (-552.029) -- 0:00:30
584000 -- (-553.824) (-553.880) [-550.376] (-550.633) * (-554.930) (-551.143) [-549.535] (-551.973) -- 0:00:30
584500 -- [-552.141] (-551.960) (-552.018) (-554.056) * [-552.412] (-551.081) (-551.226) (-553.203) -- 0:00:30
585000 -- (-552.784) (-552.450) [-552.209] (-550.682) * [-549.996] (-552.373) (-551.432) (-552.584) -- 0:00:30
Average standard deviation of split frequencies: 0.010619
585500 -- (-554.724) (-549.813) [-551.241] (-552.317) * (-550.394) (-553.105) (-549.676) [-552.210] -- 0:00:30
586000 -- (-549.787) [-552.176] (-554.451) (-550.050) * (-551.372) (-550.570) [-551.047] (-550.956) -- 0:00:30
586500 -- [-551.698] (-551.572) (-551.495) (-551.183) * (-554.765) (-551.476) (-552.072) [-550.225] -- 0:00:30
587000 -- (-551.290) (-555.422) (-552.567) [-551.393] * [-552.186] (-556.809) (-549.504) (-553.396) -- 0:00:30
587500 -- [-550.600] (-550.533) (-550.967) (-553.162) * (-549.129) [-551.622] (-551.156) (-551.042) -- 0:00:30
588000 -- (-551.287) [-552.086] (-551.336) (-550.376) * (-551.280) [-550.766] (-552.757) (-553.032) -- 0:00:30
588500 -- (-550.604) (-552.487) (-553.565) [-552.508] * (-551.105) (-554.317) [-550.557] (-550.924) -- 0:00:30
589000 -- [-553.307] (-551.553) (-551.862) (-551.119) * (-550.686) [-549.325] (-551.278) (-552.856) -- 0:00:30
589500 -- (-551.627) (-550.770) [-548.904] (-555.661) * [-552.126] (-547.978) (-549.801) (-552.369) -- 0:00:29
590000 -- (-553.119) (-552.742) [-548.428] (-553.909) * (-553.114) (-549.292) [-552.908] (-552.383) -- 0:00:29
Average standard deviation of split frequencies: 0.010275
590500 -- [-550.406] (-551.722) (-550.915) (-551.911) * (-550.563) [-550.853] (-552.102) (-551.921) -- 0:00:29
591000 -- (-550.896) (-550.469) (-553.592) [-552.299] * (-554.617) (-549.732) [-550.129] (-551.116) -- 0:00:29
591500 -- (-550.903) [-550.374] (-549.089) (-550.074) * (-551.496) [-552.136] (-551.750) (-552.478) -- 0:00:29
592000 -- (-550.313) [-548.778] (-550.035) (-550.722) * [-554.074] (-552.791) (-551.401) (-553.319) -- 0:00:29
592500 -- [-549.088] (-551.674) (-551.838) (-552.721) * (-551.616) [-552.346] (-552.158) (-551.088) -- 0:00:30
593000 -- (-548.988) (-552.035) [-556.254] (-553.881) * [-551.540] (-552.020) (-554.186) (-551.700) -- 0:00:30
593500 -- [-550.479] (-551.066) (-550.300) (-553.327) * (-551.785) [-551.385] (-551.147) (-551.818) -- 0:00:30
594000 -- (-550.464) (-548.708) [-553.607] (-553.003) * (-553.714) (-548.106) [-550.758] (-552.975) -- 0:00:30
594500 -- (-550.121) [-550.354] (-554.359) (-551.653) * (-559.506) (-550.319) [-549.494] (-552.249) -- 0:00:30
595000 -- [-550.241] (-558.859) (-552.363) (-555.490) * (-556.216) (-553.133) [-552.384] (-550.784) -- 0:00:29
Average standard deviation of split frequencies: 0.010599
595500 -- (-551.031) (-554.413) (-550.590) [-552.301] * [-552.159] (-550.794) (-551.768) (-550.501) -- 0:00:29
596000 -- (-550.965) (-555.023) (-552.236) [-552.040] * (-551.128) (-550.588) (-552.657) [-554.441] -- 0:00:29
596500 -- [-552.571] (-552.045) (-552.434) (-553.028) * [-550.690] (-553.261) (-548.382) (-552.632) -- 0:00:29
597000 -- (-550.665) [-548.655] (-550.412) (-551.687) * (-553.195) (-550.469) [-549.882] (-555.002) -- 0:00:29
597500 -- (-552.122) (-550.988) [-550.921] (-551.636) * (-550.299) (-550.601) (-550.425) [-555.363] -- 0:00:29
598000 -- [-548.906] (-554.641) (-555.272) (-554.491) * (-553.508) (-552.638) [-550.275] (-554.449) -- 0:00:29
598500 -- (-558.353) [-554.752] (-553.455) (-556.670) * (-551.186) (-553.026) (-551.743) [-550.995] -- 0:00:29
599000 -- [-549.831] (-552.007) (-551.726) (-552.893) * (-551.361) (-549.827) (-550.544) [-551.308] -- 0:00:29
599500 -- [-551.585] (-552.644) (-552.189) (-550.237) * (-551.119) (-550.332) (-550.735) [-552.256] -- 0:00:29
600000 -- (-550.581) (-553.486) (-554.418) [-554.723] * (-551.926) (-552.399) [-559.754] (-552.963) -- 0:00:29
Average standard deviation of split frequencies: 0.010412
600500 -- (-553.898) (-554.243) [-550.624] (-551.586) * (-555.029) (-550.955) [-550.379] (-553.478) -- 0:00:29
601000 -- (-552.507) [-550.243] (-553.051) (-552.273) * (-552.260) [-550.312] (-552.012) (-551.606) -- 0:00:29
601500 -- (-552.618) (-549.975) (-551.560) [-551.514] * (-549.787) (-551.530) [-550.988] (-550.475) -- 0:00:29
602000 -- [-551.053] (-550.481) (-555.007) (-550.082) * [-550.659] (-549.971) (-552.837) (-551.497) -- 0:00:29
602500 -- (-552.499) (-550.263) (-551.300) [-550.998] * (-550.750) (-550.214) (-549.650) [-553.095] -- 0:00:29
603000 -- (-548.269) (-552.986) [-552.923] (-552.313) * (-550.612) (-552.672) [-550.843] (-551.561) -- 0:00:28
603500 -- (-553.860) [-552.021] (-550.254) (-552.334) * (-558.324) (-552.038) [-551.993] (-552.037) -- 0:00:28
604000 -- [-552.127] (-550.435) (-550.842) (-551.765) * (-552.689) (-551.714) (-550.697) [-553.059] -- 0:00:28
604500 -- (-552.490) [-552.634] (-550.549) (-549.413) * [-549.642] (-552.049) (-551.129) (-550.219) -- 0:00:28
605000 -- (-550.476) (-551.320) (-550.367) [-551.331] * (-549.075) (-551.093) [-555.529] (-552.623) -- 0:00:29
Average standard deviation of split frequencies: 0.010787
605500 -- (-552.141) [-548.211] (-555.795) (-549.191) * (-550.033) [-550.965] (-555.577) (-550.868) -- 0:00:29
606000 -- [-552.494] (-549.915) (-551.266) (-550.965) * (-550.172) [-551.725] (-558.691) (-552.072) -- 0:00:29
606500 -- (-552.169) (-551.373) (-551.022) [-555.127] * [-551.169] (-555.968) (-554.692) (-550.579) -- 0:00:29
607000 -- [-550.348] (-550.502) (-554.954) (-550.399) * [-550.221] (-553.260) (-551.941) (-550.232) -- 0:00:29
607500 -- [-551.212] (-550.277) (-550.535) (-550.485) * (-551.791) (-553.345) (-552.365) [-551.135] -- 0:00:29
608000 -- (-551.181) (-551.536) [-548.426] (-549.732) * (-548.705) (-551.245) [-552.665] (-549.707) -- 0:00:29
608500 -- [-552.944] (-556.209) (-550.379) (-551.216) * [-550.061] (-552.333) (-554.089) (-552.770) -- 0:00:28
609000 -- [-548.738] (-552.379) (-549.114) (-550.002) * [-550.218] (-555.998) (-551.777) (-549.212) -- 0:00:28
609500 -- [-553.007] (-553.331) (-549.926) (-551.503) * (-551.554) (-553.020) [-549.869] (-551.435) -- 0:00:28
610000 -- (-550.870) (-549.584) (-552.436) [-552.110] * (-549.699) (-559.156) (-549.755) [-549.518] -- 0:00:28
Average standard deviation of split frequencies: 0.010807
610500 -- [-550.698] (-550.523) (-551.756) (-552.968) * [-548.220] (-555.402) (-552.663) (-552.659) -- 0:00:28
611000 -- (-550.903) (-549.134) (-550.584) [-549.135] * (-550.925) (-552.775) (-552.682) [-552.828] -- 0:00:28
611500 -- [-551.695] (-549.658) (-554.036) (-549.053) * (-554.298) [-553.138] (-551.746) (-550.742) -- 0:00:28
612000 -- (-551.284) (-551.556) [-551.281] (-549.951) * [-552.035] (-553.253) (-552.949) (-554.505) -- 0:00:28
612500 -- (-553.824) (-551.078) [-551.151] (-550.787) * (-554.562) (-553.444) (-551.728) [-552.598] -- 0:00:28
613000 -- (-555.655) (-554.959) (-552.438) [-551.852] * (-553.763) [-551.469] (-551.681) (-551.762) -- 0:00:28
613500 -- (-553.818) (-552.040) (-551.218) [-551.615] * (-552.485) [-550.579] (-553.955) (-553.971) -- 0:00:28
614000 -- (-559.294) (-550.840) [-556.101] (-551.331) * [-551.681] (-550.579) (-551.251) (-550.314) -- 0:00:28
614500 -- (-551.277) (-551.237) (-555.832) [-550.444] * (-552.513) (-553.401) [-550.619] (-551.038) -- 0:00:28
615000 -- (-551.918) [-550.649] (-551.380) (-552.020) * (-552.159) (-553.365) [-549.588] (-553.675) -- 0:00:28
Average standard deviation of split frequencies: 0.010255
615500 -- (-552.824) [-551.250] (-552.022) (-550.944) * (-551.849) (-551.828) [-549.218] (-553.290) -- 0:00:28
616000 -- (-550.744) (-553.122) (-551.402) [-551.217] * (-552.325) (-550.635) [-549.588] (-558.867) -- 0:00:28
616500 -- (-550.944) (-551.427) [-551.287] (-548.881) * [-550.791] (-552.615) (-550.862) (-550.967) -- 0:00:27
617000 -- (-552.388) (-554.518) [-553.924] (-554.698) * (-552.291) [-553.342] (-549.271) (-549.868) -- 0:00:27
617500 -- (-553.844) (-554.273) (-553.518) [-549.500] * (-551.634) (-551.384) (-551.265) [-549.839] -- 0:00:27
618000 -- (-551.947) (-550.795) (-552.341) [-552.098] * (-552.044) (-552.377) (-550.415) [-551.308] -- 0:00:27
618500 -- (-551.224) [-550.600] (-551.072) (-550.212) * (-551.952) [-549.861] (-549.008) (-551.886) -- 0:00:27
619000 -- (-552.351) [-551.752] (-555.855) (-550.161) * (-550.518) (-551.802) [-550.180] (-552.796) -- 0:00:28
619500 -- [-552.655] (-552.332) (-551.525) (-551.643) * (-550.512) [-551.992] (-549.567) (-551.424) -- 0:00:28
620000 -- (-553.717) [-554.096] (-551.162) (-553.066) * [-552.046] (-549.963) (-549.487) (-549.381) -- 0:00:28
Average standard deviation of split frequencies: 0.009823
620500 -- (-552.789) [-552.167] (-550.317) (-550.893) * [-555.274] (-555.432) (-551.200) (-551.054) -- 0:00:28
621000 -- (-550.541) (-553.117) (-551.394) [-551.279] * [-552.334] (-556.705) (-551.118) (-551.854) -- 0:00:28
621500 -- (-552.103) (-551.371) [-549.375] (-550.701) * (-552.256) (-549.236) [-551.168] (-551.123) -- 0:00:28
622000 -- (-550.941) (-552.841) [-549.243] (-553.798) * (-552.750) [-550.668] (-550.753) (-548.903) -- 0:00:27
622500 -- (-552.148) (-552.799) [-550.134] (-550.975) * (-551.753) [-547.826] (-551.879) (-552.861) -- 0:00:27
623000 -- (-550.910) (-552.069) (-553.053) [-549.694] * (-552.044) (-548.837) [-551.637] (-549.989) -- 0:00:27
623500 -- (-554.527) [-549.958] (-551.448) (-552.427) * (-551.846) (-551.506) [-549.441] (-551.661) -- 0:00:27
624000 -- (-553.130) [-549.421] (-553.128) (-550.859) * (-551.470) (-549.168) (-550.453) [-552.603] -- 0:00:27
624500 -- (-553.504) (-553.423) (-552.966) [-549.602] * (-550.910) (-549.349) [-550.897] (-551.114) -- 0:00:27
625000 -- (-551.524) (-550.756) [-552.632] (-550.668) * (-551.343) (-549.967) (-551.515) [-548.943] -- 0:00:27
Average standard deviation of split frequencies: 0.009225
625500 -- (-554.003) [-550.541] (-554.366) (-551.396) * [-550.617] (-550.148) (-553.362) (-549.549) -- 0:00:27
626000 -- (-551.827) [-549.049] (-559.303) (-554.195) * (-549.377) (-552.009) (-553.555) [-548.946] -- 0:00:27
626500 -- (-551.646) (-551.837) (-553.170) [-553.344] * (-551.740) [-552.150] (-552.707) (-553.053) -- 0:00:27
627000 -- (-553.645) (-553.951) (-553.515) [-552.717] * (-550.723) (-553.216) [-553.107] (-551.115) -- 0:00:27
627500 -- (-551.129) (-554.238) (-552.759) [-551.167] * [-551.027] (-548.543) (-553.159) (-549.998) -- 0:00:27
628000 -- (-554.613) (-551.935) [-551.022] (-550.530) * (-553.737) (-549.806) [-554.715] (-550.049) -- 0:00:27
628500 -- (-553.163) [-558.589] (-555.570) (-550.317) * (-552.417) [-548.248] (-551.936) (-549.995) -- 0:00:27
629000 -- [-552.577] (-558.735) (-554.878) (-550.716) * [-549.912] (-551.383) (-551.193) (-550.243) -- 0:00:27
629500 -- (-549.591) (-551.974) [-551.170] (-552.088) * (-549.457) (-553.443) [-551.449] (-550.540) -- 0:00:27
630000 -- (-550.731) [-552.776] (-550.444) (-553.024) * [-550.014] (-548.180) (-558.498) (-551.103) -- 0:00:27
Average standard deviation of split frequencies: 0.009717
630500 -- (-553.207) (-553.677) (-549.554) [-552.768] * [-553.149] (-554.223) (-552.463) (-551.706) -- 0:00:26
631000 -- (-550.031) [-549.250] (-551.884) (-551.668) * (-552.310) [-552.099] (-550.480) (-553.062) -- 0:00:26
631500 -- (-553.218) [-555.049] (-552.725) (-554.094) * [-550.408] (-551.506) (-549.589) (-551.068) -- 0:00:26
632000 -- (-551.338) (-553.339) [-550.328] (-556.295) * [-551.410] (-551.208) (-549.907) (-552.178) -- 0:00:26
632500 -- [-550.688] (-553.702) (-552.056) (-549.830) * [-551.505] (-550.310) (-552.313) (-550.120) -- 0:00:26
633000 -- [-549.285] (-553.246) (-555.712) (-551.608) * (-552.030) (-555.180) (-549.626) [-549.207] -- 0:00:27
633500 -- (-551.048) [-551.467] (-553.253) (-551.139) * (-549.955) (-552.538) (-551.413) [-550.463] -- 0:00:27
634000 -- [-551.953] (-549.567) (-551.610) (-551.657) * (-552.467) (-551.220) [-553.451] (-552.722) -- 0:00:27
634500 -- (-551.745) [-551.500] (-550.327) (-553.478) * (-551.217) (-552.355) [-551.816] (-555.956) -- 0:00:27
635000 -- [-549.291] (-554.251) (-552.296) (-553.974) * (-552.899) (-551.488) (-551.219) [-551.711] -- 0:00:27
Average standard deviation of split frequencies: 0.010072
635500 -- (-552.083) [-551.473] (-553.207) (-550.812) * (-555.262) (-548.685) [-550.939] (-550.017) -- 0:00:26
636000 -- [-552.113] (-550.307) (-553.035) (-554.582) * (-556.054) (-550.289) [-552.053] (-554.588) -- 0:00:26
636500 -- (-551.137) [-551.425] (-549.859) (-554.339) * (-551.103) (-553.539) (-549.958) [-549.846] -- 0:00:26
637000 -- [-550.478] (-552.872) (-552.535) (-553.434) * (-555.466) (-550.673) (-552.818) [-549.446] -- 0:00:26
637500 -- [-551.122] (-551.137) (-556.475) (-554.660) * (-558.281) [-555.806] (-552.620) (-551.107) -- 0:00:26
638000 -- (-551.628) (-550.814) [-553.277] (-551.950) * [-549.640] (-552.160) (-548.328) (-551.389) -- 0:00:26
638500 -- (-554.010) (-550.608) [-551.155] (-554.360) * [-548.355] (-555.313) (-550.180) (-550.962) -- 0:00:26
639000 -- (-552.016) [-550.472] (-551.966) (-554.045) * (-551.360) [-552.960] (-551.874) (-550.160) -- 0:00:26
639500 -- (-552.617) [-550.791] (-552.282) (-551.479) * (-549.236) (-551.496) (-554.357) [-550.640] -- 0:00:26
640000 -- (-549.016) (-550.290) (-551.716) [-550.640] * (-549.817) [-553.263] (-552.607) (-550.780) -- 0:00:26
Average standard deviation of split frequencies: 0.009825
640500 -- (-552.487) (-552.321) [-554.176] (-552.297) * [-549.586] (-551.019) (-554.083) (-551.831) -- 0:00:26
641000 -- (-550.431) [-553.599] (-553.657) (-551.089) * [-550.130] (-551.635) (-551.736) (-558.386) -- 0:00:26
641500 -- (-550.833) [-552.009] (-551.211) (-552.406) * (-552.216) [-549.374] (-554.380) (-551.485) -- 0:00:26
642000 -- (-550.378) (-552.466) (-550.561) [-549.545] * (-550.466) (-552.985) [-549.398] (-555.274) -- 0:00:26
642500 -- (-551.916) (-552.542) (-552.066) [-549.306] * [-548.267] (-553.970) (-550.853) (-550.639) -- 0:00:26
643000 -- (-551.826) (-551.870) [-551.577] (-550.206) * (-554.326) (-552.560) [-549.886] (-549.241) -- 0:00:26
643500 -- (-550.659) [-550.281] (-552.363) (-555.687) * (-549.761) [-552.509] (-550.315) (-553.327) -- 0:00:26
644000 -- (-550.495) (-549.750) [-553.453] (-550.305) * (-549.668) (-555.300) (-553.819) [-554.161] -- 0:00:25
644500 -- (-550.540) (-552.701) (-549.742) [-550.916] * (-552.195) [-552.781] (-553.603) (-554.655) -- 0:00:25
645000 -- (-550.226) (-551.437) (-551.833) [-550.473] * (-559.563) (-554.812) (-554.834) [-550.642] -- 0:00:25
Average standard deviation of split frequencies: 0.009744
645500 -- (-550.114) (-549.481) (-551.154) [-550.562] * [-549.630] (-554.933) (-553.170) (-551.798) -- 0:00:25
646000 -- (-552.527) (-549.613) (-556.947) [-549.265] * [-548.593] (-552.929) (-551.221) (-551.522) -- 0:00:25
646500 -- (-552.098) (-551.406) [-551.145] (-552.894) * (-548.565) (-553.001) (-550.178) [-552.942] -- 0:00:25
647000 -- (-549.719) (-552.221) [-551.322] (-552.718) * [-548.397] (-550.692) (-550.470) (-553.924) -- 0:00:26
647500 -- (-551.288) (-556.011) (-549.275) [-550.735] * (-548.608) (-553.771) [-552.883] (-551.624) -- 0:00:26
648000 -- [-550.048] (-551.948) (-549.583) (-552.187) * (-550.750) (-551.310) (-552.164) [-552.517] -- 0:00:26
648500 -- (-552.229) (-553.371) (-548.054) [-548.874] * (-553.520) (-550.406) (-551.387) [-550.941] -- 0:00:26
649000 -- [-558.235] (-553.139) (-552.091) (-553.961) * (-555.161) (-551.261) (-553.512) [-550.084] -- 0:00:25
649500 -- (-554.415) (-551.764) [-549.216] (-553.279) * (-552.474) [-551.200] (-555.868) (-555.849) -- 0:00:25
650000 -- (-553.254) (-552.124) [-549.770] (-554.909) * (-555.954) (-549.487) (-555.106) [-551.205] -- 0:00:25
Average standard deviation of split frequencies: 0.009376
650500 -- [-550.397] (-550.626) (-550.993) (-551.829) * (-553.772) (-550.723) (-549.347) [-553.231] -- 0:00:25
651000 -- [-548.709] (-550.590) (-551.793) (-550.588) * (-552.750) (-550.354) [-549.492] (-553.879) -- 0:00:25
651500 -- (-550.831) (-550.638) [-551.458] (-552.952) * [-551.441] (-551.620) (-549.476) (-554.232) -- 0:00:25
652000 -- (-549.225) (-554.996) (-555.562) [-551.599] * (-554.337) [-557.348] (-549.492) (-550.681) -- 0:00:25
652500 -- [-551.269] (-551.806) (-552.429) (-552.256) * (-551.973) (-552.677) [-550.974] (-550.994) -- 0:00:25
653000 -- (-550.351) (-552.827) [-550.410] (-557.046) * (-552.495) (-554.187) [-551.210] (-551.711) -- 0:00:25
653500 -- (-550.227) (-552.110) [-548.350] (-551.995) * (-551.743) [-551.248] (-549.948) (-551.915) -- 0:00:25
654000 -- [-549.506] (-549.831) (-552.056) (-551.850) * (-552.398) [-551.796] (-550.341) (-550.871) -- 0:00:25
654500 -- (-551.705) (-555.732) (-553.671) [-552.856] * [-550.513] (-550.325) (-554.592) (-551.825) -- 0:00:25
655000 -- (-562.600) (-553.836) [-551.213] (-553.849) * (-550.255) [-551.010] (-551.517) (-553.652) -- 0:00:25
Average standard deviation of split frequencies: 0.009004
