--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:24:32 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/furB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -550.16 -554.23
2 -550.34 -553.97
--------------------------------------
TOTAL -550.25 -554.11
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882840 0.087792 0.342662 1.449246 0.857879 1347.55 1379.10 1.001
r(A<->C){all} 0.145022 0.016534 0.000106 0.410633 0.108185 194.90 203.70 1.002
r(A<->G){all} 0.163274 0.020110 0.000063 0.457208 0.124344 166.45 178.68 1.002
r(A<->T){all} 0.168053 0.020015 0.000033 0.451342 0.129457 184.56 259.89 1.000
r(C<->G){all} 0.136815 0.016731 0.000144 0.409440 0.097218 173.53 242.45 1.000
r(C<->T){all} 0.220775 0.027864 0.000001 0.556096 0.184900 176.27 256.75 1.007
r(G<->T){all} 0.166061 0.021122 0.000117 0.451856 0.124821 214.90 239.47 1.000
pi(A){all} 0.222412 0.000432 0.182565 0.264175 0.221936 1364.33 1413.20 1.000
pi(C){all} 0.312794 0.000544 0.264691 0.355730 0.312377 1166.77 1266.49 1.000
pi(G){all} 0.280344 0.000501 0.234830 0.323384 0.279985 1233.30 1332.94 1.000
pi(T){all} 0.184450 0.000378 0.147642 0.221054 0.183354 1199.19 1270.66 1.000
alpha{1,2} 0.328173 0.151017 0.000121 1.009211 0.210145 1038.18 1248.04 1.000
alpha{3} 0.407229 0.226512 0.000209 1.332854 0.237479 1165.01 1181.79 1.001
pinvar{all} 0.990873 0.000064 0.975786 0.999760 0.992935 1328.06 1414.53 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -525.952952
Model 2: PositiveSelection -525.154045
Model 0: one-ratio -525.651831
Model 7: beta -525.952951
Model 8: beta&w>1 -525.154045
Model 0 vs 1 0.6022419999999329
Model 2 vs 1 1.5978139999999712
Model 8 vs 7 1.5978119999999763
>C1
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C2
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C3
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C4
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C5
MTGASVRSTRQRAAISTLLETVDDFRSAQEFHNELRRRGNNISLTTVYRT
LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
AWAAEVAAKHGFSDVSHTIEIFGTCSECRSo
>C6
MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
AWAAEVAAKHGFSDVSHTIEIFGTCSECRSo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=132
C1 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
C2 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
C3 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
C4 MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
C5 -MTGASVRSTRQRAAISTLLETVDDFRSAQEFHNELRRRGNNISLTTVYR
C6 -MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
******************************:******************
C1 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
C2 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
C3 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
C4 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
C5 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
C6 TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
**************************************************
C1 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
C2 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
C3 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
C4 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS-
C5 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRSo
C6 EAWAAEVAAKHGFSDVSHTIEIFGTCSECRSo
*******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 131 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 131 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3978]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3978]--->[3978]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.452 Mb, Max= 30.652 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
C2 MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
C3 MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
C4 MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
C5 MTGASVRSTRQRAAISTLLETVDDFRSAQEFHNELRRRGNNISLTTVYRT
C6 MTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYRT
******************************:*******************
C1 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
C2 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
C3 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
C4 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
C5 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
C6 LQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEVE
**************************************************
C1 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
C2 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
C3 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
C4 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
C5 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
C6 AWAAEVAAKHGFSDVSHTIEIFGTCSECRS