655500 -- [-550.775] (-553.558) (-553.258) (-552.757) * (-549.443) (-550.049) (-550.268) [-550.511] -- 0:00:25
656000 -- (-554.224) [-551.172] (-550.392) (-555.386) * [-550.603] (-555.054) (-549.981) (-550.761) -- 0:00:25
656500 -- (-550.893) (-551.680) (-548.698) [-555.529] * [-554.135] (-553.116) (-552.292) (-551.357) -- 0:00:25
657000 -- (-548.623) [-548.717] (-551.903) (-554.671) * (-556.907) (-551.924) [-549.294] (-550.951) -- 0:00:25
657500 -- (-552.327) (-552.860) [-549.756] (-557.986) * (-551.190) (-552.173) (-550.136) [-550.543] -- 0:00:25
658000 -- (-550.823) [-548.020] (-550.958) (-550.977) * (-551.080) (-551.434) (-554.318) [-550.110] -- 0:00:24
658500 -- [-552.693] (-552.374) (-553.578) (-551.113) * (-550.806) (-552.049) (-549.630) [-549.752] -- 0:00:24
659000 -- (-552.742) (-549.271) (-554.169) [-550.704] * (-551.740) [-551.472] (-550.227) (-548.214) -- 0:00:24
659500 -- (-551.784) (-549.459) (-550.393) [-550.717] * (-553.132) [-550.538] (-548.542) (-550.352) -- 0:00:24
660000 -- (-554.987) [-550.346] (-551.812) (-552.609) * (-552.627) (-551.633) [-549.491] (-549.914) -- 0:00:25
Average standard deviation of split frequencies: 0.009142
660500 -- (-553.993) (-549.889) [-552.711] (-551.397) * (-552.550) (-550.055) (-550.571) [-548.561] -- 0:00:25
661000 -- (-555.733) (-550.614) [-549.004] (-551.219) * (-553.064) [-549.713] (-552.384) (-552.585) -- 0:00:25
661500 -- (-553.489) (-550.880) (-552.919) [-548.948] * (-551.728) [-549.606] (-553.488) (-550.853) -- 0:00:25
662000 -- [-550.869] (-550.778) (-554.998) (-557.651) * (-551.617) (-555.299) [-552.951] (-550.090) -- 0:00:25
662500 -- (-553.147) (-554.693) (-553.348) [-550.909] * (-554.539) (-551.203) (-548.240) [-553.379] -- 0:00:24
663000 -- (-552.565) (-550.899) (-550.385) [-547.926] * (-555.018) (-551.836) [-549.106] (-551.953) -- 0:00:24
663500 -- (-553.197) [-552.070] (-549.628) (-548.074) * [-552.739] (-552.440) (-552.812) (-552.295) -- 0:00:24
664000 -- (-552.609) [-549.487] (-549.738) (-548.637) * [-550.783] (-551.537) (-553.047) (-555.041) -- 0:00:24
664500 -- (-552.605) (-550.459) (-551.531) [-551.158] * (-552.289) [-549.859] (-552.289) (-556.108) -- 0:00:24
665000 -- (-550.418) (-550.906) [-550.675] (-550.961) * (-552.930) (-549.875) (-552.364) [-552.457] -- 0:00:24
Average standard deviation of split frequencies: 0.009326
665500 -- [-549.877] (-550.422) (-551.935) (-550.928) * (-551.516) (-550.894) (-553.642) [-554.221] -- 0:00:24
666000 -- (-550.498) [-552.345] (-552.641) (-556.977) * [-550.085] (-556.281) (-550.341) (-550.329) -- 0:00:24
666500 -- (-551.529) [-551.086] (-551.912) (-561.009) * (-554.417) (-551.467) (-552.784) [-550.831] -- 0:00:24
667000 -- (-549.783) (-549.498) [-550.391] (-552.043) * (-550.701) (-555.022) [-551.145] (-550.804) -- 0:00:24
667500 -- (-551.288) (-554.127) [-549.098] (-551.580) * [-551.361] (-552.175) (-548.870) (-553.259) -- 0:00:24
668000 -- (-552.570) (-550.443) [-549.913] (-553.357) * (-552.280) (-552.781) [-549.367] (-552.143) -- 0:00:24
668500 -- (-550.577) (-555.560) [-550.391] (-550.084) * [-552.049] (-549.381) (-549.545) (-550.782) -- 0:00:24
669000 -- (-552.139) (-557.321) (-548.887) [-552.683] * [-549.147] (-550.987) (-553.391) (-550.352) -- 0:00:24
669500 -- [-548.862] (-554.197) (-553.214) (-554.758) * (-552.341) [-551.926] (-549.380) (-553.434) -- 0:00:24
670000 -- (-549.577) (-553.429) [-554.046] (-552.458) * [-551.760] (-552.131) (-553.039) (-551.629) -- 0:00:24
Average standard deviation of split frequencies: 0.008889
670500 -- (-549.522) (-551.983) [-551.367] (-550.488) * (-549.535) [-551.244] (-551.876) (-554.320) -- 0:00:24
671000 -- (-551.188) (-551.685) [-550.472] (-551.520) * (-551.777) (-551.892) [-550.820] (-553.134) -- 0:00:24
671500 -- [-551.485] (-551.755) (-552.488) (-552.308) * (-550.591) (-551.282) (-549.500) [-550.831] -- 0:00:23
672000 -- (-552.349) [-553.768] (-552.823) (-550.949) * (-553.027) [-553.271] (-550.485) (-552.540) -- 0:00:23
672500 -- (-551.493) (-554.184) (-551.039) [-550.050] * (-552.666) (-550.850) [-550.077] (-552.437) -- 0:00:23
673000 -- (-553.105) [-550.437] (-552.914) (-550.450) * (-552.359) [-551.028] (-550.870) (-550.745) -- 0:00:23
673500 -- (-550.754) (-550.857) [-550.008] (-548.614) * (-550.193) (-549.935) [-549.423] (-554.292) -- 0:00:23
674000 -- (-553.944) [-550.276] (-552.825) (-553.248) * [-550.646] (-553.823) (-551.140) (-552.319) -- 0:00:24
674500 -- (-550.820) (-551.342) [-554.598] (-549.231) * (-553.943) (-550.503) (-549.197) [-551.194] -- 0:00:24
675000 -- (-552.914) [-552.427] (-549.946) (-552.151) * (-549.877) (-551.979) (-549.437) [-551.671] -- 0:00:24
Average standard deviation of split frequencies: 0.009240
675500 -- (-551.796) (-553.275) (-549.953) [-550.201] * (-553.420) [-549.773] (-551.939) (-551.223) -- 0:00:24
676000 -- (-553.094) (-552.754) [-551.594] (-555.934) * (-550.676) [-550.041] (-548.266) (-554.004) -- 0:00:23
676500 -- (-551.752) (-551.030) (-550.157) [-549.399] * (-550.845) (-552.178) [-553.419] (-552.355) -- 0:00:23
677000 -- (-550.906) [-550.789] (-548.231) (-551.539) * (-552.652) [-553.832] (-552.112) (-553.511) -- 0:00:23
677500 -- (-551.369) (-550.620) [-548.898] (-550.316) * (-553.221) (-550.705) [-551.346] (-552.328) -- 0:00:23
678000 -- (-554.977) [-548.983] (-550.528) (-551.324) * [-550.719] (-549.860) (-550.395) (-550.692) -- 0:00:23
678500 -- [-554.237] (-550.833) (-554.291) (-553.034) * (-550.736) (-551.314) [-552.479] (-548.689) -- 0:00:23
679000 -- (-552.862) (-551.073) (-549.464) [-549.653] * (-548.228) (-551.363) (-551.219) [-548.920] -- 0:00:23
679500 -- (-551.128) [-550.284] (-551.949) (-553.347) * [-550.285] (-550.345) (-548.304) (-554.194) -- 0:00:23
680000 -- (-551.905) (-550.245) (-550.010) [-549.344] * (-552.991) [-549.500] (-555.784) (-550.532) -- 0:00:23
Average standard deviation of split frequencies: 0.009533
680500 -- (-550.280) (-552.882) [-548.115] (-557.326) * (-553.633) [-549.334] (-552.608) (-550.285) -- 0:00:23
681000 -- (-555.335) [-550.126] (-550.521) (-553.001) * (-550.378) (-549.286) [-552.964] (-552.143) -- 0:00:23
681500 -- (-554.802) [-550.876] (-550.709) (-550.480) * (-550.367) (-552.427) (-547.343) [-550.618] -- 0:00:23
682000 -- (-552.986) (-550.503) (-547.996) [-551.354] * (-548.853) (-552.631) (-549.577) [-553.358] -- 0:00:23
682500 -- (-551.427) [-550.798] (-549.354) (-552.553) * (-550.369) [-551.716] (-547.374) (-551.675) -- 0:00:23
683000 -- (-552.472) [-548.728] (-548.129) (-551.708) * (-551.730) (-550.596) (-548.978) [-550.677] -- 0:00:23
683500 -- (-550.448) (-552.441) (-547.821) [-550.778] * [-552.034] (-550.329) (-549.377) (-549.988) -- 0:00:23
684000 -- (-551.501) (-552.025) [-552.839] (-553.755) * [-550.445] (-550.561) (-549.736) (-559.674) -- 0:00:23
684500 -- (-551.087) (-551.894) (-553.889) [-549.142] * (-551.921) [-550.670] (-552.405) (-551.354) -- 0:00:23
685000 -- (-553.679) (-549.736) (-552.475) [-550.530] * (-555.999) [-548.867] (-552.130) (-551.230) -- 0:00:22
Average standard deviation of split frequencies: 0.009903
685500 -- (-554.864) [-548.713] (-551.206) (-553.259) * (-556.329) (-553.713) (-550.670) [-549.769] -- 0:00:22
686000 -- (-551.135) (-550.451) (-551.050) [-552.081] * (-550.949) (-550.600) (-551.184) [-550.615] -- 0:00:22
686500 -- (-551.701) [-552.157] (-553.518) (-549.617) * [-549.573] (-551.772) (-554.556) (-552.939) -- 0:00:22
687000 -- (-552.278) (-551.618) [-552.558] (-550.871) * (-547.226) [-553.406] (-555.785) (-557.701) -- 0:00:22
687500 -- (-551.652) [-550.103] (-553.990) (-550.409) * (-549.075) (-550.483) (-550.100) [-550.732] -- 0:00:22
688000 -- (-553.439) (-550.918) (-552.952) [-553.678] * (-549.714) [-552.161] (-554.090) (-549.690) -- 0:00:22
688500 -- (-552.470) (-549.360) (-553.156) [-548.840] * (-554.519) (-550.571) (-551.967) [-549.842] -- 0:00:23
689000 -- (-550.569) (-550.821) [-551.928] (-552.082) * (-551.436) (-549.481) (-551.793) [-551.581] -- 0:00:23
689500 -- (-559.138) [-554.575] (-550.715) (-549.991) * (-551.533) (-551.536) (-551.394) [-552.760] -- 0:00:22
690000 -- (-554.093) (-552.202) (-553.060) [-550.482] * (-549.373) (-552.934) (-552.226) [-552.147] -- 0:00:22
Average standard deviation of split frequencies: 0.010318
690500 -- (-551.353) [-551.694] (-551.107) (-551.383) * [-550.261] (-551.552) (-551.497) (-548.661) -- 0:00:22
691000 -- (-550.809) (-549.993) (-552.080) [-551.767] * (-551.292) (-553.525) (-550.790) [-549.846] -- 0:00:22
691500 -- [-551.125] (-549.189) (-551.556) (-553.057) * (-549.658) (-550.983) [-550.844] (-552.008) -- 0:00:22
692000 -- [-550.578] (-549.050) (-551.265) (-550.523) * [-548.820] (-550.574) (-551.245) (-557.016) -- 0:00:22
692500 -- (-552.237) [-548.606] (-553.538) (-557.768) * (-549.038) [-551.578] (-551.510) (-553.769) -- 0:00:22
693000 -- (-550.615) (-551.208) [-552.882] (-550.601) * (-550.026) (-549.922) [-551.528] (-551.185) -- 0:00:22
693500 -- (-555.195) (-551.965) [-550.915] (-558.136) * (-553.582) (-551.966) [-552.884] (-549.371) -- 0:00:22
694000 -- [-551.874] (-552.730) (-550.918) (-553.207) * (-548.898) (-553.702) [-551.491] (-551.002) -- 0:00:22
694500 -- (-549.947) (-549.942) [-549.312] (-553.203) * [-552.230] (-552.524) (-549.202) (-553.504) -- 0:00:22
695000 -- [-551.071] (-553.413) (-550.889) (-551.785) * [-550.623] (-551.382) (-550.197) (-550.039) -- 0:00:22
Average standard deviation of split frequencies: 0.009642
695500 -- (-551.292) (-558.595) (-550.732) [-552.908] * (-556.504) [-553.284] (-552.312) (-549.798) -- 0:00:22
696000 -- (-552.614) (-553.532) [-552.252] (-555.546) * (-550.402) (-553.743) (-551.646) [-552.809] -- 0:00:22
696500 -- (-551.030) (-555.638) (-553.113) [-549.891] * (-551.014) (-549.789) [-552.164] (-553.074) -- 0:00:22
697000 -- [-551.816] (-553.376) (-552.150) (-549.638) * (-548.991) (-549.775) (-551.274) [-551.138] -- 0:00:22
697500 -- (-551.678) (-550.508) (-552.472) [-550.075] * [-556.283] (-549.561) (-553.640) (-549.221) -- 0:00:22
698000 -- [-550.004] (-553.749) (-554.267) (-556.099) * (-549.807) (-548.949) [-550.262] (-550.716) -- 0:00:22
698500 -- (-548.893) (-553.601) (-553.009) [-551.866] * [-553.701] (-548.443) (-553.329) (-549.491) -- 0:00:22
699000 -- (-550.837) [-550.644] (-552.818) (-551.976) * (-553.702) (-547.962) (-555.857) [-553.192] -- 0:00:21
699500 -- [-551.324] (-553.087) (-552.265) (-552.595) * (-554.596) [-554.171] (-552.121) (-553.132) -- 0:00:21
700000 -- (-551.998) (-548.341) (-552.788) [-550.786] * (-554.469) [-549.915] (-551.406) (-551.796) -- 0:00:21
Average standard deviation of split frequencies: 0.009657
700500 -- (-552.316) [-550.934] (-551.149) (-550.701) * [-551.220] (-551.193) (-555.942) (-551.757) -- 0:00:21
701000 -- [-551.673] (-551.870) (-553.288) (-553.049) * (-551.755) [-551.439] (-551.103) (-551.231) -- 0:00:21
701500 -- (-550.359) (-555.708) [-552.667] (-550.611) * (-554.704) [-553.850] (-549.238) (-549.575) -- 0:00:21
702000 -- (-552.588) (-555.818) (-553.497) [-551.673] * (-553.310) [-550.858] (-549.969) (-550.643) -- 0:00:22
702500 -- [-551.756] (-553.800) (-556.886) (-550.795) * (-552.192) (-551.198) (-550.366) [-550.375] -- 0:00:22
703000 -- (-551.162) (-552.431) [-550.877] (-551.269) * (-552.261) (-551.023) (-554.068) [-550.123] -- 0:00:21
703500 -- (-549.954) [-550.753] (-553.755) (-549.246) * (-550.817) (-552.675) [-554.674] (-550.915) -- 0:00:21
704000 -- (-551.439) (-555.662) (-558.016) [-552.686] * [-552.062] (-558.121) (-552.153) (-552.320) -- 0:00:21
704500 -- (-552.712) (-554.800) (-552.900) [-553.212] * (-552.543) (-555.394) (-553.436) [-558.832] -- 0:00:21
705000 -- [-550.307] (-552.356) (-554.346) (-551.436) * [-556.640] (-551.012) (-551.410) (-552.175) -- 0:00:21
Average standard deviation of split frequencies: 0.009859
705500 -- [-551.965] (-550.005) (-553.287) (-549.995) * (-553.491) (-549.714) (-548.021) [-550.644] -- 0:00:21
706000 -- (-554.553) [-551.486] (-553.525) (-554.822) * (-551.954) [-549.241] (-549.306) (-551.948) -- 0:00:21
706500 -- [-550.426] (-548.765) (-552.985) (-551.482) * (-554.195) (-552.110) [-549.442] (-552.827) -- 0:00:21
707000 -- (-549.610) (-549.575) [-552.225] (-549.082) * (-550.881) [-550.043] (-552.660) (-551.669) -- 0:00:21
707500 -- [-552.565] (-556.490) (-551.351) (-552.245) * [-551.635] (-550.772) (-553.132) (-553.092) -- 0:00:21
708000 -- (-551.603) (-551.240) (-550.633) [-550.720] * (-551.295) (-551.985) [-550.237] (-552.147) -- 0:00:21
708500 -- (-550.735) [-548.762] (-551.764) (-552.824) * [-551.326] (-548.740) (-552.353) (-552.508) -- 0:00:21
709000 -- [-549.937] (-552.870) (-552.632) (-550.162) * (-551.759) (-550.509) (-549.692) [-550.710] -- 0:00:21
709500 -- (-548.071) (-551.823) (-554.901) [-551.181] * (-555.583) (-552.224) [-549.934] (-553.728) -- 0:00:21
710000 -- (-550.635) (-551.530) [-553.425] (-550.275) * [-553.637] (-552.426) (-550.605) (-553.649) -- 0:00:21
Average standard deviation of split frequencies: 0.009404
710500 -- [-550.067] (-551.537) (-551.500) (-550.219) * [-549.689] (-561.688) (-552.609) (-555.062) -- 0:00:21
711000 -- [-553.184] (-551.916) (-556.600) (-551.269) * [-551.754] (-552.265) (-550.264) (-554.674) -- 0:00:21
711500 -- [-548.961] (-550.569) (-554.065) (-553.816) * (-550.744) (-550.242) [-549.304] (-554.202) -- 0:00:21
712000 -- (-551.650) (-558.262) (-557.568) [-549.874] * (-550.347) [-553.833] (-551.676) (-550.527) -- 0:00:21
712500 -- (-549.747) (-551.987) (-551.234) [-548.956] * (-551.993) [-551.170] (-551.632) (-552.096) -- 0:00:20
713000 -- (-549.738) (-553.210) (-551.896) [-547.826] * (-550.898) (-550.197) (-556.428) [-552.687] -- 0:00:20
713500 -- (-551.692) [-549.443] (-554.917) (-553.473) * (-551.112) (-553.957) (-551.194) [-552.343] -- 0:00:20
714000 -- (-554.365) [-554.018] (-551.438) (-553.440) * (-552.006) [-552.792] (-550.462) (-551.099) -- 0:00:20
714500 -- (-553.843) (-551.924) [-551.484] (-549.695) * [-551.658] (-555.683) (-552.466) (-551.101) -- 0:00:20
715000 -- (-552.728) [-551.125] (-552.720) (-551.440) * (-551.546) (-550.050) [-550.630] (-552.804) -- 0:00:20
Average standard deviation of split frequencies: 0.009295
715500 -- (-554.726) (-548.841) (-552.387) [-550.895] * (-554.372) (-554.278) [-551.109] (-551.514) -- 0:00:20
716000 -- (-554.701) (-552.528) [-553.481] (-551.019) * (-551.472) (-550.609) (-556.627) [-551.849] -- 0:00:21
716500 -- (-551.174) [-551.901] (-552.739) (-552.461) * (-552.443) [-551.246] (-552.496) (-555.485) -- 0:00:20
717000 -- (-554.239) (-552.849) [-551.112] (-549.435) * (-549.525) (-550.556) [-552.757] (-551.511) -- 0:00:20
717500 -- [-552.724] (-550.188) (-556.886) (-552.282) * (-552.370) (-552.268) (-550.651) [-554.742] -- 0:00:20
718000 -- (-550.967) [-551.976] (-549.954) (-549.967) * (-550.441) [-549.210] (-551.513) (-559.029) -- 0:00:20
718500 -- (-552.200) [-553.381] (-550.569) (-548.352) * [-553.334] (-553.302) (-551.282) (-550.879) -- 0:00:20
719000 -- [-554.652] (-550.734) (-551.372) (-550.555) * (-556.128) (-554.752) (-549.539) [-552.502] -- 0:00:20
719500 -- (-553.702) (-553.887) (-554.104) [-547.898] * (-552.010) (-552.679) [-553.366] (-551.444) -- 0:00:20
720000 -- (-554.924) [-555.549] (-554.617) (-550.996) * [-550.910] (-548.879) (-552.084) (-556.303) -- 0:00:20
Average standard deviation of split frequencies: 0.009004
720500 -- (-552.478) [-550.646] (-551.498) (-552.891) * (-554.447) (-550.697) (-556.878) [-554.086] -- 0:00:20
721000 -- (-553.442) (-551.805) [-550.555] (-551.245) * (-551.348) [-551.882] (-552.622) (-551.745) -- 0:00:20
721500 -- [-549.593] (-552.415) (-551.381) (-550.847) * (-553.909) (-550.756) (-553.486) [-551.003] -- 0:00:20
722000 -- (-549.737) [-553.996] (-551.428) (-551.100) * (-551.685) (-548.953) (-550.744) [-549.966] -- 0:00:20
722500 -- (-550.900) [-554.226] (-551.307) (-551.719) * (-553.287) (-549.419) [-550.536] (-556.763) -- 0:00:20
723000 -- (-556.011) (-553.417) [-552.890] (-549.863) * (-552.762) (-550.570) [-549.348] (-553.072) -- 0:00:20
723500 -- (-551.337) [-549.612] (-554.957) (-550.550) * (-549.824) (-555.370) (-550.567) [-551.539] -- 0:00:20
724000 -- (-555.115) (-550.584) [-550.253] (-550.805) * (-552.357) [-549.386] (-550.810) (-550.902) -- 0:00:20
724500 -- [-554.897] (-552.705) (-550.693) (-552.366) * (-554.547) [-549.760] (-550.789) (-551.100) -- 0:00:20
725000 -- (-550.911) (-551.063) [-551.067] (-553.020) * [-553.656] (-549.207) (-550.294) (-550.786) -- 0:00:20
Average standard deviation of split frequencies: 0.008594
725500 -- (-551.199) (-550.810) (-552.675) [-550.943] * (-555.122) [-551.656] (-551.309) (-550.962) -- 0:00:20
726000 -- [-550.737] (-555.152) (-553.720) (-551.847) * (-557.469) (-550.923) (-550.814) [-550.773] -- 0:00:20
726500 -- (-553.556) (-550.135) (-554.789) [-553.142] * (-555.710) (-552.641) [-550.903] (-551.048) -- 0:00:19
727000 -- (-552.682) [-549.669] (-553.811) (-553.051) * (-550.538) (-551.423) [-551.235] (-552.788) -- 0:00:19