******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 99.23 C1 C5 99.23
TOP 4 0 99.23 C5 C1 99.23
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 99.23 C2 C5 99.23
TOP 4 1 99.23 C5 C2 99.23
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.23 C3 C5 99.23
TOP 4 2 99.23 C5 C3 99.23
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 99.23 C4 C5 99.23
TOP 4 3 99.23 C5 C4 99.23
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 99.24 C5 C6 99.24
TOP 5 4 99.24 C6 C5 99.24
AVG 0 C1 * 99.85
AVG 1 C2 * 99.85
AVG 2 C3 * 99.85
AVG 3 C4 * 99.85
AVG 4 C5 * 99.23
AVG 5 C6 * 99.85
TOT TOT * 99.74
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
C2 ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
C3 ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
C4 ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
C5 ---ATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
C6 ---ATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
***********************************************
C1 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
C2 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
C3 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
C4 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
C5 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGTTTCACA
C6 AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
******************************************* ******
C1 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
C2 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
C3 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
C4 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
C5 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
C6 ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
**************************************************
C1 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
C2 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
C3 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
C4 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
C5 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
C6 ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
**************************************************
C1 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
C2 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
C3 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
C4 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
C5 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
C6 CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
**************************************************
C1 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
C2 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
C3 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
C4 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
C5 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
C6 TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
**************************************************
C1 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
C2 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
C3 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
C4 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
C5 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
C6 GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
**************************************************
C1 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
C2 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
C3 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
C4 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
C5 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
C6 CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
*******************************************
>C1
ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C2
ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C3
ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C4
ATGATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C5
---ATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGTTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C6
---ATGACTGGAGCCAGCGTCCGTTCCACCCGACAACGCGCGGCAATATC
AACGCTGTTGGAGACGGTCGATGACTTCCGCTCAGCCCAGGAGCTTCACA
ACGAGCTGCGCCGCCGCGGCAATAATATCAGCTTGACCACCGTCTACCGT
ACCCTGCAATCGATGGCAGAGGCGGGAATGGTCGACACGTTGCGCACCAA
CACCGGTGAATCGGTCTACCGCAGATGTTCCAGGCAGCATCACCACCATC
TGGTGTGCCGAGGCTGCGGTTCCACTATCGAGGTCGGCGACCACGAAGTC
GAGGCATGGGCGGCAGAAGTGGCCGCCAAGCATGGATTCTCTGACGTTAG
CCACACCATCGAAATCTTTGGCACCTGCTCAGAATGTCGGTCC---
>C1
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C2
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C3
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C4
MMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C5