727500 -- (-549.553) [-549.693] (-551.737) (-551.746) * (-550.861) (-553.184) [-550.676] (-550.854) -- 0:00:19
728000 -- (-554.274) [-552.758] (-548.584) (-549.704) * (-551.929) (-551.456) [-553.385] (-549.484) -- 0:00:19
728500 -- [-551.217] (-550.080) (-549.551) (-551.287) * (-553.955) (-551.049) (-550.376) [-550.062] -- 0:00:19
729000 -- (-550.776) (-553.422) [-550.050] (-552.863) * (-552.785) (-551.963) [-547.914] (-551.729) -- 0:00:19
729500 -- [-551.714] (-551.680) (-551.058) (-550.476) * (-550.578) (-550.549) [-550.451] (-555.678) -- 0:00:19
730000 -- (-551.385) [-552.784] (-551.990) (-551.363) * (-549.437) [-550.349] (-551.375) (-551.277) -- 0:00:19
Average standard deviation of split frequencies: 0.008805
730500 -- [-549.449] (-547.953) (-551.783) (-550.040) * (-552.899) [-548.860] (-552.260) (-552.839) -- 0:00:19
731000 -- (-550.136) [-550.616] (-550.884) (-552.089) * [-552.246] (-548.636) (-552.877) (-550.368) -- 0:00:19
731500 -- (-549.040) (-549.113) (-552.326) [-548.312] * (-551.485) (-549.954) (-551.870) [-552.478] -- 0:00:19
732000 -- (-549.804) (-553.217) (-552.451) [-549.030] * [-557.588] (-548.390) (-552.010) (-548.424) -- 0:00:19
732500 -- [-549.855] (-554.704) (-550.511) (-551.358) * (-549.359) (-550.885) (-551.335) [-548.371] -- 0:00:19
733000 -- [-551.969] (-552.139) (-550.783) (-550.973) * (-549.248) [-548.813] (-553.663) (-552.077) -- 0:00:19
733500 -- (-555.459) (-547.930) (-554.048) [-549.246] * [-552.501] (-552.195) (-548.638) (-550.352) -- 0:00:19
734000 -- (-552.109) [-551.889] (-551.553) (-550.087) * (-549.837) (-550.765) [-549.470] (-551.893) -- 0:00:19
734500 -- (-548.831) (-552.022) (-552.356) [-551.376] * [-550.701] (-553.752) (-550.478) (-552.228) -- 0:00:19
735000 -- (-551.795) (-552.606) [-554.660] (-548.193) * [-553.251] (-551.411) (-553.022) (-551.750) -- 0:00:19
Average standard deviation of split frequencies: 0.008816
735500 -- (-549.742) (-550.532) [-553.225] (-549.969) * (-554.948) (-552.151) [-552.264] (-552.659) -- 0:00:19
736000 -- (-549.505) (-551.107) (-555.361) [-549.507] * [-551.487] (-552.869) (-550.608) (-550.773) -- 0:00:19
736500 -- (-551.005) [-548.298] (-555.217) (-553.473) * (-551.633) [-551.186] (-550.666) (-549.140) -- 0:00:19
737000 -- (-554.109) (-551.748) (-553.384) [-550.570] * [-551.380] (-553.310) (-551.221) (-549.833) -- 0:00:19
737500 -- (-554.303) [-551.265] (-551.528) (-550.687) * (-550.322) (-552.250) (-550.143) [-550.207] -- 0:00:19
738000 -- (-551.661) (-550.607) (-552.677) [-554.349] * (-551.731) (-551.072) [-548.503] (-555.673) -- 0:00:19
738500 -- (-548.624) (-555.142) [-551.408] (-554.646) * [-549.853] (-549.690) (-552.586) (-552.899) -- 0:00:19
739000 -- [-550.490] (-553.204) (-550.266) (-553.566) * (-552.936) (-552.867) [-551.758] (-549.249) -- 0:00:19
739500 -- (-552.698) (-552.258) (-551.712) [-549.785] * (-553.066) [-554.114] (-554.662) (-549.478) -- 0:00:19
740000 -- [-549.484] (-550.941) (-549.765) (-549.697) * [-556.967] (-552.450) (-551.790) (-552.521) -- 0:00:18
Average standard deviation of split frequencies: 0.008648
740500 -- (-550.963) (-551.161) [-551.805] (-550.437) * (-556.309) (-551.605) (-550.286) [-550.306] -- 0:00:18
741000 -- (-551.969) (-550.071) [-551.642] (-550.373) * [-551.822] (-551.694) (-552.687) (-550.504) -- 0:00:18
741500 -- [-552.971] (-551.271) (-553.888) (-551.267) * (-552.683) (-553.973) [-549.787] (-552.116) -- 0:00:18
742000 -- (-551.954) [-551.428] (-551.482) (-549.944) * (-551.696) (-552.924) [-550.489] (-552.033) -- 0:00:18
742500 -- [-549.008] (-553.042) (-550.732) (-553.254) * [-552.756] (-549.743) (-548.520) (-552.110) -- 0:00:18
743000 -- (-551.328) (-561.760) [-549.523] (-550.579) * (-557.750) (-553.095) [-549.278] (-549.939) -- 0:00:18
743500 -- (-551.682) (-549.088) (-552.402) [-549.479] * (-554.454) (-550.602) (-552.159) [-549.749] -- 0:00:18
744000 -- (-550.175) (-550.321) [-550.028] (-550.641) * (-553.371) (-554.774) (-551.121) [-549.314] -- 0:00:18
744500 -- [-554.158] (-550.099) (-550.944) (-550.993) * (-554.237) (-553.017) (-550.301) [-549.935] -- 0:00:18
745000 -- (-549.112) [-549.770] (-550.575) (-551.486) * [-550.109] (-556.629) (-550.671) (-552.429) -- 0:00:18
Average standard deviation of split frequencies: 0.008103
745500 -- (-550.764) (-550.352) (-551.716) [-548.583] * (-550.004) (-552.787) (-552.087) [-551.784] -- 0:00:18
746000 -- (-550.575) (-552.731) (-550.751) [-548.775] * (-548.338) (-551.316) [-549.248] (-551.948) -- 0:00:18
746500 -- (-550.824) (-553.602) (-549.740) [-549.252] * (-551.838) (-549.402) [-548.943] (-550.192) -- 0:00:18
747000 -- (-553.370) (-552.722) [-550.049] (-549.411) * (-553.229) (-550.520) [-550.140] (-553.503) -- 0:00:18
747500 -- [-553.351] (-550.972) (-550.983) (-550.397) * (-550.706) [-550.147] (-549.449) (-549.639) -- 0:00:18
748000 -- (-549.377) (-552.905) (-552.347) [-553.561] * (-553.944) (-551.989) (-551.999) [-551.855] -- 0:00:18
748500 -- [-551.841] (-549.672) (-550.307) (-552.892) * [-551.185] (-551.858) (-548.870) (-552.561) -- 0:00:18
749000 -- (-554.517) (-550.921) (-556.996) [-550.586] * (-551.914) (-552.981) [-552.935] (-552.177) -- 0:00:18
749500 -- (-558.426) (-550.609) [-550.032] (-550.408) * (-548.779) (-549.743) (-552.771) [-553.686] -- 0:00:18
750000 -- (-551.166) (-551.807) [-554.076] (-552.918) * (-554.241) (-551.260) (-551.592) [-554.328] -- 0:00:18
Average standard deviation of split frequencies: 0.008085
750500 -- (-549.966) (-553.507) [-551.519] (-550.271) * (-551.053) [-553.942] (-552.884) (-552.744) -- 0:00:18
751000 -- (-554.753) (-552.719) (-552.496) [-550.308] * [-548.373] (-550.787) (-549.254) (-550.079) -- 0:00:18
751500 -- (-551.531) (-556.833) [-552.317] (-551.654) * [-551.924] (-550.507) (-550.411) (-550.605) -- 0:00:18
752000 -- (-551.015) (-551.666) (-553.533) [-549.095] * (-551.599) (-553.110) (-551.137) [-550.218] -- 0:00:18
752500 -- [-551.846] (-553.216) (-550.308) (-549.633) * (-551.228) (-554.836) [-551.374] (-552.502) -- 0:00:18
753000 -- (-556.528) (-552.098) [-549.041] (-550.871) * [-549.771] (-553.633) (-550.909) (-556.709) -- 0:00:18
753500 -- (-552.699) (-551.908) [-550.828] (-552.018) * (-553.444) [-552.597] (-549.677) (-557.875) -- 0:00:17
754000 -- (-551.889) [-553.164] (-550.786) (-550.527) * (-550.909) (-553.472) (-550.172) [-552.907] -- 0:00:17
754500 -- [-550.193] (-554.256) (-552.699) (-550.881) * (-551.072) [-551.668] (-550.403) (-550.892) -- 0:00:17
755000 -- [-552.223] (-552.783) (-550.991) (-551.758) * (-550.004) (-551.195) [-550.556] (-553.345) -- 0:00:17
Average standard deviation of split frequencies: 0.008379
755500 -- [-551.026] (-553.745) (-553.066) (-550.454) * (-553.941) [-550.502] (-551.147) (-550.351) -- 0:00:17
756000 -- (-549.976) (-553.854) (-549.993) [-552.825] * [-551.827] (-557.162) (-550.957) (-551.428) -- 0:00:17
756500 -- (-551.506) (-556.156) [-553.287] (-549.640) * [-555.089] (-551.443) (-552.273) (-553.388) -- 0:00:17
757000 -- (-552.808) (-554.580) (-552.885) [-551.173] * [-553.377] (-551.403) (-550.394) (-551.103) -- 0:00:17
757500 -- [-548.402] (-551.964) (-549.580) (-549.534) * (-549.717) (-550.961) (-552.100) [-550.244] -- 0:00:17
758000 -- (-551.016) [-548.649] (-550.529) (-551.838) * (-548.955) [-550.879] (-551.775) (-551.320) -- 0:00:17
758500 -- (-549.027) (-549.893) [-548.601] (-552.647) * (-549.618) (-551.395) (-549.059) [-551.828] -- 0:00:17
759000 -- [-549.642] (-551.645) (-554.133) (-551.597) * (-555.626) [-552.058] (-551.016) (-551.859) -- 0:00:17
759500 -- [-549.885] (-550.751) (-551.156) (-552.093) * (-552.377) (-554.235) (-553.176) [-552.428] -- 0:00:17
760000 -- (-550.958) (-549.849) (-552.970) [-548.660] * (-556.321) (-551.155) (-550.420) [-549.527] -- 0:00:17
Average standard deviation of split frequencies: 0.007824
760500 -- (-552.417) (-550.270) (-551.178) [-550.261] * [-552.492] (-551.435) (-546.850) (-551.035) -- 0:00:17
761000 -- (-551.041) [-555.624] (-550.877) (-551.671) * (-550.965) [-549.828] (-549.605) (-551.057) -- 0:00:17
761500 -- (-550.017) (-551.095) [-548.399] (-551.073) * (-553.102) [-551.406] (-550.782) (-551.322) -- 0:00:17
762000 -- (-556.675) (-551.398) [-550.678] (-553.184) * [-551.228] (-551.596) (-557.235) (-552.996) -- 0:00:17
762500 -- (-551.172) [-549.519] (-551.352) (-555.618) * (-554.749) [-551.077] (-552.861) (-553.573) -- 0:00:17
763000 -- (-550.711) (-551.610) [-551.529] (-559.757) * [-551.337] (-551.935) (-551.340) (-551.792) -- 0:00:17
763500 -- (-549.526) (-550.924) [-553.338] (-553.770) * (-551.515) (-555.126) (-551.070) [-552.794] -- 0:00:17
764000 -- (-550.557) (-552.215) [-551.015] (-549.669) * [-551.849] (-549.845) (-550.894) (-555.841) -- 0:00:17
764500 -- (-551.229) (-551.322) (-553.320) [-550.762] * (-548.726) (-551.878) (-556.696) [-550.922] -- 0:00:17
765000 -- (-552.094) (-552.657) [-549.515] (-550.720) * (-549.551) (-551.725) (-554.925) [-550.772] -- 0:00:17
Average standard deviation of split frequencies: 0.007693
765500 -- [-549.502] (-551.789) (-551.751) (-550.517) * (-552.260) [-550.165] (-554.871) (-550.535) -- 0:00:17
766000 -- (-550.671) (-550.495) (-549.401) [-548.120] * (-551.171) (-549.826) [-552.665] (-550.844) -- 0:00:17
766500 -- (-552.301) [-552.974] (-551.416) (-552.173) * (-556.210) (-554.269) [-551.326] (-551.215) -- 0:00:17
767000 -- (-551.444) [-550.151] (-552.747) (-552.162) * (-556.928) (-550.224) [-549.036] (-550.337) -- 0:00:17
767500 -- (-548.748) [-549.329] (-551.467) (-554.290) * (-552.532) [-548.877] (-552.815) (-551.448) -- 0:00:16
768000 -- [-550.080] (-549.703) (-551.166) (-556.819) * (-551.768) (-550.638) (-552.079) [-556.146] -- 0:00:16
768500 -- (-550.994) [-550.095] (-550.537) (-551.990) * [-550.337] (-550.204) (-549.587) (-556.576) -- 0:00:16
769000 -- (-554.294) [-552.413] (-552.282) (-551.878) * (-550.336) [-551.111] (-549.919) (-557.766) -- 0:00:16
769500 -- (-550.554) (-548.107) [-551.010] (-557.996) * (-551.352) [-550.375] (-552.671) (-550.281) -- 0:00:16
770000 -- [-547.728] (-549.364) (-551.585) (-554.022) * (-554.015) (-550.615) [-550.171] (-549.488) -- 0:00:16
Average standard deviation of split frequencies: 0.007723
770500 -- (-552.946) [-548.696] (-551.902) (-549.526) * (-550.411) (-550.502) (-550.234) [-549.142] -- 0:00:16
771000 -- (-552.160) (-551.982) [-549.379] (-553.657) * (-550.747) [-551.852] (-551.089) (-552.561) -- 0:00:16
771500 -- (-553.063) [-551.918] (-550.810) (-550.121) * (-551.551) (-552.135) (-550.893) [-550.723] -- 0:00:16
772000 -- (-550.738) (-553.343) (-551.027) [-549.691] * (-551.154) [-550.286] (-550.532) (-551.026) -- 0:00:16
772500 -- [-549.772] (-555.778) (-555.322) (-553.249) * (-552.446) (-555.320) [-550.637] (-550.583) -- 0:00:16
773000 -- (-552.741) (-551.240) (-549.638) [-551.103] * (-552.942) (-552.321) (-549.209) [-550.588] -- 0:00:16
773500 -- (-550.962) (-552.491) [-550.738] (-554.946) * [-552.327] (-549.917) (-550.227) (-551.757) -- 0:00:16
774000 -- (-552.684) (-553.178) (-551.335) [-553.467] * (-551.495) [-550.090] (-551.136) (-552.203) -- 0:00:16
774500 -- [-552.627] (-552.767) (-551.711) (-551.648) * (-552.529) [-552.256] (-554.785) (-550.646) -- 0:00:16
775000 -- (-549.711) (-550.198) [-551.764] (-554.398) * (-551.659) (-550.445) (-553.656) [-549.354] -- 0:00:16
Average standard deviation of split frequencies: 0.008087
775500 -- (-551.787) (-550.771) [-551.587] (-550.710) * (-557.046) (-548.677) [-551.759] (-550.795) -- 0:00:16
776000 -- (-550.001) (-550.068) [-552.638] (-550.051) * [-550.155] (-549.894) (-549.915) (-551.286) -- 0:00:16
776500 -- (-549.389) [-552.303] (-557.190) (-551.633) * [-552.608] (-550.534) (-552.927) (-551.213) -- 0:00:16
777000 -- (-550.676) [-548.733] (-553.680) (-551.081) * (-549.089) (-550.168) [-553.677] (-553.253) -- 0:00:16
777500 -- [-551.551] (-550.816) (-554.188) (-549.619) * [-551.853] (-549.531) (-554.372) (-552.425) -- 0:00:16
778000 -- (-551.024) (-549.537) (-553.638) [-553.790] * (-549.971) (-553.147) [-553.159] (-551.190) -- 0:00:16
778500 -- (-552.523) (-557.879) (-556.613) [-549.158] * (-550.165) [-548.580] (-553.207) (-550.337) -- 0:00:16
779000 -- (-551.803) (-561.844) (-550.209) [-550.797] * [-554.278] (-550.412) (-550.965) (-551.976) -- 0:00:16
779500 -- (-551.086) (-557.620) [-552.822] (-551.738) * (-557.152) (-550.717) [-550.768] (-549.446) -- 0:00:16
780000 -- (-552.016) (-556.769) [-552.755] (-550.591) * (-554.352) (-551.939) (-552.775) [-552.906] -- 0:00:16
Average standard deviation of split frequencies: 0.007957
780500 -- [-551.976] (-553.040) (-550.960) (-551.564) * (-554.028) (-551.921) [-550.761] (-551.631) -- 0:00:16
781000 -- (-550.352) (-553.671) (-551.883) [-551.702] * (-551.858) (-550.981) (-550.774) [-555.452] -- 0:00:15
781500 -- (-552.141) (-549.143) (-551.733) [-554.625] * (-551.420) (-554.526) (-551.809) [-553.663] -- 0:00:15
782000 -- (-556.259) (-550.058) (-552.820) [-551.281] * (-551.100) (-553.107) [-552.146] (-550.605) -- 0:00:15
782500 -- [-553.043] (-551.620) (-556.503) (-552.059) * [-549.947] (-549.658) (-550.147) (-556.300) -- 0:00:15
783000 -- (-551.663) (-549.260) (-551.314) [-552.967] * [-549.760] (-548.536) (-553.205) (-552.838) -- 0:00:15
783500 -- (-552.636) (-551.277) (-549.932) [-553.167] * (-551.423) [-555.496] (-552.199) (-552.437) -- 0:00:15
784000 -- (-553.760) [-549.129] (-550.588) (-552.733) * (-551.222) [-550.879] (-551.939) (-549.870) -- 0:00:15
784500 -- (-554.025) [-551.796] (-551.341) (-553.132) * [-550.237] (-555.604) (-550.835) (-551.760) -- 0:00:15
785000 -- (-552.802) (-551.938) [-550.342] (-552.111) * [-549.748] (-549.383) (-553.911) (-552.528) -- 0:00:15
Average standard deviation of split frequencies: 0.008079
785500 -- (-552.414) (-553.807) (-550.946) [-550.658] * (-549.599) [-548.646] (-553.603) (-551.982) -- 0:00:15
786000 -- (-553.309) (-552.985) (-549.672) [-550.694] * (-555.846) [-549.847] (-551.630) (-556.202) -- 0:00:15
786500 -- [-549.256] (-553.206) (-549.933) (-549.949) * [-551.328] (-550.155) (-551.008) (-551.158) -- 0:00:15
787000 -- (-552.481) (-552.083) [-550.098] (-550.127) * (-553.620) (-550.451) [-549.839] (-549.246) -- 0:00:15
787500 -- [-549.476] (-551.226) (-548.605) (-550.765) * [-549.148] (-557.319) (-552.344) (-551.652) -- 0:00:15
788000 -- (-549.935) (-551.574) [-549.846] (-551.630) * (-555.036) (-557.718) [-550.967] (-551.863) -- 0:00:15
788500 -- [-549.917] (-555.782) (-550.888) (-553.040) * (-551.707) (-552.520) [-549.580] (-550.294) -- 0:00:15
789000 -- (-550.669) (-552.427) [-549.152] (-553.141) * (-553.371) (-551.858) [-550.040] (-552.524) -- 0:00:15
789500 -- (-549.967) (-551.822) (-554.287) [-552.701] * (-550.188) (-549.733) [-550.073] (-550.789) -- 0:00:15
790000 -- [-549.707] (-549.683) (-548.914) (-555.838) * [-550.412] (-552.185) (-552.632) (-550.912) -- 0:00:15
Average standard deviation of split frequencies: 0.008698
790500 -- (-552.733) (-551.858) [-549.182] (-551.310) * (-551.788) (-554.088) (-551.273) [-550.423] -- 0:00:15
791000 -- [-554.080] (-552.939) (-549.774) (-550.714) * (-549.403) (-554.844) [-550.083] (-551.732) -- 0:00:15
791500 -- (-554.169) (-550.793) (-550.652) [-548.698] * [-550.905] (-551.934) (-550.890) (-550.853) -- 0:00:15
792000 -- (-553.905) [-550.555] (-549.560) (-547.775) * [-550.961] (-553.574) (-550.650) (-550.860) -- 0:00:15
792500 -- (-550.428) (-551.481) (-552.826) [-550.370] * (-549.559) (-553.620) (-550.578) [-551.675] -- 0:00:15
793000 -- [-555.088] (-550.485) (-552.747) (-552.348) * (-551.384) (-552.924) (-551.794) [-552.569] -- 0:00:15
793500 -- [-550.462] (-553.326) (-550.199) (-549.576) * (-549.929) [-551.445] (-552.544) (-554.583) -- 0:00:15
794000 -- [-554.481] (-552.421) (-549.671) (-549.272) * (-551.015) [-553.644] (-552.063) (-550.690) -- 0:00:15
794500 -- [-552.839] (-552.754) (-549.687) (-550.471) * (-552.925) (-552.555) (-551.674) [-550.758] -- 0:00:15
795000 -- (-554.019) (-555.615) [-555.851] (-551.613) * (-553.423) (-551.514) [-549.099] (-553.363) -- 0:00:14
Average standard deviation of split frequencies: 0.008605
795500 -- (-554.022) (-555.515) [-550.212] (-550.738) * [-550.945] (-555.542) (-553.187) (-554.929) -- 0:00:14
796000 -- (-553.014) (-550.579) (-549.672) [-551.793] * (-550.808) (-550.888) (-550.374) [-554.030] -- 0:00:14
796500 -- (-554.258) (-553.062) (-552.038) [-550.022] * (-553.091) (-553.204) [-551.972] (-553.728) -- 0:00:14
797000 -- [-551.199] (-552.342) (-551.690) (-550.507) * (-550.521) [-549.905] (-553.479) (-551.273) -- 0:00:14
797500 -- [-551.958] (-550.215) (-551.567) (-552.155) * [-550.898] (-550.184) (-553.418) (-553.677) -- 0:00:14
798000 -- (-550.914) [-550.506] (-551.661) (-553.575) * [-551.527] (-550.247) (-555.538) (-552.515) -- 0:00:14
798500 -- [-551.533] (-550.008) (-550.672) (-551.742) * [-548.655] (-551.709) (-556.959) (-551.134) -- 0:00:14
799000 -- (-550.787) (-552.475) [-549.309] (-550.391) * (-550.353) (-552.692) [-553.231] (-551.110) -- 0:00:14
799500 -- [-553.453] (-549.918) (-554.164) (-552.225) * (-550.297) (-554.083) [-550.095] (-553.027) -- 0:00:14
800000 -- (-549.212) (-556.258) [-552.414] (-550.158) * (-549.488) (-550.652) [-548.629] (-550.734) -- 0:00:14
Average standard deviation of split frequencies: 0.008208
800500 -- (-550.765) (-548.847) [-549.768] (-555.392) * [-550.114] (-553.035) (-553.523) (-551.250) -- 0:00:14
801000 -- (-551.215) [-550.125] (-550.522) (-552.512) * (-551.498) (-553.688) [-552.234] (-552.427) -- 0:00:14
801500 -- (-552.926) (-554.725) [-551.206] (-550.097) * (-550.765) (-552.649) [-550.030] (-553.980) -- 0:00:14
802000 -- (-554.591) (-556.810) [-548.855] (-551.070) * (-552.595) (-551.230) [-550.672] (-553.598) -- 0:00:14
802500 -- [-552.620] (-555.730) (-551.418) (-549.845) * [-551.783] (-552.838) (-551.504) (-549.869) -- 0:00:14
803000 -- (-553.851) (-554.729) [-552.621] (-552.505) * (-551.730) (-551.342) (-557.207) [-553.490] -- 0:00:14
803500 -- (-551.090) (-551.079) (-553.654) [-553.314] * [-548.832] (-551.636) (-553.352) (-552.990) -- 0:00:14
804000 -- (-551.295) [-550.219] (-555.306) (-550.473) * (-552.960) (-553.177) (-550.435) [-554.688] -- 0:00:14
804500 -- (-551.223) [-549.897] (-551.579) (-554.160) * (-551.490) (-551.472) [-549.711] (-553.143) -- 0:00:14
805000 -- (-551.345) (-551.703) [-549.434] (-552.227) * (-552.701) [-551.079] (-551.600) (-550.371) -- 0:00:14
Average standard deviation of split frequencies: 0.007947
805500 -- (-552.833) (-551.555) [-549.892] (-554.559) * [-550.568] (-553.499) (-552.990) (-550.104) -- 0:00:14
806000 -- [-552.591] (-551.104) (-551.726) (-553.392) * (-554.899) (-552.842) [-553.479] (-550.496) -- 0:00:14
806500 -- (-551.120) (-550.504) [-550.605] (-551.896) * (-549.486) (-550.707) (-548.606) [-550.893] -- 0:00:14
807000 -- (-548.804) (-551.964) (-550.774) [-551.853] * (-555.197) (-551.095) [-555.066] (-549.581) -- 0:00:14
807500 -- (-551.453) (-550.960) [-550.643] (-553.080) * [-551.205] (-557.014) (-551.755) (-551.282) -- 0:00:14
808000 -- [-551.909] (-551.038) (-550.457) (-553.233) * (-551.929) (-553.738) [-549.834] (-551.319) -- 0:00:14
808500 -- (-549.608) [-549.013] (-548.978) (-551.803) * (-554.156) [-554.259] (-551.853) (-553.189) -- 0:00:13
809000 -- [-550.831] (-548.814) (-549.737) (-551.561) * (-551.564) (-551.608) (-551.978) [-551.283] -- 0:00:13
809500 -- (-552.195) [-550.534] (-549.543) (-556.443) * (-548.242) (-554.122) (-552.188) [-551.458] -- 0:00:13
810000 -- (-556.020) (-551.446) [-553.444] (-550.051) * (-553.637) (-551.685) (-550.683) [-551.620] -- 0:00:13
Average standard deviation of split frequencies: 0.007696
810500 -- (-551.113) (-550.322) [-548.122] (-553.017) * (-553.821) (-549.936) (-548.786) [-551.053] -- 0:00:13
811000 -- (-553.445) [-554.812] (-549.811) (-551.151) * [-551.940] (-552.310) (-551.934) (-551.699) -- 0:00:13
811500 -- (-553.450) [-548.346] (-553.911) (-559.909) * [-550.813] (-555.223) (-552.079) (-549.069) -- 0:00:13
812000 -- [-549.675] (-552.458) (-550.424) (-551.901) * (-553.393) [-550.549] (-551.014) (-548.362) -- 0:00:13
812500 -- (-553.961) [-552.000] (-549.724) (-554.899) * (-551.863) (-550.249) (-553.733) [-550.222] -- 0:00:13
813000 -- [-551.136] (-553.698) (-555.844) (-552.055) * [-549.327] (-550.091) (-550.990) (-552.328) -- 0:00:13
813500 -- (-549.873) (-552.780) [-554.432] (-551.618) * (-550.163) [-555.329] (-550.259) (-550.051) -- 0:00:13
814000 -- (-553.609) [-548.212] (-552.775) (-551.248) * (-553.852) (-553.848) [-552.254] (-550.933) -- 0:00:13
814500 -- (-552.725) [-548.679] (-553.118) (-551.943) * (-555.182) [-551.872] (-553.435) (-551.795) -- 0:00:13
815000 -- [-550.609] (-551.795) (-554.901) (-550.442) * (-550.917) [-554.897] (-549.725) (-553.518) -- 0:00:13
Average standard deviation of split frequencies: 0.008122
815500 -- (-551.357) (-552.434) [-550.840] (-550.769) * (-550.482) [-549.269] (-551.113) (-552.594) -- 0:00:13
816000 -- (-551.609) [-553.398] (-550.876) (-551.378) * [-549.459] (-555.462) (-548.903) (-550.866) -- 0:00:13
816500 -- (-549.453) (-554.010) [-549.590] (-553.505) * (-551.821) (-552.743) (-553.359) [-550.323] -- 0:00:13
817000 -- (-553.234) (-551.393) (-550.524) [-550.596] * (-552.567) (-550.515) [-550.584] (-550.237) -- 0:00:13
817500 -- (-551.196) (-551.438) [-552.588] (-552.412) * (-551.150) (-552.368) [-550.293] (-552.008) -- 0:00:13
818000 -- (-552.860) [-550.068] (-554.671) (-550.353) * (-552.913) (-553.563) (-549.702) [-550.763] -- 0:00:13
818500 -- (-552.753) (-557.789) [-550.807] (-550.007) * (-551.263) [-550.627] (-550.520) (-553.689) -- 0:00:13
819000 -- (-548.789) (-553.706) [-550.167] (-552.260) * [-549.605] (-551.475) (-551.184) (-550.771) -- 0:00:13
819500 -- (-553.743) [-553.269] (-551.191) (-553.280) * (-551.908) [-549.793] (-553.447) (-554.020) -- 0:00:13
820000 -- (-554.659) [-550.247] (-550.688) (-548.939) * [-553.087] (-550.793) (-549.891) (-553.262) -- 0:00:13
Average standard deviation of split frequencies: 0.007940
820500 -- (-550.330) (-551.422) (-552.133) [-552.057] * (-548.834) [-550.438] (-553.211) (-553.072) -- 0:00:13
821000 -- (-550.127) (-554.979) [-551.235] (-551.844) * [-548.830] (-552.334) (-549.307) (-551.141) -- 0:00:13
821500 -- (-550.718) [-550.716] (-550.310) (-554.167) * (-551.545) (-550.507) [-551.615] (-551.915) -- 0:00:13
822000 -- [-550.241] (-553.367) (-551.969) (-549.652) * (-548.408) (-553.669) [-550.651] (-553.330) -- 0:00:12
822500 -- (-550.823) [-549.954] (-553.832) (-551.636) * [-551.284] (-551.067) (-552.128) (-550.748) -- 0:00:12
823000 -- (-549.277) (-550.927) [-549.420] (-550.267) * (-549.916) (-555.636) (-549.853) [-552.115] -- 0:00:12
823500 -- (-551.400) (-550.771) (-549.287) [-551.651] * (-550.406) [-550.577] (-553.964) (-552.113) -- 0:00:12
824000 -- (-551.912) (-556.172) [-549.476] (-551.975) * (-548.331) [-552.293] (-555.358) (-553.204) -- 0:00:12
824500 -- (-553.638) (-555.348) (-550.368) [-552.963] * (-552.499) (-550.648) (-553.379) [-552.436] -- 0:00:12
825000 -- (-551.125) (-552.624) (-549.642) [-552.559] * (-548.087) (-551.538) (-552.623) [-552.333] -- 0:00:12
Average standard deviation of split frequencies: 0.007889
825500 -- (-551.832) (-553.345) (-551.314) [-551.945] * [-551.621] (-551.929) (-554.199) (-551.555) -- 0:00:12
826000 -- (-553.548) (-552.064) [-549.435] (-549.458) * [-549.551] (-549.499) (-553.071) (-551.515) -- 0:00:12
826500 -- [-549.475] (-549.823) (-550.415) (-552.238) * (-550.694) (-548.928) (-551.619) [-549.546] -- 0:00:12
827000 -- [-549.946] (-550.648) (-552.074) (-552.092) * (-551.276) (-549.811) (-554.073) [-550.675] -- 0:00:12
827500 -- (-551.685) (-551.150) (-552.052) [-552.089] * [-555.826] (-551.495) (-550.290) (-551.304) -- 0:00:12
828000 -- [-551.194] (-551.171) (-550.741) (-551.678) * (-554.792) (-551.224) [-552.233] (-549.790) -- 0:00:12
828500 -- [-552.529] (-550.421) (-550.927) (-552.986) * (-549.049) (-551.956) [-549.532] (-549.438) -- 0:00:12
829000 -- (-551.490) (-552.294) [-549.926] (-555.488) * (-551.251) [-550.419] (-549.479) (-549.927) -- 0:00:12
829500 -- [-552.806] (-550.872) (-551.028) (-553.557) * (-554.573) (-553.845) (-549.039) [-550.383] -- 0:00:12
830000 -- [-548.783] (-549.048) (-551.970) (-549.629) * (-550.069) [-552.451] (-550.321) (-552.690) -- 0:00:12
Average standard deviation of split frequencies: 0.007978
830500 -- [-549.908] (-552.008) (-551.969) (-548.887) * (-548.986) (-550.516) [-549.452] (-553.649) -- 0:00:12
831000 -- (-551.723) (-551.363) (-548.375) [-548.227] * (-551.272) (-549.431) (-552.725) [-549.959] -- 0:00:12
831500 -- (-550.305) (-551.953) [-552.100] (-550.980) * (-550.681) (-550.702) [-550.397] (-548.900) -- 0:00:12
832000 -- (-550.088) (-551.069) [-553.115] (-550.336) * (-553.095) (-551.319) (-553.817) [-550.517] -- 0:00:12
832500 -- (-551.715) [-550.247] (-552.808) (-551.636) * (-551.340) [-552.405] (-551.969) (-553.472) -- 0:00:12
833000 -- (-551.827) (-551.401) (-551.791) [-553.389] * (-550.263) [-552.133] (-553.113) (-550.461) -- 0:00:12
833500 -- (-550.934) [-551.034] (-552.644) (-551.217) * [-548.888] (-550.758) (-553.406) (-553.111) -- 0:00:12
834000 -- [-551.412] (-551.078) (-553.427) (-550.716) * (-550.632) [-549.446] (-554.144) (-558.697) -- 0:00:12
834500 -- [-555.273] (-550.354) (-551.179) (-550.843) * (-550.621) (-551.187) (-553.627) [-550.830] -- 0:00:12
835000 -- (-548.707) [-554.477] (-554.244) (-551.892) * (-549.616) (-551.267) [-552.606] (-552.980) -- 0:00:12
Average standard deviation of split frequencies: 0.007894
835500 -- (-551.812) (-558.030) (-555.413) [-551.390] * (-550.290) [-557.481] (-552.928) (-548.510) -- 0:00:12
836000 -- (-553.222) [-550.313] (-553.045) (-549.122) * (-552.169) [-550.537] (-550.512) (-551.378) -- 0:00:11
836500 -- [-551.698] (-550.505) (-551.895) (-548.719) * (-551.669) (-549.743) (-551.196) [-550.970] -- 0:00:11
837000 -- (-551.567) (-552.862) (-549.682) [-551.856] * (-551.840) [-555.286] (-552.434) (-549.816) -- 0:00:11
837500 -- [-551.668] (-549.697) (-554.457) (-550.922) * (-553.238) [-550.739] (-550.028) (-550.425) -- 0:00:11
838000 -- [-549.058] (-552.942) (-549.496) (-551.126) * (-550.998) (-550.726) (-550.495) [-548.906] -- 0:00:11
838500 -- (-551.173) (-552.144) [-550.017] (-552.966) * [-554.099] (-552.700) (-550.136) (-549.623) -- 0:00:11
839000 -- (-551.988) (-551.672) (-553.767) [-554.013] * (-550.937) (-552.078) (-551.934) [-552.952] -- 0:00:11
839500 -- (-553.948) [-550.955] (-550.487) (-550.296) * (-550.607) (-549.756) [-550.605] (-554.581) -- 0:00:11
840000 -- (-549.864) (-551.416) (-551.389) [-549.895] * (-551.771) [-549.479] (-549.231) (-558.198) -- 0:00:11
Average standard deviation of split frequencies: 0.007851
840500 -- (-558.750) [-550.025] (-553.698) (-551.613) * [-549.231] (-552.198) (-550.313) (-552.032) -- 0:00:11
841000 -- (-556.676) [-549.989] (-552.437) (-551.519) * (-550.592) [-549.295] (-549.935) (-551.057) -- 0:00:11
841500 -- (-551.681) (-549.901) (-554.839) [-552.145] * (-552.335) (-551.791) [-548.278] (-550.878) -- 0:00:11
842000 -- (-549.066) [-549.473] (-551.248) (-550.775) * [-551.675] (-550.236) (-547.987) (-551.422) -- 0:00:11
842500 -- [-551.111] (-549.948) (-549.796) (-556.780) * (-551.326) (-553.632) (-552.753) [-552.268] -- 0:00:11
843000 -- (-551.102) [-549.789] (-550.640) (-553.103) * (-548.948) (-555.128) [-551.373] (-554.242) -- 0:00:11
843500 -- (-555.698) (-554.307) (-551.434) [-551.270] * [-550.810] (-550.185) (-551.595) (-552.024) -- 0:00:11
844000 -- (-555.657) (-551.493) (-550.737) [-551.154] * (-550.633) (-552.113) [-550.855] (-552.537) -- 0:00:11
844500 -- (-552.175) [-552.534] (-550.000) (-552.281) * [-550.778] (-550.792) (-551.986) (-551.049) -- 0:00:11
845000 -- [-551.105] (-551.913) (-552.689) (-554.056) * [-549.614] (-548.625) (-550.481) (-551.064) -- 0:00:11
Average standard deviation of split frequencies: 0.007998
845500 -- (-552.261) [-553.177] (-554.765) (-554.689) * [-550.272] (-552.755) (-551.977) (-551.468) -- 0:00:11
846000 -- (-556.685) (-551.789) [-547.689] (-552.537) * [-550.756] (-552.445) (-552.025) (-552.351) -- 0:00:11
846500 -- (-556.017) [-551.943] (-549.437) (-550.695) * (-553.861) (-551.573) [-550.594] (-553.058) -- 0:00:11
847000 -- (-551.899) [-553.000] (-547.932) (-552.379) * (-551.704) (-552.589) (-553.801) [-549.704] -- 0:00:11
847500 -- [-552.426] (-551.213) (-551.958) (-551.710) * (-551.522) (-551.445) (-550.530) [-551.008] -- 0:00:11
848000 -- [-551.738] (-554.371) (-550.660) (-553.239) * (-554.810) (-552.768) [-549.517] (-556.714) -- 0:00:11
848500 -- (-556.702) (-548.361) [-551.137] (-552.046) * (-551.799) [-553.620] (-550.239) (-550.702) -- 0:00:11
849000 -- (-553.023) [-551.641] (-551.540) (-551.982) * (-548.161) (-549.589) [-549.123] (-551.818) -- 0:00:11
849500 -- (-552.239) (-554.189) (-548.999) [-551.214] * [-552.507] (-553.114) (-550.799) (-553.761) -- 0:00:10
850000 -- (-551.134) [-553.022] (-551.951) (-550.628) * (-550.876) (-550.840) [-551.752] (-551.855) -- 0:00:10
Average standard deviation of split frequencies: 0.007823
850500 -- [-548.443] (-553.507) (-550.343) (-548.725) * [-550.462] (-550.023) (-558.095) (-552.593) -- 0:00:10
851000 -- (-550.636) (-550.684) [-548.980] (-555.523) * (-551.166) (-556.748) [-548.568] (-553.863) -- 0:00:10
851500 -- [-550.459] (-552.699) (-549.844) (-554.622) * [-549.745] (-555.630) (-554.059) (-549.796) -- 0:00:10
852000 -- (-550.000) (-554.722) [-553.041] (-552.587) * [-551.048] (-551.980) (-548.986) (-551.503) -- 0:00:10
852500 -- [-553.540] (-551.812) (-552.211) (-550.632) * (-550.434) [-551.220] (-558.890) (-553.617) -- 0:00:10
853000 -- (-553.517) [-552.931] (-551.512) (-550.015) * (-550.062) (-552.982) [-551.397] (-553.313) -- 0:00:10
853500 -- (-554.128) [-552.468] (-550.980) (-550.618) * (-550.815) (-555.331) [-551.198] (-551.916) -- 0:00:10
854000 -- (-552.681) (-551.338) [-550.688] (-550.801) * (-550.231) (-552.139) (-551.723) [-551.805] -- 0:00:10
854500 -- [-553.010] (-551.699) (-551.016) (-550.847) * [-550.437] (-550.904) (-551.250) (-551.574) -- 0:00:10
855000 -- [-550.268] (-552.762) (-549.505) (-553.612) * [-552.891] (-555.483) (-549.072) (-551.371) -- 0:00:10
Average standard deviation of split frequencies: 0.007742
855500 -- (-550.788) (-554.727) [-549.600] (-551.262) * (-550.425) (-551.713) [-551.202] (-552.031) -- 0:00:10
856000 -- (-550.197) (-550.280) [-548.624] (-549.037) * [-551.774] (-550.458) (-552.457) (-554.180) -- 0:00:10
856500 -- (-554.759) (-550.779) (-549.852) [-552.325] * (-553.412) (-550.619) [-551.325] (-551.821) -- 0:00:10
857000 -- [-549.412] (-551.246) (-550.649) (-552.239) * (-551.241) (-553.247) [-551.059] (-550.574) -- 0:00:10
857500 -- (-550.538) [-550.040] (-550.115) (-555.116) * [-552.080] (-550.288) (-550.324) (-551.602) -- 0:00:10
858000 -- (-551.321) [-550.821] (-549.388) (-551.979) * (-550.735) (-550.979) [-550.123] (-549.834) -- 0:00:10
858500 -- (-553.023) (-549.622) (-553.242) [-547.718] * (-550.792) [-552.070] (-553.271) (-554.327) -- 0:00:10
859000 -- (-557.893) (-553.294) (-553.056) [-550.185] * [-550.445] (-550.981) (-551.033) (-551.679) -- 0:00:10
859500 -- (-549.586) (-551.768) (-553.009) [-549.849] * (-550.684) (-553.046) [-553.659] (-552.819) -- 0:00:10
860000 -- (-551.088) (-550.827) (-561.302) [-549.646] * (-551.936) (-550.816) [-550.513] (-554.714) -- 0:00:10
Average standard deviation of split frequencies: 0.007088
860500 -- (-549.719) (-551.862) (-551.665) [-550.054] * (-554.112) [-552.386] (-553.755) (-549.369) -- 0:00:10
861000 -- (-553.359) (-551.795) (-549.735) [-549.187] * [-552.166] (-552.730) (-553.197) (-551.455) -- 0:00:10
861500 -- (-551.617) [-548.656] (-550.903) (-552.159) * [-552.474] (-553.144) (-552.894) (-551.537) -- 0:00:10
862000 -- [-551.387] (-549.052) (-552.653) (-551.298) * (-555.458) [-552.029] (-550.957) (-551.333) -- 0:00:10
862500 -- (-552.376) (-554.078) (-551.400) [-551.889] * (-554.169) [-549.000] (-549.155) (-551.805) -- 0:00:10
863000 -- (-551.488) [-553.961] (-551.195) (-551.412) * [-552.370] (-553.772) (-549.252) (-550.225) -- 0:00:10
863500 -- [-551.338] (-550.319) (-552.950) (-552.034) * (-549.434) [-551.998] (-549.024) (-552.857) -- 0:00:09
864000 -- (-550.563) (-553.966) [-552.100] (-551.610) * (-551.722) (-549.767) [-549.651] (-550.557) -- 0:00:09
864500 -- (-551.276) (-549.465) (-549.719) [-549.628] * (-555.740) [-552.052] (-550.754) (-551.257) -- 0:00:09
865000 -- (-554.139) (-550.880) (-552.072) [-550.941] * (-549.864) (-550.200) (-551.464) [-548.695] -- 0:00:09
Average standard deviation of split frequencies: 0.006724
865500 -- (-549.758) [-549.619] (-552.874) (-549.439) * (-558.257) [-550.432] (-553.740) (-552.105) -- 0:00:09
866000 -- (-551.481) [-550.020] (-553.233) (-550.369) * (-556.897) [-550.159] (-553.954) (-551.264) -- 0:00:09
866500 -- (-551.242) (-549.796) (-552.259) [-549.526] * (-551.483) (-550.078) [-549.884] (-549.905) -- 0:00:09
867000 -- (-552.034) [-551.624] (-554.466) (-550.621) * (-550.919) (-548.956) [-549.567] (-555.889) -- 0:00:09
867500 -- (-556.843) (-549.771) [-552.342] (-549.075) * (-551.513) (-550.687) [-557.270] (-549.896) -- 0:00:09
868000 -- (-553.178) (-551.326) (-554.774) [-553.418] * (-553.389) [-551.569] (-552.736) (-548.805) -- 0:00:09
868500 -- [-549.119] (-553.689) (-551.868) (-550.752) * (-551.311) (-551.352) [-548.989] (-549.764) -- 0:00:09
869000 -- (-554.525) (-555.066) [-550.818] (-549.932) * (-550.377) (-548.244) (-548.568) [-549.064] -- 0:00:09
869500 -- (-552.652) [-549.273] (-549.881) (-552.805) * (-552.401) [-550.337] (-551.154) (-551.433) -- 0:00:09
870000 -- (-552.739) (-548.746) (-551.248) [-548.682] * (-555.892) (-552.273) (-549.836) [-553.352] -- 0:00:09
Average standard deviation of split frequencies: 0.006599