oMTGASVRSTRQRAAISTLLETVDDFRSAQEFHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
>C6
oMTGASVRSTRQRAAISTLLETVDDFRSAQELHNELRRRGNNISLTTVYR
TLQSMAEAGMVDTLRTNTGESVYRRCSRQHHHHLVCRGCGSTIEVGDHEV
EAWAAEVAAKHGFSDVSHTIEIFGTCSECRS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 396 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789376
Setting output file names to "/data/2res/furB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 888400249
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0247538408
Seed = 2048378856
Swapseed = 1579789376
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 7 unique site patterns
Division 2 has 6 unique site patterns
Division 3 has 6 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -882.113382 -- -24.965149
Chain 2 -- -882.382161 -- -24.965149
Chain 3 -- -882.369513 -- -24.965149
Chain 4 -- -882.379803 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -882.382161 -- -24.965149
Chain 2 -- -882.368708 -- -24.965149
Chain 3 -- -882.382211 -- -24.965149
Chain 4 -- -882.368708 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-882.113] (-882.382) (-882.370) (-882.380) * [-882.382] (-882.369) (-882.382) (-882.369)
500 -- [-558.236] (-560.032) (-560.401) (-555.905) * (-558.655) (-564.314) [-552.674] (-557.428) -- 0:00:00
1000 -- (-555.845) (-558.802) [-555.879] (-563.887) * (-555.838) (-558.115) (-557.892) [-560.027] -- 0:00:00
1500 -- (-554.384) [-558.288] (-556.871) (-557.186) * (-553.132) (-555.339) (-558.049) [-551.550] -- 0:00:00
2000 -- (-556.616) (-556.160) [-553.206] (-550.206) * (-557.961) (-559.811) [-553.338] (-562.011) -- 0:00:00
2500 -- (-568.787) (-553.772) [-551.897] (-556.850) * (-554.981) [-552.008] (-555.608) (-555.623) -- 0:00:00
3000 -- (-567.720) [-557.903] (-553.060) (-557.678) * (-555.831) [-554.391] (-557.070) (-551.730) -- 0:00:00
3500 -- [-554.791] (-553.217) (-553.935) (-555.032) * [-557.095] (-554.741) (-558.614) (-555.021) -- 0:00:00
4000 -- [-557.463] (-568.150) (-556.428) (-550.119) * (-552.500) [-557.599] (-553.037) (-562.669) -- 0:00:00
4500 -- [-557.523] (-557.933) (-558.749) (-554.398) * (-551.619) (-561.197) [-555.932] (-558.579) -- 0:03:41
5000 -- [-561.272] (-555.797) (-560.293) (-552.553) * (-560.836) (-555.390) [-556.318] (-553.642) -- 0:03:19
Average standard deviation of split frequencies: 0.082309
5500 -- (-554.402) (-558.126) [-560.311] (-565.903) * (-559.388) [-563.207] (-550.857) (-560.547) -- 0:03:00
6000 -- (-559.844) (-558.161) [-555.502] (-557.778) * (-555.695) (-552.570) (-553.823) [-553.610] -- 0:02:45
6500 -- (-556.542) [-561.538] (-560.448) (-565.512) * [-553.377] (-559.355) (-560.627) (-558.804) -- 0:02:32
7000 -- [-561.395] (-553.955) (-561.132) (-552.549) * (-553.173) (-555.543) (-562.002) [-556.329] -- 0:02:21
7500 -- [-558.970] (-552.191) (-553.303) (-559.123) * [-552.708] (-552.797) (-560.662) (-556.779) -- 0:02:12
8000 -- [-555.115] (-549.194) (-561.652) (-563.462) * [-557.120] (-564.094) (-552.397) (-558.230) -- 0:02:04
8500 -- (-552.117) (-558.642) (-556.769) [-558.755] * [-553.039] (-551.865) (-556.277) (-555.411) -- 0:01:56
9000 -- (-553.511) [-562.696] (-557.124) (-555.580) * (-555.072) [-559.171] (-557.425) (-557.838) -- 0:01:50
9500 -- (-553.528) (-554.828) (-561.336) [-550.948] * (-561.729) [-555.320] (-557.534) (-564.390) -- 0:01:44
10000 -- (-562.128) (-553.478) [-552.078] (-563.111) * (-559.087) [-561.284] (-557.464) (-554.865) -- 0:01:39
Average standard deviation of split frequencies: 0.079970
10500 -- (-552.523) (-554.369) [-553.491] (-553.186) * (-563.615) (-561.702) [-556.281] (-559.345) -- 0:01:34
11000 -- (-555.293) (-555.250) (-556.830) [-549.328] * (-561.256) (-559.288) [-552.328] (-551.658) -- 0:01:29
11500 -- (-560.250) (-552.425) [-554.285] (-553.378) * (-554.365) (-562.936) (-557.043) [-555.055] -- 0:01:25
12000 -- (-556.631) [-553.929] (-552.910) (-559.005) * (-557.584) (-551.992) [-557.666] (-553.344) -- 0:01:22
12500 -- (-555.171) (-551.715) [-551.136] (-563.602) * (-559.315) [-557.737] (-559.112) (-557.178) -- 0:01:19
13000 -- (-562.762) [-554.355] (-553.126) (-555.030) * [-566.477] (-553.862) (-560.464) (-563.193) -- 0:01:15
13500 -- (-555.242) [-560.401] (-555.085) (-558.456) * (-560.109) (-558.454) (-557.543) [-551.375] -- 0:01:13
14000 -- (-558.502) (-557.642) (-555.342) [-555.483] * [-557.572] (-555.472) (-573.425) (-552.344) -- 0:01:10
14500 -- [-553.261] (-551.007) (-552.530) (-567.723) * [-556.196] (-555.897) (-560.765) (-551.636) -- 0:01:07
15000 -- (-559.426) (-549.229) [-549.813] (-563.013) * (-550.788) [-559.060] (-569.287) (-551.706) -- 0:01:05
Average standard deviation of split frequencies: 0.073657
15500 -- [-553.133] (-549.146) (-558.663) (-557.920) * (-553.955) [-552.827] (-568.938) (-550.422) -- 0:01:03