870500 -- (-553.892) (-554.047) [-551.218] (-553.510) * (-554.803) (-553.061) (-549.552) [-552.475] -- 0:00:09
871000 -- (-550.490) [-553.449] (-552.645) (-551.114) * (-550.756) [-550.460] (-550.163) (-549.065) -- 0:00:09
871500 -- [-550.433] (-551.511) (-550.781) (-550.673) * (-550.348) (-550.934) [-549.415] (-552.185) -- 0:00:09
872000 -- [-551.004] (-552.478) (-551.544) (-550.007) * [-550.898] (-551.745) (-551.485) (-551.787) -- 0:00:09
872500 -- [-551.259] (-549.689) (-550.354) (-551.781) * [-550.663] (-552.405) (-556.049) (-550.380) -- 0:00:09
873000 -- (-549.471) [-550.292] (-554.106) (-551.026) * (-549.285) (-552.041) [-552.317] (-549.343) -- 0:00:09
873500 -- (-552.201) [-552.579] (-554.633) (-552.516) * [-551.071] (-550.688) (-552.430) (-550.447) -- 0:00:09
874000 -- [-550.093] (-550.806) (-551.494) (-550.319) * (-550.691) (-550.855) [-552.988] (-549.903) -- 0:00:09
874500 -- (-549.879) (-552.354) (-550.846) [-550.739] * [-548.854] (-551.321) (-549.883) (-551.605) -- 0:00:09
875000 -- [-551.250] (-550.398) (-552.037) (-550.092) * (-551.555) (-550.145) (-552.060) [-552.502] -- 0:00:09
Average standard deviation of split frequencies: 0.006525
875500 -- (-553.069) (-551.914) [-552.583] (-553.331) * (-549.528) (-551.150) (-552.768) [-553.779] -- 0:00:09
876000 -- [-551.010] (-552.173) (-551.880) (-553.026) * [-549.461] (-556.125) (-550.871) (-552.027) -- 0:00:09
876500 -- (-558.760) (-552.559) (-550.132) [-550.207] * (-550.151) [-549.477] (-551.417) (-553.848) -- 0:00:09
877000 -- (-549.247) [-549.837] (-549.689) (-552.109) * (-549.653) [-550.819] (-550.352) (-548.968) -- 0:00:08
877500 -- (-550.333) (-550.301) [-550.026] (-551.198) * (-552.849) (-551.585) [-550.485] (-550.817) -- 0:00:08
878000 -- (-550.816) [-549.324] (-552.178) (-551.165) * [-549.629] (-551.582) (-551.300) (-549.894) -- 0:00:08
878500 -- (-549.993) (-550.747) [-555.111] (-555.967) * (-549.982) (-551.498) [-548.508] (-551.172) -- 0:00:08
879000 -- (-550.798) (-551.954) [-550.978] (-552.586) * (-548.150) [-551.438] (-548.301) (-550.930) -- 0:00:08
879500 -- [-552.968] (-549.793) (-553.920) (-552.851) * (-549.045) (-555.267) (-549.270) [-549.498] -- 0:00:08
880000 -- (-550.981) (-550.342) (-551.739) [-550.956] * (-549.787) (-555.798) (-548.838) [-550.241] -- 0:00:08
Average standard deviation of split frequencies: 0.006323
880500 -- (-551.966) (-552.518) (-551.475) [-550.372] * (-550.945) [-550.534] (-550.248) (-551.386) -- 0:00:08
881000 -- [-550.877] (-550.192) (-554.102) (-551.304) * [-548.987] (-557.104) (-554.354) (-554.120) -- 0:00:08
881500 -- [-551.113] (-551.699) (-549.567) (-553.727) * [-548.632] (-554.412) (-555.171) (-551.226) -- 0:00:08
882000 -- (-550.541) [-551.765] (-551.406) (-555.671) * (-550.466) (-551.875) (-551.358) [-549.086] -- 0:00:08
882500 -- (-551.368) [-552.335] (-552.828) (-552.287) * [-554.226] (-551.490) (-550.089) (-550.358) -- 0:00:08
883000 -- (-553.418) [-552.163] (-550.424) (-550.931) * (-552.084) (-553.321) [-551.752] (-550.269) -- 0:00:08
883500 -- (-553.552) (-551.237) (-553.276) [-548.375] * (-551.174) [-552.873] (-548.081) (-551.003) -- 0:00:08
884000 -- (-551.998) (-550.641) [-549.578] (-550.095) * (-550.776) (-551.992) (-551.260) [-553.108] -- 0:00:08
884500 -- (-551.449) (-551.604) (-550.833) [-551.593] * (-551.252) (-551.067) (-550.361) [-552.518] -- 0:00:08
885000 -- (-550.540) (-555.603) (-554.216) [-550.189] * (-550.459) (-550.562) (-553.919) [-551.827] -- 0:00:08
Average standard deviation of split frequencies: 0.006119
885500 -- (-552.645) [-548.911] (-548.835) (-550.872) * (-552.254) (-560.522) (-550.865) [-551.739] -- 0:00:08
886000 -- (-552.751) [-550.433] (-550.828) (-556.002) * (-551.559) (-552.685) [-550.801] (-548.584) -- 0:00:08
886500 -- [-552.128] (-553.014) (-551.200) (-558.517) * (-553.441) (-554.477) [-551.544] (-550.998) -- 0:00:08
887000 -- (-553.707) (-552.235) (-550.621) [-550.742] * (-551.547) (-552.020) (-553.082) [-548.670] -- 0:00:08
887500 -- [-550.674] (-550.928) (-551.829) (-552.597) * [-551.365] (-555.539) (-550.615) (-549.579) -- 0:00:08
888000 -- (-552.723) (-549.709) (-551.056) [-552.449] * (-551.249) (-555.196) (-550.131) [-550.522] -- 0:00:08
888500 -- (-551.847) (-550.108) (-549.896) [-552.930] * (-552.118) (-552.627) [-549.810] (-549.481) -- 0:00:08
889000 -- (-553.545) [-550.668] (-551.696) (-553.416) * [-551.110] (-552.593) (-553.862) (-550.423) -- 0:00:08
889500 -- [-551.342] (-553.894) (-551.962) (-554.538) * [-549.860] (-552.858) (-555.707) (-554.230) -- 0:00:08
890000 -- [-552.062] (-551.142) (-551.362) (-551.824) * [-549.203] (-549.832) (-550.611) (-551.941) -- 0:00:08
Average standard deviation of split frequencies: 0.006476
890500 -- (-553.126) (-550.741) (-551.205) [-552.572] * (-550.851) [-549.994] (-549.253) (-549.239) -- 0:00:07
891000 -- (-553.517) [-553.718] (-551.960) (-550.043) * (-551.277) (-550.971) (-551.235) [-550.486] -- 0:00:07
891500 -- (-554.028) (-553.778) (-547.655) [-550.531] * (-549.118) (-549.026) [-553.122] (-556.612) -- 0:00:07
892000 -- [-551.582] (-550.011) (-551.356) (-549.564) * (-548.410) (-549.668) (-551.976) [-549.010] -- 0:00:07
892500 -- (-554.844) (-553.057) [-549.732] (-550.949) * (-551.741) (-553.210) [-552.215] (-549.287) -- 0:00:07
893000 -- (-555.105) [-552.190] (-549.874) (-550.357) * (-548.504) (-551.329) (-552.358) [-550.852] -- 0:00:07
893500 -- [-556.713] (-553.371) (-550.837) (-549.217) * [-549.776] (-552.358) (-551.082) (-549.578) -- 0:00:07
894000 -- (-552.113) [-554.509] (-551.413) (-553.947) * (-551.837) (-552.588) (-557.165) [-548.520] -- 0:00:07
894500 -- [-550.864] (-551.127) (-550.187) (-550.838) * (-549.931) (-551.700) [-555.757] (-554.681) -- 0:00:07
895000 -- (-551.295) (-553.183) [-551.384] (-550.279) * (-553.502) (-550.748) (-553.574) [-549.579] -- 0:00:07
Average standard deviation of split frequencies: 0.006437
895500 -- [-550.828] (-550.414) (-554.254) (-550.928) * (-556.806) [-551.823] (-551.824) (-550.270) -- 0:00:07
896000 -- (-556.477) (-550.198) (-554.250) [-551.146] * (-549.659) [-552.638] (-552.905) (-552.933) -- 0:00:07
896500 -- [-551.306] (-551.474) (-552.952) (-551.608) * (-551.068) (-556.891) (-550.569) [-550.180] -- 0:00:07
897000 -- [-553.659] (-551.142) (-554.048) (-548.705) * [-550.817] (-550.748) (-551.402) (-549.640) -- 0:00:07
897500 -- (-552.747) (-550.572) [-551.216] (-554.976) * (-553.337) (-550.715) (-555.757) [-548.930] -- 0:00:07
898000 -- (-554.330) (-551.385) (-549.503) [-551.280] * (-551.536) [-554.899] (-550.088) (-552.323) -- 0:00:07
898500 -- (-558.233) [-550.780] (-552.950) (-551.605) * (-554.629) (-549.565) [-551.782] (-551.017) -- 0:00:07
899000 -- [-557.157] (-550.906) (-551.488) (-550.735) * (-557.770) [-550.422] (-552.689) (-550.113) -- 0:00:07
899500 -- (-552.459) (-551.387) [-553.235] (-550.781) * [-551.143] (-550.121) (-551.589) (-551.213) -- 0:00:07
900000 -- (-551.596) (-554.204) (-551.414) [-551.600] * (-553.326) (-551.426) (-552.914) [-550.316] -- 0:00:07
Average standard deviation of split frequencies: 0.006862
900500 -- [-550.604] (-549.328) (-557.192) (-555.910) * (-550.751) (-551.037) (-552.682) [-549.843] -- 0:00:07
901000 -- (-554.494) (-549.845) (-553.138) [-554.134] * (-553.164) (-551.107) (-550.156) [-550.853] -- 0:00:07
901500 -- (-553.101) (-548.684) (-552.570) [-553.857] * (-552.849) (-549.906) (-552.441) [-549.680] -- 0:00:07
902000 -- (-559.010) (-549.298) (-550.166) [-549.219] * (-550.592) (-553.421) [-548.709] (-551.003) -- 0:00:07
902500 -- (-550.856) [-552.303] (-553.579) (-550.084) * (-551.499) [-552.004] (-551.026) (-552.174) -- 0:00:07
903000 -- (-551.518) (-549.401) [-552.160] (-550.340) * (-549.024) (-552.851) (-550.652) [-549.574] -- 0:00:07
903500 -- (-551.514) (-549.696) (-555.938) [-551.427] * (-550.035) (-550.993) [-549.928] (-554.240) -- 0:00:07
904000 -- (-552.136) [-548.650] (-551.505) (-551.925) * (-552.929) (-551.517) [-552.203] (-550.716) -- 0:00:07
904500 -- (-556.975) (-549.425) (-548.883) [-550.638] * (-551.779) (-552.501) [-549.571] (-551.066) -- 0:00:06
905000 -- (-552.797) (-552.618) [-550.558] (-549.488) * (-551.314) (-552.284) [-553.340] (-550.913) -- 0:00:06
Average standard deviation of split frequencies: 0.007140
905500 -- (-551.151) (-553.105) [-550.989] (-551.729) * (-553.166) (-551.244) [-550.564] (-550.485) -- 0:00:06
906000 -- (-553.341) (-550.899) [-550.609] (-552.374) * (-555.007) (-549.857) (-552.778) [-549.302] -- 0:00:06
906500 -- (-556.173) [-549.355] (-552.550) (-552.439) * (-554.802) [-551.015] (-551.787) (-552.208) -- 0:00:06
907000 -- [-552.034] (-550.955) (-549.863) (-550.998) * (-551.551) [-553.508] (-549.267) (-550.506) -- 0:00:06
907500 -- (-552.481) [-550.974] (-551.936) (-554.079) * (-550.720) [-551.543] (-549.059) (-551.028) -- 0:00:06
908000 -- (-551.555) (-551.006) (-554.306) [-552.974] * [-550.289] (-552.563) (-551.616) (-549.543) -- 0:00:06
908500 -- (-551.440) (-552.491) [-552.521] (-553.330) * (-553.508) (-551.865) [-550.743] (-554.031) -- 0:00:06
909000 -- (-551.303) (-553.713) (-550.502) [-549.929] * (-551.187) [-553.920] (-551.569) (-550.748) -- 0:00:06
909500 -- (-556.549) (-553.372) (-553.940) [-552.483] * (-549.572) (-552.434) [-548.960] (-550.759) -- 0:00:06
910000 -- [-551.017] (-552.820) (-553.228) (-552.031) * [-552.139] (-551.979) (-552.142) (-553.468) -- 0:00:06
Average standard deviation of split frequencies: 0.007218
910500 -- (-552.766) (-550.509) (-552.810) [-552.625] * (-550.353) [-556.902] (-548.453) (-552.071) -- 0:00:06
911000 -- (-550.487) (-551.719) (-552.201) [-548.754] * (-550.097) [-553.782] (-552.109) (-550.821) -- 0:00:06
911500 -- [-551.460] (-553.268) (-549.650) (-549.528) * (-553.189) [-549.148] (-551.303) (-555.911) -- 0:00:06
912000 -- (-551.876) (-552.238) (-550.857) [-554.352] * (-550.756) [-553.204] (-550.915) (-550.562) -- 0:00:06
912500 -- [-551.794] (-553.607) (-551.827) (-549.966) * (-551.322) (-551.271) (-554.475) [-551.212] -- 0:00:06
913000 -- (-552.091) (-552.902) [-550.633] (-555.585) * (-551.127) (-552.904) [-552.213] (-549.182) -- 0:00:06
913500 -- [-551.027] (-551.489) (-549.208) (-551.308) * (-550.347) (-553.721) [-552.582] (-552.708) -- 0:00:06
914000 -- [-553.022] (-554.492) (-549.179) (-553.047) * (-551.851) (-549.886) [-550.109] (-553.274) -- 0:00:06
914500 -- [-553.407] (-556.478) (-551.268) (-550.118) * (-551.493) [-550.274] (-552.030) (-551.102) -- 0:00:06
915000 -- (-552.163) [-554.330] (-556.335) (-552.959) * [-549.350] (-556.729) (-549.680) (-550.328) -- 0:00:06
Average standard deviation of split frequencies: 0.007148
915500 -- (-550.729) (-552.714) (-555.552) [-553.153] * (-550.460) (-549.921) [-550.937] (-553.674) -- 0:00:06
916000 -- (-552.398) (-552.975) [-552.841] (-551.233) * [-551.456] (-551.434) (-549.799) (-550.315) -- 0:00:06
916500 -- (-550.250) [-551.297] (-549.620) (-552.142) * (-550.295) (-554.505) (-553.823) [-551.973] -- 0:00:06
917000 -- (-550.933) [-551.874] (-549.859) (-552.731) * (-549.999) (-551.822) (-554.813) [-553.676] -- 0:00:06
917500 -- (-553.415) [-551.147] (-548.876) (-554.398) * (-551.481) (-550.219) [-550.912] (-552.687) -- 0:00:06
918000 -- (-551.998) (-552.878) [-551.431] (-548.966) * (-551.289) (-552.055) [-549.892] (-547.713) -- 0:00:05
918500 -- [-550.172] (-553.770) (-551.097) (-554.886) * (-550.250) (-549.861) (-552.865) [-548.866] -- 0:00:05
919000 -- [-551.265] (-549.753) (-551.651) (-551.566) * (-551.571) (-552.749) [-548.381] (-550.257) -- 0:00:05
919500 -- (-551.889) (-551.588) (-550.805) [-550.301] * (-553.542) (-552.514) (-552.625) [-551.018] -- 0:00:05
920000 -- (-549.877) (-553.798) (-552.258) [-550.150] * (-550.213) (-551.425) (-548.724) [-551.343] -- 0:00:05
Average standard deviation of split frequencies: 0.007567
920500 -- (-550.271) (-557.007) [-552.195] (-550.715) * (-550.645) [-552.762] (-552.043) (-558.271) -- 0:00:05
921000 -- (-551.680) [-549.705] (-557.187) (-553.041) * (-553.233) (-551.052) (-551.687) [-551.046] -- 0:00:05
921500 -- (-553.332) (-549.650) [-551.003] (-550.260) * (-551.742) (-551.443) [-549.115] (-552.362) -- 0:00:05
922000 -- (-549.405) (-550.677) [-551.160] (-549.645) * [-551.792] (-556.259) (-552.229) (-552.261) -- 0:00:05
922500 -- (-552.190) (-552.540) [-551.781] (-552.632) * (-551.338) [-551.902] (-552.500) (-550.329) -- 0:00:05
923000 -- (-552.969) (-553.290) [-549.454] (-550.556) * [-552.979] (-551.717) (-552.928) (-551.436) -- 0:00:05
923500 -- (-551.355) (-553.572) [-548.959] (-550.037) * (-553.497) [-548.021] (-549.638) (-550.453) -- 0:00:05
924000 -- (-551.684) (-554.838) [-551.933] (-550.603) * (-553.437) (-551.754) (-548.298) [-552.227] -- 0:00:05
924500 -- [-551.097] (-551.507) (-553.467) (-550.321) * (-554.923) [-550.316] (-550.897) (-550.298) -- 0:00:05
925000 -- (-551.120) [-551.503] (-550.715) (-551.909) * (-550.945) (-550.422) (-551.101) [-552.828] -- 0:00:05
Average standard deviation of split frequencies: 0.007325
925500 -- (-550.281) [-551.670] (-551.211) (-553.836) * (-551.954) (-552.004) (-549.707) [-550.351] -- 0:00:05
926000 -- (-553.140) (-553.758) [-551.265] (-554.216) * [-552.542] (-549.340) (-554.281) (-553.178) -- 0:00:05
926500 -- (-551.684) (-550.872) [-552.289] (-553.828) * (-552.566) [-550.382] (-550.486) (-552.057) -- 0:00:05
927000 -- (-553.890) (-551.427) [-549.113] (-552.882) * [-551.679] (-550.803) (-549.611) (-550.369) -- 0:00:05
927500 -- (-553.363) (-551.039) [-551.576] (-555.075) * (-549.060) [-556.133] (-549.034) (-549.745) -- 0:00:05
928000 -- (-553.329) [-551.234] (-551.985) (-554.116) * [-551.400] (-555.719) (-551.671) (-552.739) -- 0:00:05
928500 -- [-551.079] (-550.253) (-550.754) (-553.344) * (-549.958) (-555.600) (-551.136) [-553.931] -- 0:00:05
929000 -- [-549.885] (-556.638) (-552.444) (-553.933) * (-554.424) (-550.636) [-549.982] (-552.877) -- 0:00:05
929500 -- (-548.694) (-553.227) [-550.033] (-556.353) * (-552.994) (-552.767) [-550.259] (-551.923) -- 0:00:05
930000 -- (-549.540) (-551.204) [-551.509] (-554.981) * (-551.981) (-553.720) (-548.117) [-551.728] -- 0:00:05
Average standard deviation of split frequencies: 0.007316
930500 -- (-550.270) [-551.379] (-549.888) (-551.388) * [-553.297] (-554.061) (-551.807) (-555.091) -- 0:00:05
931000 -- (-549.301) [-551.721] (-548.246) (-551.422) * (-551.327) [-550.702] (-550.032) (-552.928) -- 0:00:05
931500 -- [-550.226] (-550.917) (-550.902) (-551.165) * (-551.795) [-548.533] (-552.085) (-549.597) -- 0:00:05
932000 -- (-549.696) (-552.100) [-552.021] (-548.802) * (-552.566) (-551.858) [-550.281] (-550.865) -- 0:00:04
932500 -- [-550.447] (-550.795) (-554.173) (-552.591) * (-557.346) (-550.313) (-551.358) [-550.829] -- 0:00:04
933000 -- (-548.693) (-552.666) [-549.463] (-551.546) * (-551.995) (-552.186) (-550.395) [-551.230] -- 0:00:04
933500 -- (-550.363) (-549.735) (-551.209) [-549.820] * [-554.611] (-550.890) (-551.320) (-550.135) -- 0:00:04
934000 -- (-550.397) (-549.104) (-550.085) [-549.532] * (-551.703) (-549.852) (-554.729) [-551.021] -- 0:00:04
934500 -- [-549.777] (-552.078) (-553.363) (-547.713) * (-552.396) [-553.218] (-551.202) (-550.770) -- 0:00:04
935000 -- (-553.430) (-552.567) (-552.432) [-550.205] * (-552.193) [-552.613] (-555.002) (-552.309) -- 0:00:04
Average standard deviation of split frequencies: 0.007258
935500 -- (-552.053) (-549.653) (-551.538) [-552.629] * (-550.372) (-550.786) (-555.216) [-549.325] -- 0:00:04
936000 -- (-549.491) (-553.509) (-555.636) [-550.962] * (-554.096) [-552.070] (-555.871) (-551.983) -- 0:00:04
936500 -- (-551.040) (-551.624) (-553.569) [-550.564] * (-554.215) (-550.631) [-554.312] (-551.417) -- 0:00:04
937000 -- (-551.368) (-551.047) [-552.363] (-550.079) * (-557.033) [-548.815] (-555.646) (-550.694) -- 0:00:04
937500 -- (-551.922) (-552.534) (-550.295) [-550.359] * (-550.081) (-555.504) [-550.963] (-549.079) -- 0:00:04
938000 -- [-555.119] (-551.090) (-552.011) (-549.689) * (-552.963) [-551.358] (-551.462) (-553.670) -- 0:00:04
938500 -- (-551.993) (-551.330) (-552.193) [-550.632] * (-551.429) (-551.662) [-552.435] (-551.352) -- 0:00:04
939000 -- [-550.861] (-552.177) (-550.121) (-552.220) * (-551.737) [-548.322] (-553.923) (-552.163) -- 0:00:04
939500 -- [-550.754] (-551.675) (-548.902) (-550.263) * (-551.918) [-550.484] (-553.417) (-551.208) -- 0:00:04
940000 -- (-552.754) (-551.151) [-548.748] (-553.793) * [-551.175] (-554.945) (-554.684) (-555.027) -- 0:00:04
Average standard deviation of split frequencies: 0.007267
940500 -- (-556.090) [-550.993] (-548.176) (-551.879) * (-552.491) [-556.141] (-549.605) (-554.597) -- 0:00:04
941000 -- [-551.010] (-550.567) (-549.849) (-552.433) * (-555.791) (-552.069) [-550.802] (-551.125) -- 0:00:04
941500 -- (-552.674) [-552.495] (-551.444) (-551.476) * (-552.988) (-551.940) (-552.205) [-548.760] -- 0:00:04
942000 -- (-555.301) (-550.702) (-550.187) [-550.926] * [-549.245] (-553.734) (-551.505) (-550.051) -- 0:00:04
942500 -- [-552.331] (-548.658) (-550.541) (-555.603) * (-550.371) [-554.773] (-552.011) (-552.446) -- 0:00:04
943000 -- (-550.768) (-551.085) [-550.634] (-555.088) * [-550.168] (-555.076) (-550.876) (-550.748) -- 0:00:04
943500 -- [-550.858] (-554.068) (-550.990) (-553.508) * [-552.064] (-551.442) (-550.682) (-552.024) -- 0:00:04
944000 -- (-549.230) (-555.183) [-549.586] (-555.288) * (-552.049) (-550.182) [-548.624] (-550.414) -- 0:00:04
944500 -- [-548.049] (-548.780) (-548.718) (-548.710) * (-552.218) (-551.913) [-551.209] (-552.015) -- 0:00:04
945000 -- (-550.440) (-552.040) (-553.397) [-553.565] * (-551.742) [-550.170] (-555.024) (-551.840) -- 0:00:04
Average standard deviation of split frequencies: 0.007696
945500 -- (-553.254) (-550.688) (-552.746) [-549.460] * (-550.800) (-552.364) (-550.994) [-549.371] -- 0:00:03
946000 -- (-551.238) (-553.200) (-551.410) [-550.378] * (-554.888) (-550.441) [-553.743] (-555.890) -- 0:00:03
946500 -- (-557.610) (-550.053) [-550.633] (-552.711) * (-554.094) [-550.155] (-554.825) (-556.107) -- 0:00:03
947000 -- (-556.185) (-558.620) (-550.815) [-549.522] * (-553.666) (-553.037) (-550.907) [-555.688] -- 0:00:03
947500 -- (-551.673) (-552.205) [-551.183] (-548.673) * (-550.993) (-550.940) (-553.194) [-551.708] -- 0:00:03
948000 -- (-550.709) (-555.361) (-552.292) [-551.572] * [-548.877] (-550.780) (-549.502) (-553.289) -- 0:00:03
948500 -- (-552.568) (-552.514) (-553.175) [-551.127] * (-551.637) (-551.277) (-552.877) [-551.199] -- 0:00:03
949000 -- [-555.676] (-551.701) (-554.887) (-550.137) * [-549.479] (-553.503) (-550.804) (-551.007) -- 0:00:03
949500 -- [-551.234] (-551.050) (-550.666) (-548.947) * (-549.113) [-553.112] (-553.050) (-553.029) -- 0:00:03
950000 -- (-553.561) (-553.116) (-551.247) [-550.507] * (-550.935) (-551.514) (-550.587) [-549.305] -- 0:00:03
Average standard deviation of split frequencies: 0.007603
950500 -- [-550.574] (-550.252) (-554.814) (-552.272) * (-553.486) [-549.889] (-551.570) (-551.351) -- 0:00:03
951000 -- (-552.223) [-550.817] (-556.443) (-550.929) * [-550.699] (-551.660) (-551.348) (-551.094) -- 0:00:03
951500 -- (-555.352) [-549.192] (-553.228) (-548.633) * (-551.820) (-550.520) [-551.204] (-548.338) -- 0:00:03
952000 -- (-554.195) [-551.283] (-552.655) (-550.765) * (-550.193) (-552.931) (-549.944) [-548.729] -- 0:00:03
952500 -- (-555.022) (-550.700) [-553.409] (-549.474) * (-550.652) [-550.200] (-552.482) (-552.841) -- 0:00:03
953000 -- (-552.458) [-551.691] (-550.888) (-551.403) * [-548.441] (-550.864) (-554.660) (-549.772) -- 0:00:03
953500 -- (-549.520) [-551.054] (-551.906) (-552.074) * (-551.940) (-553.706) [-554.446] (-552.954) -- 0:00:03
954000 -- [-550.944] (-552.233) (-552.939) (-552.032) * [-552.984] (-552.520) (-553.709) (-551.204) -- 0:00:03
954500 -- (-550.975) (-550.539) (-553.268) [-550.669] * [-556.409] (-550.173) (-554.280) (-555.295) -- 0:00:03
955000 -- (-552.100) (-549.880) (-551.694) [-550.963] * (-552.971) [-551.701] (-551.095) (-550.523) -- 0:00:03
Average standard deviation of split frequencies: 0.007150
955500 -- (-548.612) [-551.993] (-552.845) (-554.837) * (-551.576) (-551.887) [-550.756] (-551.946) -- 0:00:03
956000 -- [-548.146] (-554.545) (-552.663) (-551.312) * [-552.620] (-553.520) (-552.708) (-551.058) -- 0:00:03
956500 -- [-553.909] (-552.455) (-552.186) (-550.000) * (-549.566) (-551.664) (-554.370) [-555.394] -- 0:00:03
957000 -- (-550.724) (-552.252) (-549.549) [-550.968] * (-551.937) (-554.843) [-549.052] (-553.587) -- 0:00:03
957500 -- (-547.985) (-553.915) [-549.469] (-551.119) * (-551.163) [-551.155] (-551.252) (-550.802) -- 0:00:03
958000 -- (-550.797) [-555.112] (-549.246) (-549.695) * [-551.171] (-549.372) (-552.024) (-551.283) -- 0:00:03
958500 -- (-553.270) [-551.791] (-553.915) (-553.551) * (-554.187) [-549.360] (-550.659) (-552.054) -- 0:00:03
959000 -- (-551.516) [-552.075] (-550.764) (-549.913) * (-554.601) (-550.286) [-550.852] (-549.380) -- 0:00:02
959500 -- (-550.927) [-550.941] (-550.793) (-553.283) * (-553.805) (-552.636) [-550.450] (-549.263) -- 0:00:02
960000 -- (-550.409) (-549.275) [-550.136] (-550.629) * [-552.590] (-553.686) (-552.962) (-552.843) -- 0:00:02
Average standard deviation of split frequencies: 0.007197
960500 -- (-550.351) (-550.051) [-550.643] (-549.002) * (-552.426) [-551.301] (-552.365) (-550.022) -- 0:00:02
961000 -- [-551.290] (-549.732) (-548.900) (-550.972) * [-552.586] (-551.362) (-554.613) (-549.048) -- 0:00:02
961500 -- [-554.056] (-556.888) (-550.985) (-551.181) * (-551.234) (-550.658) [-551.233] (-550.144) -- 0:00:02
962000 -- (-550.293) [-550.110] (-548.627) (-550.050) * (-550.995) (-553.644) [-549.815] (-550.758) -- 0:00:02
962500 -- (-552.441) (-553.122) (-552.874) [-548.970] * (-551.484) (-551.981) (-551.374) [-550.575] -- 0:00:02
963000 -- [-550.500] (-553.047) (-550.052) (-552.197) * (-551.150) (-554.510) (-550.390) [-550.498] -- 0:00:02
963500 -- (-550.598) (-553.069) [-550.250] (-551.792) * [-550.986] (-551.031) (-553.009) (-551.444) -- 0:00:02
964000 -- (-550.631) (-551.984) (-550.815) [-549.518] * [-553.123] (-550.990) (-549.589) (-552.030) -- 0:00:02
964500 -- (-551.025) (-550.802) [-550.331] (-554.916) * (-551.732) (-550.483) [-550.649] (-553.311) -- 0:00:02
965000 -- (-551.896) (-552.824) (-554.312) [-554.979] * (-552.965) [-550.143] (-553.666) (-550.251) -- 0:00:02
Average standard deviation of split frequencies: 0.007483
965500 -- (-549.335) (-560.337) (-551.335) [-549.746] * [-549.137] (-551.772) (-552.466) (-553.617) -- 0:00:02
966000 -- [-549.583] (-557.464) (-551.040) (-548.340) * (-550.419) [-549.477] (-551.168) (-549.252) -- 0:00:02
966500 -- (-551.347) (-551.778) (-550.864) [-548.894] * (-552.618) [-551.860] (-551.311) (-554.053) -- 0:00:02
967000 -- (-551.091) [-550.375] (-550.940) (-548.333) * (-551.768) (-553.204) (-550.332) [-555.065] -- 0:00:02
967500 -- (-550.527) [-549.497] (-551.374) (-551.840) * (-552.317) (-554.950) (-552.426) [-552.503] -- 0:00:02
968000 -- (-550.627) (-550.443) (-550.547) [-554.772] * [-551.765] (-550.104) (-552.153) (-554.596) -- 0:00:02
968500 -- (-550.563) (-551.919) [-552.467] (-553.297) * (-552.348) [-550.807] (-549.763) (-549.223) -- 0:00:02
969000 -- (-549.855) (-549.492) [-554.669] (-552.063) * (-552.411) [-550.180] (-549.629) (-549.323) -- 0:00:02
969500 -- (-550.044) [-553.787] (-552.614) (-552.126) * [-550.802] (-551.754) (-552.903) (-550.024) -- 0:00:02
970000 -- (-550.351) (-550.331) [-551.025] (-551.328) * (-550.986) [-552.329] (-549.339) (-551.378) -- 0:00:02
Average standard deviation of split frequencies: 0.007716
970500 -- (-551.901) (-551.030) [-552.441] (-552.115) * (-551.785) (-549.970) (-552.120) [-551.233] -- 0:00:02
971000 -- (-551.847) (-552.144) [-551.081] (-550.076) * [-550.471] (-548.311) (-552.831) (-550.387) -- 0:00:02
971500 -- (-549.321) (-551.535) (-553.874) [-549.594] * (-551.736) (-557.554) (-554.907) [-550.498] -- 0:00:02
972000 -- (-553.388) (-551.119) [-551.122] (-557.568) * (-551.850) (-551.732) [-551.887] (-553.402) -- 0:00:02
972500 -- [-548.589] (-553.325) (-551.854) (-556.055) * (-552.680) (-549.029) [-552.408] (-550.675) -- 0:00:02
973000 -- [-549.109] (-549.730) (-553.478) (-551.090) * (-549.990) [-552.948] (-555.511) (-550.845) -- 0:00:01
973500 -- [-551.328] (-550.623) (-550.992) (-553.510) * (-550.342) (-554.188) [-553.478] (-552.201) -- 0:00:01
974000 -- (-550.081) [-551.165] (-551.971) (-550.100) * (-550.554) (-553.558) (-551.022) [-552.302] -- 0:00:01
974500 -- (-550.659) [-550.000] (-551.510) (-550.892) * (-550.518) (-551.746) (-554.378) [-551.672] -- 0:00:01
975000 -- [-550.049] (-550.649) (-552.563) (-551.883) * [-549.202] (-550.927) (-553.534) (-551.544) -- 0:00:01
Average standard deviation of split frequencies: 0.007916
975500 -- (-549.410) (-548.568) (-549.796) [-550.097] * (-549.964) (-554.040) [-554.593] (-553.301) -- 0:00:01
976000 -- [-549.744] (-552.885) (-551.040) (-550.951) * (-551.816) [-550.393] (-552.834) (-550.627) -- 0:00:01
976500 -- (-553.388) (-552.405) [-549.912] (-552.007) * (-550.155) (-550.468) (-551.850) [-550.921] -- 0:00:01
977000 -- [-551.030] (-554.517) (-552.399) (-553.301) * (-554.012) (-551.583) (-553.181) [-554.153] -- 0:00:01
977500 -- [-551.725] (-557.293) (-553.157) (-549.972) * (-552.713) (-550.140) [-551.460] (-553.314) -- 0:00:01
978000 -- (-552.172) (-553.424) (-550.701) [-551.748] * (-551.943) [-549.758] (-555.366) (-551.046) -- 0:00:01
978500 -- (-551.545) (-555.027) (-550.853) [-552.448] * (-551.980) (-550.924) (-555.120) [-551.905] -- 0:00:01
979000 -- [-552.352] (-550.254) (-550.549) (-552.318) * (-551.023) [-549.628] (-550.639) (-551.751) -- 0:00:01
979500 -- (-550.616) (-549.105) [-552.406] (-550.650) * [-555.200] (-550.231) (-550.019) (-550.603) -- 0:00:01
980000 -- (-549.514) [-548.912] (-554.844) (-556.527) * [-552.726] (-550.681) (-551.413) (-551.127) -- 0:00:01
Average standard deviation of split frequencies: 0.007798
980500 -- (-551.531) (-548.748) [-553.028] (-558.049) * (-549.992) (-552.005) (-550.917) [-552.633] -- 0:00:01
981000 -- (-550.728) (-553.593) [-550.063] (-556.090) * [-551.343] (-550.515) (-551.546) (-552.000) -- 0:00:01
981500 -- (-549.378) [-550.454] (-556.392) (-552.798) * (-552.670) (-548.367) (-553.031) [-550.634] -- 0:00:01
982000 -- [-550.685] (-550.568) (-552.111) (-556.496) * (-550.516) (-549.582) [-550.972] (-550.757) -- 0:00:01
982500 -- [-551.561] (-551.441) (-553.050) (-554.551) * (-550.669) [-550.967] (-554.010) (-549.736) -- 0:00:01
983000 -- (-552.857) (-550.634) [-549.915] (-551.361) * [-549.885] (-554.470) (-552.700) (-551.391) -- 0:00:01
983500 -- (-556.363) (-548.900) [-552.588] (-551.327) * (-552.908) [-551.996] (-552.148) (-549.790) -- 0:00:01
984000 -- (-553.072) (-550.202) (-550.457) [-549.515] * (-551.258) (-550.898) (-557.710) [-550.382] -- 0:00:01
984500 -- [-551.621] (-550.148) (-549.854) (-550.551) * (-551.203) [-551.391] (-552.341) (-551.722) -- 0:00:01
985000 -- (-550.069) (-549.849) (-552.022) [-550.133] * [-551.350] (-550.512) (-554.719) (-549.751) -- 0:00:01
Average standard deviation of split frequencies: 0.007915
985500 -- (-554.138) (-551.145) (-550.464) [-559.574] * (-550.644) (-551.582) [-550.919] (-550.856) -- 0:00:01
986000 -- (-549.882) (-551.686) (-555.009) [-552.596] * (-551.007) [-550.719] (-553.479) (-560.208) -- 0:00:01
986500 -- (-551.495) (-548.817) (-550.068) [-553.070] * (-550.961) [-549.141] (-549.381) (-551.710) -- 0:00:00
987000 -- [-551.204] (-550.664) (-553.590) (-551.012) * (-552.509) (-551.344) [-550.231] (-552.186) -- 0:00:00
987500 -- (-550.085) (-549.435) (-554.725) [-551.720] * (-553.886) [-552.644] (-549.565) (-555.078) -- 0:00:00
988000 -- (-550.754) (-551.608) [-553.659] (-551.476) * (-553.606) (-551.231) [-550.875] (-551.740) -- 0:00:00
988500 -- (-550.590) (-551.308) (-548.851) [-549.476] * [-551.440] (-551.208) (-553.599) (-553.729) -- 0:00:00
989000 -- (-555.314) (-551.401) [-549.836] (-548.413) * (-553.334) [-551.789] (-548.682) (-552.105) -- 0:00:00
989500 -- [-550.196] (-551.715) (-554.058) (-549.654) * (-550.283) (-553.308) (-550.678) [-550.200] -- 0:00:00
990000 -- (-553.449) (-552.068) [-551.482] (-551.645) * (-551.928) [-552.232] (-553.975) (-548.824) -- 0:00:00
Average standard deviation of split frequencies: 0.007693
990500 -- (-553.430) [-551.128] (-551.737) (-550.566) * (-552.508) [-550.237] (-552.475) (-549.129) -- 0:00:00
991000 -- (-550.422) (-549.848) [-551.603] (-552.798) * (-551.662) [-551.390] (-551.000) (-555.364) -- 0:00:00
991500 -- [-554.530] (-551.062) (-551.614) (-555.055) * (-552.405) (-550.059) [-550.104] (-548.355) -- 0:00:00
992000 -- (-553.934) (-551.064) [-550.870] (-554.438) * (-552.152) (-551.186) [-550.312] (-550.320) -- 0:00:00
992500 -- (-549.679) [-556.202] (-551.250) (-553.099) * [-550.520] (-552.476) (-549.987) (-549.975) -- 0:00:00
993000 -- [-549.911] (-554.109) (-551.140) (-552.960) * (-555.075) [-549.699] (-552.205) (-551.642) -- 0:00:00
993500 -- (-553.113) (-552.796) (-552.470) [-550.999] * (-552.332) (-553.199) [-552.030] (-549.794) -- 0:00:00
994000 -- (-554.779) [-552.337] (-554.311) (-551.702) * [-552.386] (-548.857) (-552.128) (-552.900) -- 0:00:00
994500 -- [-551.975] (-552.137) (-551.207) (-554.413) * (-551.332) (-549.686) (-553.718) [-550.459] -- 0:00:00
995000 -- [-551.293] (-553.647) (-553.782) (-551.152) * (-550.755) (-548.642) (-549.899) [-551.798] -- 0:00:00
Average standard deviation of split frequencies: 0.007546
995500 -- (-549.255) [-549.946] (-555.489) (-551.712) * (-554.031) (-550.395) [-549.338] (-551.430) -- 0:00:00
996000 -- (-550.429) (-548.733) [-550.908] (-549.855) * (-550.600) [-550.482] (-549.757) (-550.178) -- 0:00:00
996500 -- [-552.689] (-550.841) (-551.296) (-549.292) * [-549.919] (-549.439) (-555.148) (-555.455) -- 0:00:00
997000 -- (-554.576) (-552.086) (-550.714) [-549.543] * (-550.674) (-550.600) [-551.533] (-552.047) -- 0:00:00
997500 -- (-557.917) (-553.004) (-550.050) [-552.052] * (-549.370) (-548.618) (-555.031) [-553.764] -- 0:00:00
998000 -- (-551.868) [-550.959] (-552.623) (-550.633) * (-550.919) (-553.737) (-553.382) [-550.103] -- 0:00:00
998500 -- (-549.681) [-551.737] (-550.715) (-552.006) * (-551.121) [-550.800] (-553.535) (-548.772) -- 0:00:00
999000 -- [-551.998] (-555.958) (-551.766) (-552.802) * (-552.104) (-552.170) (-555.258) [-549.249] -- 0:00:00
999500 -- (-552.898) (-552.456) [-549.925] (-552.229) * (-555.045) (-549.533) (-551.504) [-550.485] -- 0:00:00
1000000 -- (-554.695) [-554.072] (-553.324) (-551.587) * (-551.919) (-551.743) (-550.207) [-553.378] -- 0:00:00
Average standard deviation of split frequencies: 0.007668
Analysis completed in 1 mins 13 seconds
Analysis used 71.31 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -546.22
Likelihood of best state for "cold" chain of run 2 was -546.22
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 66 %) Dirichlet(Revmat{all})
98.2 % ( 96 %) Slider(Revmat{all})
34.9 % ( 24 %) Dirichlet(Pi{all})
34.8 % ( 23 %) Slider(Pi{all})
69.9 % ( 47 %) Multiplier(Alpha{1,2})
79.3 % ( 48 %) Multiplier(Alpha{3})
28.9 % ( 20 %) Slider(Pinvar{all})
97.2 % ( 98 %) ExtSPR(Tau{all},V{all})
68.9 % ( 71 %) ExtTBR(Tau{all},V{all})
97.9 % ( 98 %) NNI(Tau{all},V{all})
87.8 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 17 %) Multiplier(V{all})
95.1 % ( 98 %) Nodeslider(V{all})
30.2 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 62 %) Dirichlet(Revmat{all})
98.3 % ( 97 %) Slider(Revmat{all})
34.7 % ( 24 %) Dirichlet(Pi{all})
35.4 % ( 32 %) Slider(Pi{all})
69.8 % ( 45 %) Multiplier(Alpha{1,2})
79.3 % ( 66 %) Multiplier(Alpha{3})
28.8 % ( 30 %) Slider(Pinvar{all})
97.1 % (100 %) ExtSPR(Tau{all},V{all})
68.8 % ( 69 %) ExtTBR(Tau{all},V{all})
98.1 % (100 %) NNI(Tau{all},V{all})
87.8 % ( 85 %) ParsSPR(Tau{all},V{all})
28.0 % ( 27 %) Multiplier(V{all})
95.0 % ( 96 %) Nodeslider(V{all})
30.6 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166695 0.82 0.66
3 | 166542 166728 0.83
4 | 167183 166667 166185
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 167182 0.82 0.66
3 | 166800 166232 0.83
4 | 166779 166587 166420
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -550.57
| 1 1 1 1 1 1 |
| 1 2 |
| 1 1 1 1 2 |
| 2 *2 1 1 2 1 * 211 212 21 1 |
|1 1 22 1 2 1 22 2 2 2 1 2|
| 11 1 1 1 2 1 2 1 * |
| 2 2 1 1 1 1 2 1 2 * 2 |
| * 2 2 1 2 1 2 * 2 11 |
| 2 12 2 2 2 21 |
| 1 2 2 2 22 2 2 1 1|
|2 1 * * 2 1 21 2 |
| 1 2 1 2 |
| 2 |
| 2 1 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -552.18
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -550.16 -554.23
2 -550.34 -553.97
--------------------------------------
TOTAL -550.25 -554.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882840 0.087792 0.342662 1.449246 0.857879 1347.55 1379.10 1.001
r(A<->C){all} 0.145022 0.016534 0.000106 0.410633 0.108185 194.90 203.70 1.002
r(A<->G){all} 0.163274 0.020110 0.000063 0.457208 0.124344 166.45 178.68 1.002
r(A<->T){all} 0.168053 0.020015 0.000033 0.451342 0.129457 184.56 259.89 1.000
r(C<->G){all} 0.136815 0.016731 0.000144 0.409440 0.097218 173.53 242.45 1.000
r(C<->T){all} 0.220775 0.027864 0.000001 0.556096 0.184900 176.27 256.75 1.007
r(G<->T){all} 0.166061 0.021122 0.000117 0.451856 0.124821 214.90 239.47 1.000
pi(A){all} 0.222412 0.000432 0.182565 0.264175 0.221936 1364.33 1413.20 1.000
pi(C){all} 0.312794 0.000544 0.264691 0.355730 0.312377 1166.77 1266.49 1.000
pi(G){all} 0.280344 0.000501 0.234830 0.323384 0.279985 1233.30 1332.94 1.000
pi(T){all} 0.184450 0.000378 0.147642 0.221054 0.183354 1199.19 1270.66 1.000
alpha{1,2} 0.328173 0.151017 0.000121 1.009211 0.210145 1038.18 1248.04 1.000
alpha{3} 0.407229 0.226512 0.000209 1.332854 0.237479 1165.01 1181.79 1.001
pinvar{all} 0.990873 0.000064 0.975786 0.999760 0.992935 1328.06 1414.53 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .*.***
9 -- ...**.
10 -- ..****
11 -- .**.**
12 -- ...*.*
13 -- ..**..
14 -- ..*.*.
15 -- .*...*
16 -- ..*..*
17 -- .*..*.
18 -- .***.*
19 -- ....**
20 -- .****.
21 -- .*.*..
22 -- ..***.
23 -- ..*.**
24 -- ...***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 446 0.148568 0.000942 0.147901 0.149234 2
8 445 0.148235 0.005182 0.144570 0.151899 2
9 443 0.147568 0.005182 0.143904 0.151233 2
10 439 0.146236 0.004240 0.143238 0.149234 2
11 436 0.145237 0.005653 0.141239 0.149234 2
12 435 0.144903 0.002355 0.143238 0.146569 2
13 431 0.143571 0.014604 0.133245 0.153897 2
14 423 0.140906 0.001413 0.139907 0.141905 2
15 419 0.139574 0.006124 0.135243 0.143904 2
16 418 0.139241 0.005653 0.135243 0.143238 2
17 414 0.137908 0.004711 0.134577 0.141239 2
18 412 0.137242 0.007537 0.131912 0.142572 2
19 410 0.136576 0.022612 0.120586 0.152565 2
20 408 0.135909 0.009422 0.129247 0.142572 2
21 407 0.135576 0.002355 0.133911 0.137242 2
22 297 0.098934 0.013662 0.089274 0.108594 2
23 281 0.093604 0.011777 0.085276 0.101932 2
24 279 0.092938 0.014604 0.082612 0.103264 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.089851 0.008726 0.000004 0.280984 0.060298 1.001 2
length{all}[2] 0.093859 0.009363 0.000003 0.296074 0.062854 1.000 2
length{all}[3] 0.092068 0.008439 0.000098 0.278809 0.064169 1.000 2
length{all}[4] 0.090211 0.007925 0.000029 0.270849 0.063591 1.000 2
length{all}[5] 0.140879 0.014236 0.000117 0.378932 0.110350 1.000 2
length{all}[6] 0.089568 0.007960 0.000039 0.263025 0.062247 1.000 2
length{all}[7] 0.096166 0.008705 0.000231 0.300624 0.070068 1.012 2
length{all}[8] 0.086430 0.007615 0.000039 0.275988 0.058661 0.999 2
length{all}[9] 0.097024 0.009340 0.000130 0.312801 0.072161 0.998 2
length{all}[10] 0.097161 0.009218 0.000390 0.280343 0.064788 1.000 2
length{all}[11] 0.094879 0.008296 0.000231 0.292472 0.066657 0.999 2
length{all}[12] 0.092398 0.009484 0.000039 0.261865 0.063607 1.000 2
length{all}[13] 0.096000 0.010588 0.000028 0.291437 0.059693 0.998 2
length{all}[14] 0.105047 0.010901 0.000064 0.323421 0.066065 0.998 2
length{all}[15] 0.097756 0.009098 0.000246 0.281635 0.070291 0.999 2
length{all}[16] 0.081687 0.006466 0.000304 0.256624 0.055452 0.998 2
length{all}[17] 0.100749 0.011740 0.000075 0.296048 0.067294 1.004 2
length{all}[18] 0.093716 0.007972 0.000161 0.261997 0.067131 0.998 2
length{all}[19] 0.095081 0.008668 0.000067 0.266655 0.070244 0.998 2
length{all}[20] 0.096618 0.011332 0.000086 0.305017 0.064607 0.999 2
length{all}[21] 0.103041 0.010818 0.000204 0.306916 0.071529 0.999 2
length{all}[22] 0.095130 0.008714 0.000499 0.273965 0.071489 0.999 2
length{all}[23] 0.092223 0.009261 0.000084 0.297813 0.059622 0.998 2
length{all}[24] 0.091952 0.009543 0.000167 0.277297 0.059341 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007668
Maximum standard deviation of split frequencies = 0.022612
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.012
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------- C1 (1)
|
|----------------------------------------- C2 (2)
|
|------------------------------------------ C3 (3)
+
|----------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------- C6 (6)
|------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 396
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
3 ambiguity characters in seq. 1
3 ambiguity characters in seq. 2
3 ambiguity characters in seq. 3
3 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
6 ambiguity characters in seq. 6
2 sites are removed. 1 132
Sequences read..
Counting site patterns.. 0:00
Compressing, 46 patterns at 130 / 130 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 46 patterns at 130 / 130 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
44896 bytes for conP
4048 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.040000 0.061528 0.072620 0.082070 0.033998 0.097112 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -574.935144
Iterating by ming2
Initial: fx= 574.935144
x= 0.04000 0.06153 0.07262 0.08207 0.03400 0.09711 0.30000 1.30000
1 h-m-p 0.0000 0.0003 300.2699 +++ 548.016725 m 0.0003 14 | 1/8
2 h-m-p 0.0000 0.0000 2019.7283 ++ 537.012477 m 0.0000 25 | 2/8
3 h-m-p 0.0001 0.0004 47.1362 ++ 532.932747 m 0.0004 36 | 3/8
4 h-m-p 0.0000 0.0002 68.7344 ++ 530.479339 m 0.0002 47 | 4/8
5 h-m-p 0.0006 0.0030 12.6799 ++ 528.740213 m 0.0030 58 | 5/8
6 h-m-p 0.0160 8.0000 2.8787 ++++YYCCC 525.972070 4 4.7390 79 | 5/8
7 h-m-p 1.6000 8.0000 0.0693 ++ 525.929568 m 8.0000 90 | 5/8
8 h-m-p 0.5035 7.4283 1.1007 +YYC 525.876219 2 1.6577 107 | 5/8
9 h-m-p 1.6000 8.0000 0.1053 ++ 525.858041 m 8.0000 118 | 5/8
10 h-m-p 0.2332 8.0000 3.6130 ++YCCC 525.794919 3 2.7264 139 | 5/8
11 h-m-p 1.6000 8.0000 1.5186 YCCC 525.758812 3 3.6012 155 | 5/8
12 h-m-p 1.4024 8.0000 3.8997 ++ 525.715277 m 8.0000 166 | 5/8
13 h-m-p 1.6000 8.0000 9.5145 CCCC 525.696270 3 1.8419 183 | 5/8
14 h-m-p 1.6000 8.0000 10.6378 ++ 525.677464 m 8.0000 194 | 5/8
15 h-m-p 1.6000 8.0000 19.6006 CCC 525.668785 2 1.7119 209 | 5/8
16 h-m-p 1.3740 8.0000 24.4205 ++ 525.659850 m 8.0000 220 | 5/8
17 h-m-p 1.6000 8.0000 64.8661 CC 525.657049 1 1.9750 233 | 5/8
18 h-m-p 1.6000 8.0000 70.6143 +YC 525.654113 1 5.2911 246 | 5/8
19 h-m-p 0.6892 3.4461 126.0601 +YC 525.652640 1 2.3292 259 | 5/8
20 h-m-p 0.1682 0.8412 167.4648 ++ 525.652209 m 0.8412 270 | 6/8
21 h-m-p 0.0697 0.3486 356.8175 ++ 525.651851 m 0.3486 281 | 7/8
22 h-m-p 0.6529 8.0000 0.0000 C 525.651831 0 1.0169 292 | 7/8
23 h-m-p 1.6000 8.0000 0.0000 Y 525.651831 0 3.8322 304
Out..
lnL = -525.651831
305 lfun, 305 eigenQcodon, 1830 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.026465 0.038847 0.044924 0.095973 0.063862 0.023697 999.000000 0.625500 0.282239
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.028285
np = 9
lnL0 = -559.364698
Iterating by ming2
Initial: fx= 559.364698
x= 0.02647 0.03885 0.04492 0.09597 0.06386 0.02370 951.42857 0.62550 0.28224
1 h-m-p 0.0000 0.0002 286.6812 +++ 543.051348 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0000 403.5524 ++ 540.536510 m 0.0000 27 | 2/9
3 h-m-p 0.0001 0.0003 113.3544 ++ 535.607029 m 0.0003 39 | 3/9
4 h-m-p 0.0001 0.0004 98.8146 ++ 533.424829 m 0.0004 51 | 4/9
5 h-m-p 0.0001 0.0004 226.7031 ++ 526.945222 m 0.0004 63 | 5/9
6 h-m-p 0.0152 0.0761 3.5524 +YYCYCCC 526.097938 6 0.0497 85 | 5/9
7 h-m-p 0.4103 2.0514 0.2600 ++ 525.979526 m 2.0514 97 | 6/9
8 h-m-p 0.1758 2.8082 0.1660 +YYC 525.952953 2 0.5579 116 | 6/9
9 h-m-p 1.6000 8.0000 0.0005 Y 525.952952 0 0.8127 131 | 6/9
10 h-m-p 1.6000 8.0000 0.0000 ----Y 525.952952 0 0.0016 150
Out..
lnL = -525.952952
151 lfun, 453 eigenQcodon, 1812 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.027590 0.102635 0.041732 0.011187 0.083159 0.034799 951.428575 1.057172 0.393252 0.182215 1057.899727
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000142
np = 11
lnL0 = -541.082281
Iterating by ming2
Initial: fx= 541.082281
x= 0.02759 0.10264 0.04173 0.01119 0.08316 0.03480 951.42858 1.05717 0.39325 0.18222 951.42857
1 h-m-p 0.0000 0.0003 68.3848 +++ 539.243087 m 0.0003 17 | 1/11
2 h-m-p 0.0015 0.0169 13.6003 ++ 536.091426 m 0.0169 31 | 2/11
3 h-m-p 0.0002 0.0008 19.7695 ++ 535.517478 m 0.0008 45 | 3/11
4 h-m-p 0.0003 0.0025 54.3395 ++ 534.187145 m 0.0025 59 | 4/11
5 h-m-p 0.0001 0.0005 363.6814 ++ 531.420624 m 0.0005 73 | 5/11
6 h-m-p 0.0010 0.0050 97.1597 +YYCYYCYYYC 525.611453 10 0.0047 100 | 5/11
7 h-m-p 0.9479 4.7395 0.0049 --C 525.611447 0 0.0178 116 | 5/11
8 h-m-p 0.0160 8.0000 0.0078 +++++ 525.609877 m 8.0000 139 | 5/11
9 h-m-p 0.0726 8.0000 0.8611 --------------.. | 5/11
10 h-m-p 0.0160 8.0000 0.1099 ---Y 525.609877 0 0.0001 194 | 5/11
11 h-m-p 0.0160 8.0000 0.0394 +++++ 525.596771 m 8.0000 217 | 5/11
12 h-m-p 0.2709 7.3310 1.1649 ---------------.. | 5/11
13 h-m-p 0.0160 8.0000 0.5891 ---Y 525.596752 0 0.0001 267 | 5/11
14 h-m-p 0.0160 8.0000 0.0490 +++++ 525.573089 m 8.0000 290 | 5/11
15 h-m-p 0.3422 5.2712 1.1461 ---------------.. | 5/11
16 h-m-p 0.0160 8.0000 1.3471 --YC 525.572969 1 0.0001 340 | 5/11
17 h-m-p 0.0160 8.0000 0.0751 +++++ 525.508872 m 8.0000 357 | 5/11
18 h-m-p 0.4926 3.2167 1.2203 ----------------.. | 5/11
19 h-m-p 0.0160 8.0000 4.7044 --CYC 525.506116 2 0.0003 410 | 5/11
20 h-m-p 0.0160 8.0000 0.1625 +++++ 525.212780 m 8.0000 427 | 5/11
21 h-m-p 0.0157 0.0787 1.1659 ++ 525.207544 m 0.0787 447 | 6/11
22 h-m-p 1.6000 8.0000 0.0308 +YC 525.170791 1 7.0202 463 | 6/11
23 h-m-p 1.6000 8.0000 0.0582 YC 525.168708 1 0.9751 483 | 6/11
24 h-m-p 1.6000 8.0000 0.0113 CC 525.168382 1 2.0354 504 | 6/11
25 h-m-p 1.6000 8.0000 0.0085 ++ 525.167923 m 8.0000 523 | 6/11
26 h-m-p 0.0725 8.0000 0.9329 ++CYC 525.163492 2 1.6580 547 | 6/11
27 h-m-p 1.6000 8.0000 0.2118 C 525.162228 0 1.7602 566 | 6/11
28 h-m-p 1.0691 8.0000 0.3487 +CC 525.161543 1 3.7939 588 | 6/11
29 h-m-p 1.6000 8.0000 0.3319 C 525.161325 0 2.0131 607 | 6/11
30 h-m-p 1.6000 8.0000 0.3513 YC 525.161227 1 3.0473 627 | 6/11
31 h-m-p 1.6000 8.0000 0.3745 C 525.161186 0 2.5060 646 | 6/11
32 h-m-p 1.6000 8.0000 0.3826 Y 525.161168 0 2.7265 665 | 6/11
33 h-m-p 1.6000 8.0000 0.4528 Y 525.161157 0 3.2193 684 | 6/11
34 h-m-p 1.6000 8.0000 0.7144 +Y 525.161147 0 4.0688 704 | 6/11
35 h-m-p 1.3750 8.0000 2.1140 ++ 525.161090 m 8.0000 723 | 6/11
36 h-m-p 0.2637 1.3185 54.5608 ++ 525.160897 m 1.3185 737 | 6/11
37 h-m-p -0.0000 -0.0000 330.5287
h-m-p: -0.00000000e+00 -0.00000000e+00 3.30528684e+02 525.160897
.. | 6/11
38 h-m-p 0.0160 8.0000 0.1028 C 525.160880 0 0.0034 762 | 6/11
39 h-m-p 0.0366 8.0000 0.0095 ++YC 525.160832 1 1.0742 784 | 6/11
40 h-m-p 1.6000 8.0000 0.0001 +C 525.160832 0 6.4354 804 | 6/11
41 h-m-p 0.9966 8.0000 0.0010 ++ 525.160830 m 8.0000 823 | 6/11
42 h-m-p 0.0003 0.1273 355.5203 +++++ 525.154412 m 0.1273 845 | 7/11
43 h-m-p 1.1235 8.0000 1.8903 YC 525.154357 1 0.5419 860 | 7/11
44 h-m-p 1.6000 8.0000 0.0343 C 525.154356 0 1.6308 874 | 7/11
45 h-m-p 0.8122 8.0000 0.0688 ++ 525.154353 m 8.0000 892 | 7/11
46 h-m-p 0.0046 0.3803 120.3175 ++++ 525.154071 m 0.3803 912 | 8/11
47 h-m-p 0.7258 8.0000 0.0020 C 525.154045 0 0.9433 926 | 8/11
48 h-m-p 1.6000 8.0000 0.0002 Y 525.154045 0 1.0015 943 | 8/11
49 h-m-p 1.6000 8.0000 0.0000 C 525.154045 0 1.5872 960
Out..
lnL = -525.154045
961 lfun, 3844 eigenQcodon, 17298 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -525.970199 S = -523.401737 -2.723118
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:05
did 20 / 46 patterns 0:05
did 30 / 46 patterns 0:05
did 40 / 46 patterns 0:06
did 46 / 46 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.018735 0.052166 0.090476 0.013062 0.031200 0.084982 999.000000 0.547960 1.218037
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.038776
np = 9
lnL0 = -559.759679
Iterating by ming2
Initial: fx= 559.759679
x= 0.01874 0.05217 0.09048 0.01306 0.03120 0.08498 951.42857 0.54796 1.21804
1 h-m-p 0.0000 0.0001 278.2894 ++ 551.361034 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 46426.7644 ++ 548.314738 m 0.0000 26 | 2/9
3 h-m-p 0.0001 0.0005 109.7860 ++ 535.637646 m 0.0005 38 | 3/9
4 h-m-p 0.0000 0.0000 1187.2279 ++ 527.721153 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0001 72.5876 ++ 527.013981 m 0.0001 62 | 5/9
6 h-m-p 0.0069 3.4446 0.8695 ++++
QuantileBeta(0.85, 3.27584, 0.00500) = 1.000000e+00 2000 rounds
+ 525.955088 m 3.4446 77
QuantileBeta(0.85, 3.27584, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.27584, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.27584, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.27584, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.27584, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.27584, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.27584, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.27584, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.27584, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.27599, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.27569, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
7 h-m-p 1.6000 8.0000 0.0253
QuantileBeta(0.85, 3.23537, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.11395, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.07347, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12834, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.18185, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12746, 0.00500) = 1.000000e+00 2000 rounds
C 525.952951 1 5.8658 96
QuantileBeta(0.85, 3.12746, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12746, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12746, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12746, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12746, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12746, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12746, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12746, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12746, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12731, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12746, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
8 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.85, 3.12735, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12701, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
C 525.952951 0 1.4920 111
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12750, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12721, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
| 6/9
9 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 3.12742, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12737, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
C 525.952951 0 0.0216 128
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -525.952951
129 lfun, 1419 eigenQcodon, 7740 P(t)
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.12736, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.070027 0.084751 0.085886 0.051383 0.014479 0.085889 951.428593 0.900000 1.145284 1.791755 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000264
np = 11
lnL0 = -537.769741
Iterating by ming2
Initial: fx= 537.769741
x= 0.07003 0.08475 0.08589 0.05138 0.01448 0.08589 951.42859 0.90000 1.14528 1.79176 951.42857
1 h-m-p 0.0000 0.0011 109.7323 +++YYYCYCYC 530.507953 7 0.0009 29 | 0/11
2 h-m-p 0.0011 0.0054 19.1547 ++ 529.311177 m 0.0054 43 | 1/11
3 h-m-p 0.0001 0.0003 127.0073 ++ 528.425489 m 0.0003 57 | 2/11
4 h-m-p 0.0186 0.0928 0.7984 +YCYCCC 527.333166 5 0.0550 80 | 2/11
5 h-m-p 0.0145 0.0727 0.7985 -------------.. | 2/11
6 h-m-p 0.0000 0.0010 34.2117 ++++ 525.680236 m 0.0010 139 | 3/11
7 h-m-p 0.0000 0.0000 15.9464 ++ 525.679083 m 0.0000 153 | 4/11
8 h-m-p 0.0000 0.0001 29.9753 ++ 525.474318 m 0.0001 167 | 5/11
9 h-m-p 0.0002 0.0158 5.0544 ++CCCC 525.418841 3 0.0048 189 | 5/11
10 h-m-p 0.1350 0.6750 0.1101 YCYCCC 525.273664 5 0.3838 212 | 5/11
11 h-m-p 0.5803 8.0000 0.0728 YCCC 525.225141 3 1.0395 237 | 5/11
12 h-m-p 0.8003 4.0015 0.0464 YCC 525.220735 2 0.5103 260 | 5/11
13 h-m-p 0.5102 8.0000 0.0464 ++ 525.208404 m 8.0000 280 | 5/11
14 h-m-p 0.0699 0.3496 2.2592 +
QuantileBeta(0.15, 0.00500, 2.41946) = 1.060750e-160 2000 rounds
+ 525.179533 m 0.3496 300
QuantileBeta(0.15, 0.00500, 2.41946) = 1.060750e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41946) = 1.060750e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41946) = 1.060750e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41946) = 1.060750e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41946) = 1.060750e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41946) = 1.060750e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41946) = 1.060750e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41946) = 1.060750e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41946) = 1.097780e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41946) = 1.060749e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41946) = 1.060750e-160 2000 rounds
| 6/11
15 h-m-p 0.9004 5.8162 0.4152 CCC 525.166211 2 0.9395 318 | 6/11
16 h-m-p 1.6000 8.0000 0.0423 YC 525.161281 1 1.1957 338 | 6/11
17 h-m-p 1.4356 8.0000 0.0352
QuantileBeta(0.15, 0.00500, 2.18122) = 1.207080e-160 2000 rounds
YC 525.161185 1 0.8929 358 | 6/11
18 h-m-p 1.6000 8.0000 0.0004 Y 525.161183 0 1.0911 377 | 6/11
19 h-m-p 1.6000 8.0000 0.0002 ++ 525.161183 m 8.0000 396 | 6/11
20 h-m-p 0.0646 8.0000 0.0189 ++Y 525.161180 0 2.2497 417 | 6/11
21 h-m-p 1.6000 8.0000 0.0231 ++ 525.161153 m 8.0000 436 | 6/11
22 h-m-p 0.0011 0.2741 172.9618 ++
QuantileBeta(0.15, 0.00500, 2.35797) = 1.095046e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.36926) = 7.140879e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.37011) = 7.138792e-161 2000 rounds
+ 525.154718 m 0.2741 458
QuantileBeta(0.15, 0.00500, 3.37011) = 7.138792e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37011) = 7.138792e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37011) = 7.138792e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37011) = 7.138792e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37011) = 7.138792e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37011) = 7.138792e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37011) = 7.138792e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37011) = 7.138792e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37011) = 7.388005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37011) = 7.138787e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37011) = 7.138792e-161 2000 rounds
| 7/11
23 h-m-p 0.4768 2.3842 2.7115
QuantileBeta(0.15, 0.00500, 2.69709) = 9.291632e-161 2000 rounds
YC 525.154426 1 1.1815 473 | 7/11
24 h-m-p 1.6000 8.0000 0.1658 YC 525.154370 1 1.1059 488 | 7/11
25 h-m-p 1.6000 8.0000 0.0890 ++ 525.154368 m 8.0000 506 | 7/11
26 h-m-p 0.5791 8.0000 1.2296
QuantileBeta(0.15, 0.00500, 2.34177) = 1.104453e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42990) = 6.994611e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.99004) = 3.171088e-161 2000 rounds
+ 525.154342 m 8.0000 524
QuantileBeta(0.15, 0.00500, 6.99004) = 3.171088e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.99004) = 3.171088e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.99004) = 3.171088e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.99004) = 3.171088e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.99004) = 3.171088e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.99004) = 3.171088e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.99004) = 3.171088e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.99004) = 3.171088e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.99004) = 3.281789e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.99005) = 3.171086e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.99004) = 3.171088e-161 2000 rounds
| 7/11
27 h-m-p 1.1155 5.5776 8.1553
QuantileBeta(0.15, 0.00500, 11.61644) = 1.852853e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 25.49563) = 8.243544e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 30.12203) = 6.956302e-162 2000 rounds
+ 525.154109 m 5.5776 538
QuantileBeta(0.15, 0.00500, 30.12203) = 6.956302e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.12203) = 6.956302e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.12203) = 6.956302e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.12203) = 6.956302e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.12203) = 6.956302e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.12203) = 6.956302e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.12203) = 6.956302e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.12203) = 6.956302e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.12203) = 7.199144e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.12205) = 6.956298e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 30.12203) = 6.956302e-162 2000 rounds
| 8/11
28 h-m-p 0.0661 0.3307 91.0703
QuantileBeta(0.15, 0.00500, 24.09863) = 8.731429e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721054e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 15.06261) = 1.414658e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 10.54497) = 2.050287e-161 2000 rounds
Y 525.154080 1 0.2646 554
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721054e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721054e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721054e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721054e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721054e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721054e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721054e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721054e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.02841) = 3.850955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721052e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721054e-161 2000 rounds
| 8/11
29 h-m-p 0.0182 0.0910 66.1975
QuantileBeta(0.15, 0.00500, 4.82373) = 4.753170e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.01667) = 8.128565e-161 2000 rounds
Y 525.154076 0 0.0728 569 | 8/11
30 h-m-p 1.4538 8.0000 3.3146
QuantileBeta(0.15, 0.00500, 6.02841) = 3.721054e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 20.48458) = 1.030993e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.33444) = 4.253159e-161 2000 rounds
C 525.154045 0 1.2444 583
QuantileBeta(0.15, 0.00500, 5.33444) = 4.253159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.33444) = 4.253159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.33444) = 4.253159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.33444) = 4.253159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.33444) = 4.253159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.33444) = 4.253159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.33444) = 4.253159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.33444) = 4.253159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.33444) = 4.401635e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.33445) = 4.253156e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.33444) = 4.253159e-161 2000 rounds
| 8/11
31 h-m-p 1.6000 8.0000 0.0385
QuantileBeta(0.15, 0.00500, 5.27290) = 4.307773e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.08828) = 4.480353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
Y 525.154045 0 1.0742 597
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.439422e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29332) = 4.289500e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29294) = 4.289842e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.29313) = 4.289671e-161 2000 rounds
| 8/11
32 h-m-p 0.3854 8.0000 0.1072
QuantileBeta(0.15, 0.00500, 5.33444) = 4.253159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.45839) = 4.147253e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.95418) = 3.771531e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
+ 525.154045 m 8.0000 615
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15084) = 3.767775e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15105) = 3.640546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15063) = 3.640814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15084) = 3.640680e-161 2000 rounds
| 8/11
33 h-m-p 0.9466 8.0000 0.9061
QuantileBeta(0.15, 0.00500, 7.00854) = 3.162094e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.58167) = 2.267496e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
+ 525.154045 m 8.0000 632
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39959) = 1.652664e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39992) = 1.596874e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39925) = 1.596957e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.39959) = 1.596916e-161 2000 rounds
| 8/11
34 h-m-p 1.6000 8.0000 1.5052
QuantileBeta(0.15, 0.00500, 15.80783) = 1.345825e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 23.03258) = 9.144413e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 25.44083) = 8.261655e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45054) = 1.087229e-161 2000 rounds
Y 525.154045 0 4.0202 650
QuantileBeta(0.15, 0.00500, 19.45054) = 1.087229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45054) = 1.087229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45054) = 1.087229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45054) = 1.087229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45054) = 1.087229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45054) = 1.087229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45054) = 1.087229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45054) = 1.087229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45054) = 1.125184e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45055) = 1.087229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45054) = 1.087229e-161 2000 rounds
| 8/11
35 h-m-p 0.5488 2.7441 7.0863
QuantileBeta(0.15, 0.00500, 15.56143) = 1.367831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.47827) = 1.146005e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 19.20747) = 1.101351e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 19.38978) = 1.090726e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 19.43535) = 1.088101e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 19.44674) = 1.087447e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 19.44959) = 1.087284e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 19.45031) = 1.087243e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 19.45048) = 1.087233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45042) = 1.087236e-161 2000 rounds
Y 525.154045 0 0.0000 671
QuantileBeta(0.15, 0.00500, 19.45048) = 1.087233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45048) = 1.087233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45048) = 1.087233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45048) = 1.087233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45048) = 1.087233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45048) = 1.087233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45048) = 1.087233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45048) = 1.087233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45048) = 1.125188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45049) = 1.087232e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45048) = 1.087233e-161 2000 rounds
| 8/11
36 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 19.45053) = 1.087230e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45068) = 1.087221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
Y 525.154045 0 0.8287 685
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.125186e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45093) = 1.087207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45009) = 1.087256e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
| 8/11
37 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45050) = 1.087232e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 19.45050) = 1.087232e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087232e-161 2000 rounds
Y 525.154045 0 4.4294 703
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087232e-161 2000 rounds
Out..
lnL = -525.154045
704 lfun, 8448 eigenQcodon, 46464 P(t)
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087232e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -526.036833 S = -523.401720 -2.518972
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 46 patterns 0:20
did 20 / 46 patterns 0:21
did 30 / 46 patterns 0:21
did 40 / 46 patterns 0:21
did 46 / 46 patterns 0:21
QuantileBeta(0.15, 0.00500, 19.45051) = 1.087232e-161 2000 rounds
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=132
NC_011896_1_WP_010907949_1_864_MLBR_RS04035 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
NC_002677_1_NP_301625_1_497_furB MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480 -MTGASVRSTRQRAAISTLLETVDDFRSAQEFHNELRRRGNNISLTTVYR
NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555 -MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
******************************:******************
NC_011896_1_WP_010907949_1_864_MLBR_RS04035 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
NC_002677_1_NP_301625_1_497_furB TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
**************************************************
NC_011896_1_WP_010907949_1_864_MLBR_RS04035 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
NC_002677_1_NP_301625_1_497_furB EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRSo
NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRSo
*******************************
>NC_011896_1_WP_010907949_1_864_MLBR_RS04035 ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC--- >NC_002677_1_NP_301625_1_497_furB ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC--- >NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100 ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC--- >NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120 ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC--- >NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480 ---ATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGTTTCACA ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC--- >NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555 ---ATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>NC_011896_1_WP_010907949_1_864_MLBR_RS04035 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS >NC_002677_1_NP_301625_1_497_furB MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS >NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS >NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS >NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480 -MTGASVRSTRQRAAISTLLETVDDFRSAQEFHNELRRRGNNISLTTVYR TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS >NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555 -MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
#NEXUS
[ID: 0247538408]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907949_1_864_MLBR_RS04035
NC_002677_1_NP_301625_1_497_furB
NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100
NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120
NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480
NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907949_1_864_MLBR_RS04035,
2 NC_002677_1_NP_301625_1_497_furB,
3 NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100,
4 NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120,
5 NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480,
6 NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06029756,2:0.0628541,3:0.06416858,4:0.06359088,5:0.1103499,6:0.06224664);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06029756,2:0.0628541,3:0.06416858,4:0.06359088,5:0.1103499,6:0.06224664);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -550.16 -554.23
2 -550.34 -553.97
--------------------------------------
TOTAL -550.25 -554.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882840 0.087792 0.342662 1.449246 0.857879 1347.55 1379.10 1.001
r(A<->C){all} 0.145022 0.016534 0.000106 0.410633 0.108185 194.90 203.70 1.002
r(A<->G){all} 0.163274 0.020110 0.000063 0.457208 0.124344 166.45 178.68 1.002
r(A<->T){all} 0.168053 0.020015 0.000033 0.451342 0.129457 184.56 259.89 1.000
r(C<->G){all} 0.136815 0.016731 0.000144 0.409440 0.097218 173.53 242.45 1.000
r(C<->T){all} 0.220775 0.027864 0.000001 0.556096 0.184900 176.27 256.75 1.007
r(G<->T){all} 0.166061 0.021122 0.000117 0.451856 0.124821 214.90 239.47 1.000
pi(A){all} 0.222412 0.000432 0.182565 0.264175 0.221936 1364.33 1413.20 1.000
pi(C){all} 0.312794 0.000544 0.264691 0.355730 0.312377 1166.77 1266.49 1.000
pi(G){all} 0.280344 0.000501 0.234830 0.323384 0.279985 1233.30 1332.94 1.000
pi(T){all} 0.184450 0.000378 0.147642 0.221054 0.183354 1199.19 1270.66 1.000
alpha{1,2} 0.328173 0.151017 0.000121 1.009211 0.210145 1038.18 1248.04 1.000
alpha{3} 0.407229 0.226512 0.000209 1.332854 0.237479 1165.01 1181.79 1.001
pinvar{all} 0.990873 0.000064 0.975786 0.999760 0.992935 1328.06 1414.53 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/furB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 130
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 2 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 2 2 2 2 2 2
TTC 2 2 2 2 2 2 | TCC 4 4 4 4 4 4 | TAC 2 2 2 2 2 2 | TGC 3 3 3 3 3 3
Leu TTA 0 0 0 0 0 0 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 0 1 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 2 2 2 2 2 2
CTC 0 0 0 0 0 0 | CCC 0 0 0 0 0 0 | CAC 5 5 5 5 5 5 | CGC 7 7 7 7 7 7
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 2 2 2 2 2 2
CTG 4 4 4 4 4 4 | CCG 0 0 0 0 0 0 | CAG 2 2 2 2 2 2 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 8 8 8 8 8 8 | AAC 2 2 2 2 2 2 | AGC 3 3 3 3 3 3
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 3 3 3 3 3 3 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 0 0 0 0 0 0 | Asp GAT 1 1 1 1 1 1 | Gly GGT 2 2 2 2 2 2
GTC 7 7 7 7 7 7 | GCC 4 4 4 4 4 4 | GAC 4 4 4 4 4 4 | GGC 4 4 4 4 4 4
GTA 0 0 0 0 0 0 | GCA 4 4 4 4 4 4 | Glu GAA 5 5 5 5 5 5 | GGA 3 3 3 3 3 3
GTG 2 2 2 2 2 2 | GCG 3 3 3 3 3 3 | GAG 6 6 6 6 6 6 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907949_1_864_MLBR_RS04035
position 1: T:0.18462 C:0.22308 A:0.23846 G:0.35385
position 2: T:0.22308 C:0.26154 A:0.26923 G:0.24615
position 3: T:0.13846 C:0.45385 A:0.16154 G:0.24615
Average T:0.18205 C:0.31282 A:0.22308 G:0.28205
#2: NC_002677_1_NP_301625_1_497_furB
position 1: T:0.18462 C:0.22308 A:0.23846 G:0.35385
position 2: T:0.22308 C:0.26154 A:0.26923 G:0.24615
position 3: T:0.13846 C:0.45385 A:0.16154 G:0.24615
Average T:0.18205 C:0.31282 A:0.22308 G:0.28205
#3: NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100
position 1: T:0.18462 C:0.22308 A:0.23846 G:0.35385
position 2: T:0.22308 C:0.26154 A:0.26923 G:0.24615
position 3: T:0.13846 C:0.45385 A:0.16154 G:0.24615
Average T:0.18205 C:0.31282 A:0.22308 G:0.28205
#4: NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120
position 1: T:0.18462 C:0.22308 A:0.23846 G:0.35385
position 2: T:0.22308 C:0.26154 A:0.26923 G:0.24615
position 3: T:0.13846 C:0.45385 A:0.16154 G:0.24615
Average T:0.18205 C:0.31282 A:0.22308 G:0.28205
#5: NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480
position 1: T:0.19231 C:0.21538 A:0.23846 G:0.35385
position 2: T:0.22308 C:0.26154 A:0.26923 G:0.24615
position 3: T:0.13846 C:0.45385 A:0.16154 G:0.24615
Average T:0.18462 C:0.31026 A:0.22308 G:0.28205
#6: NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555
position 1: T:0.18462 C:0.22308 A:0.23846 G:0.35385
position 2: T:0.22308 C:0.26154 A:0.26923 G:0.24615
position 3: T:0.13846 C:0.45385 A:0.16154 G:0.24615
Average T:0.18205 C:0.31282 A:0.22308 G:0.28205
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 7 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 12
TTC 12 | TCC 24 | TAC 12 | TGC 18
Leu L TTA 0 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 5 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 12
CTC 0 | CCC 0 | CAC 30 | CGC 42
CTA 0 | CCA 0 | Gln Q CAA 12 | CGA 12
CTG 24 | CCG 0 | CAG 12 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 0
ATC 24 | ACC 48 | AAC 12 | AGC 18
ATA 6 | ACA 0 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 18 | ACG 18 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 0 | Asp D GAT 6 | Gly G GGT 12
GTC 42 | GCC 24 | GAC 24 | GGC 24
GTA 0 | GCA 24 | Glu E GAA 30 | GGA 18
GTG 12 | GCG 18 | GAG 36 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18590 C:0.22179 A:0.23846 G:0.35385
position 2: T:0.22308 C:0.26154 A:0.26923 G:0.24615
position 3: T:0.13846 C:0.45385 A:0.16154 G:0.24615
Average T:0.18248 C:0.31239 A:0.22308 G:0.28205
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -525.651831 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.007862 0.000004 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.007882
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.007862, 6: 0.000004);
(NC_011896_1_WP_010907949_1_864_MLBR_RS04035: 0.000004, NC_002677_1_NP_301625_1_497_furB: 0.000004, NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100: 0.000004, NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120: 0.000004, NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480: 0.007862, NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 290.3 99.7 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 290.3 99.7 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 290.3 99.7 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 290.3 99.7 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.008 290.3 99.7 999.0000 0.0035 0.0000 1.0 0.0
7..6 0.000 290.3 99.7 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0035
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -525.952952 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.007809 0.000004 951.428575 0.000010 0.361052
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.007829
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.007809, 6: 0.000004);
(NC_011896_1_WP_010907949_1_864_MLBR_RS04035: 0.000004, NC_002677_1_NP_301625_1_497_furB: 0.000004, NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100: 0.000004, NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120: 0.000004, NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480: 0.007809, NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42858
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.36105 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 290.3 99.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 290.3 99.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 290.3 99.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 290.3 99.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.008 290.3 99.7 1.0000 0.0026 0.0026 0.8 0.3
7..6 0.000 290.3 99.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -525.154045 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.036222 0.000004 999.000000 0.988559 0.000000 0.000001 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.036242
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.036222, 6: 0.000004);
(NC_011896_1_WP_010907949_1_864_MLBR_RS04035: 0.000004, NC_002677_1_NP_301625_1_497_furB: 0.000004, NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100: 0.000004, NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120: 0.000004, NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480: 0.036222, NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
MLEs of dN/dS (w) for site classes (K=3)
p: 0.98856 0.00000 0.01144
w: 0.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 290.3 99.7 11.4298 0.0000 0.0000 0.0 0.0
7..2 0.000 290.3 99.7 11.4298 0.0000 0.0000 0.0 0.0
7..3 0.000 290.3 99.7 11.4298 0.0000 0.0000 0.0 0.0
7..4 0.000 290.3 99.7 11.4298 0.0000 0.0000 0.0 0.0
7..5 0.036 290.3 99.7 11.4298 0.0157 0.0014 4.6 0.1
7..6 0.000 290.3 99.7 11.4298 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907949_1_864_MLBR_RS04035)
Pr(w>1) post mean +- SE for w
31 L 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907949_1_864_MLBR_RS04035)
Pr(w>1) post mean +- SE for w
31 L 0.687 4.619 +- 3.384
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.096 0.097 0.098 0.099 0.100 0.101 0.102 0.102 0.103 0.104
w2: 0.085 0.097 0.104 0.106 0.107 0.106 0.103 0.101 0.097 0.094
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.009
0.011 0.010 0.009
0.011 0.011 0.011 0.010 0.009
0.011 0.011 0.011 0.011 0.011 0.009 0.009
0.011 0.011 0.011 0.011 0.011 0.011 0.010 0.009 0.008
0.010 0.011 0.011 0.011 0.011 0.011 0.011 0.011 0.010 0.009 0.008
0.010 0.010 0.010 0.011 0.011 0.011 0.011 0.011 0.011 0.011 0.010 0.009 0.008
0.009 0.009 0.010 0.010 0.010 0.011 0.011 0.011 0.011 0.011 0.011 0.010 0.010 0.008 0.007
0.008 0.009 0.009 0.009 0.010 0.010 0.010 0.011 0.011 0.011 0.011 0.011 0.011 0.010 0.010 0.008 0.007
0.008 0.008 0.008 0.009 0.009 0.009 0.010 0.010 0.010 0.011 0.011 0.011 0.011 0.011 0.011 0.010 0.009 0.008 0.007
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -525.952951 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.007809 0.000004 951.428593 3.127356 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.007829
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.007809, 6: 0.000004);
(NC_011896_1_WP_010907949_1_864_MLBR_RS04035: 0.000004, NC_002677_1_NP_301625_1_497_furB: 0.000004, NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100: 0.000004, NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120: 0.000004, NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480: 0.007809, NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42859
Parameters in M7 (beta):
p = 3.12736 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 290.3 99.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 290.3 99.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 290.3 99.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 290.3 99.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.008 290.3 99.7 1.0000 0.0026 0.0026 0.8 0.3
7..6 0.000 290.3 99.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -525.154045 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.036223 0.000004 999.000000 0.988559 0.005000 19.450506 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.036243
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.036223, 6: 0.000004);
(NC_011896_1_WP_010907949_1_864_MLBR_RS04035: 0.000004, NC_002677_1_NP_301625_1_497_furB: 0.000004, NZ_LVXE01000097_1_WP_010907949_1_2928_A3216_RS14100: 0.000004, NZ_LYPH01000103_1_WP_010907949_1_2920_A8144_RS14120: 0.000004, NZ_CP029543_1_WP_111481133_1_882_DIJ64_RS04480: 0.036223, NZ_AP014567_1_WP_119607924_1_897_JK2ML_RS04555: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M8 (beta&w>1):
p0 = 0.98856 p = 0.00500 q = 19.45051
(p1 = 0.01144) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09886 0.09886 0.09886 0.09886 0.09886 0.09886 0.09886 0.09886 0.09886 0.09886 0.01144
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 290.3 99.7 11.4300 0.0000 0.0000 0.0 0.0
7..2 0.000 290.3 99.7 11.4300 0.0000 0.0000 0.0 0.0
7..3 0.000 290.3 99.7 11.4300 0.0000 0.0000 0.0 0.0
7..4 0.000 290.3 99.7 11.4300 0.0000 0.0000 0.0 0.0
7..5 0.036 290.3 99.7 11.4300 0.0158 0.0014 4.6 0.1
7..6 0.000 290.3 99.7 11.4300 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907949_1_864_MLBR_RS04035)
Pr(w>1) post mean +- SE for w
31 L 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907949_1_864_MLBR_RS04035)
Pr(w>1) post mean +- SE for w
31 L 0.841 5.107 +- 3.154
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.081 0.088 0.095 0.102 0.109 0.114 0.117 0.114 0.103 0.076
p : 0.095 0.098 0.099 0.100 0.100 0.101 0.101 0.102 0.102 0.102
q : 0.104 0.102 0.101 0.100 0.100 0.099 0.099 0.098 0.098 0.098
ws: 0.089 0.106 0.113 0.113 0.110 0.105 0.099 0.093 0.087 0.082
Time used: 0:21
Model 1: NearlyNeutral -525.952952 Model 2: PositiveSelection -525.154045 Model 0: one-ratio -525.651831 Model 7: beta -525.952951 Model 8: beta&w>1 -525.154045 Model 0 vs 1 0.6022419999999329 Model 2 vs 1 1.5978139999999712 Model 8 vs 7 1.5978119999999763
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