16000 -- [-555.634] (-552.589) (-557.672) (-555.505) * [-552.900] (-562.163) (-556.045) (-551.731) -- 0:01:01
16500 -- (-555.746) [-551.997] (-558.313) (-569.730) * (-569.134) (-550.492) (-563.764) [-552.779] -- 0:00:59
17000 -- (-553.984) [-549.493] (-556.656) (-557.641) * (-556.121) [-560.026] (-557.334) (-551.440) -- 0:00:57
17500 -- (-559.783) [-549.575] (-555.459) (-559.293) * (-565.890) (-552.087) (-557.536) [-551.373] -- 0:01:52
18000 -- (-559.543) (-551.388) [-557.716] (-557.222) * [-563.311] (-554.549) (-558.641) (-553.711) -- 0:01:49
18500 -- [-553.197] (-552.135) (-558.678) (-551.819) * [-557.185] (-557.706) (-561.053) (-549.686) -- 0:01:46
19000 -- [-551.497] (-552.649) (-553.986) (-552.833) * [-557.274] (-554.777) (-559.853) (-551.324) -- 0:01:43
19500 -- [-554.706] (-551.650) (-560.690) (-568.746) * [-556.230] (-561.433) (-558.702) (-549.408) -- 0:01:40
20000 -- (-554.403) [-551.971] (-554.901) (-565.597) * [-553.541] (-551.956) (-555.740) (-551.027) -- 0:01:38
Average standard deviation of split frequencies: 0.068430
20500 -- (-556.589) (-549.975) (-565.802) [-555.042] * (-557.229) (-551.096) [-552.245] (-552.804) -- 0:01:35
21000 -- (-556.020) (-551.739) [-549.301] (-558.232) * [-556.742] (-554.502) (-555.740) (-554.897) -- 0:01:33
21500 -- (-557.712) [-550.379] (-562.733) (-573.030) * (-556.817) (-558.272) [-554.227] (-551.602) -- 0:01:31
22000 -- (-560.837) (-551.829) (-563.790) [-555.308] * (-566.333) (-554.899) [-556.166] (-549.795) -- 0:01:28
22500 -- (-554.499) [-550.545] (-552.036) (-560.150) * (-555.456) (-551.989) [-555.147] (-551.761) -- 0:01:26
23000 -- (-567.049) (-553.438) (-556.309) [-553.016] * [-553.415] (-551.676) (-559.292) (-551.567) -- 0:01:24
23500 -- (-566.680) (-549.647) (-557.865) [-551.548] * (-556.257) (-554.455) [-560.265] (-551.950) -- 0:01:23
24000 -- (-558.698) (-550.642) [-552.494] (-562.029) * [-552.563] (-551.581) (-558.343) (-550.235) -- 0:01:21
24500 -- [-560.652] (-548.892) (-554.541) (-563.175) * (-555.935) [-549.509] (-558.021) (-554.519) -- 0:01:19
25000 -- (-556.359) (-550.050) (-557.246) [-549.075] * (-557.063) (-554.335) [-553.917] (-551.308) -- 0:01:18
Average standard deviation of split frequencies: 0.047486
25500 -- (-554.682) (-553.862) (-567.466) [-552.754] * (-555.601) (-551.781) [-554.213] (-550.276) -- 0:01:16
26000 -- (-552.241) [-551.789] (-555.388) (-558.579) * (-560.043) (-550.749) [-551.167] (-552.521) -- 0:01:14
26500 -- (-561.285) (-553.495) [-553.109] (-553.372) * (-558.852) (-549.330) (-557.438) [-550.978] -- 0:01:13
27000 -- (-554.763) [-552.226] (-561.888) (-551.014) * (-554.360) (-550.321) [-559.028] (-553.366) -- 0:01:12
27500 -- (-565.238) (-549.823) [-563.499] (-553.124) * (-554.636) [-550.675] (-553.774) (-553.629) -- 0:01:10
28000 -- (-556.771) (-549.924) [-554.989] (-553.084) * [-558.367] (-549.043) (-555.956) (-555.948) -- 0:01:09
28500 -- (-557.737) (-549.910) [-556.353] (-552.019) * (-561.477) (-550.226) [-559.135] (-551.868) -- 0:01:08
29000 -- (-557.243) (-550.067) [-558.550] (-550.804) * (-559.259) (-549.721) (-567.898) [-552.966] -- 0:01:06
29500 -- (-555.406) (-553.126) (-566.237) [-551.577] * (-560.601) (-551.494) [-555.980] (-551.588) -- 0:01:05
30000 -- (-556.630) (-550.053) (-563.037) [-550.901] * (-555.147) (-555.155) [-553.421] (-555.230) -- 0:01:04
Average standard deviation of split frequencies: 0.043689
30500 -- (-559.933) (-550.655) (-556.234) [-549.119] * (-555.417) (-551.241) (-556.095) [-552.840] -- 0:01:35
31000 -- (-556.849) (-551.554) (-555.073) [-551.554] * (-559.875) (-551.414) [-558.737] (-554.371) -- 0:01:33
31500 -- [-555.034] (-552.708) (-555.758) (-549.956) * (-554.437) [-549.367] (-562.017) (-550.039) -- 0:01:32
32000 -- [-551.168] (-549.319) (-557.328) (-551.151) * (-558.836) [-550.538] (-566.103) (-548.793) -- 0:01:30
32500 -- (-550.568) [-549.819] (-559.771) (-553.099) * (-560.786) (-553.967) [-549.541] (-550.349) -- 0:01:29
33000 -- (-557.818) (-552.769) [-556.974] (-551.504) * (-561.965) [-550.057] (-552.482) (-549.323) -- 0:01:27
33500 -- (-562.550) (-553.433) [-554.581] (-550.539) * (-554.945) (-551.598) (-564.723) [-549.982] -- 0:01:26
34000 -- [-557.592] (-552.548) (-563.871) (-550.574) * (-566.401) (-551.159) (-558.041) [-550.236] -- 0:01:25
34500 -- (-557.287) (-551.415) (-560.361) [-551.514] * (-557.186) [-551.713] (-559.743) (-552.233) -- 0:01:23
35000 -- [-550.011] (-554.261) (-559.049) (-555.963) * (-561.353) (-554.459) [-554.568] (-551.043) -- 0:01:22
Average standard deviation of split frequencies: 0.045176
35500 -- [-562.123] (-556.905) (-559.859) (-553.423) * (-562.879) [-552.754] (-562.741) (-553.174) -- 0:01:21
36000 -- (-561.311) (-553.000) [-553.484] (-553.651) * (-551.639) [-553.997] (-553.036) (-552.861) -- 0:01:20
36500 -- (-552.294) [-550.179] (-564.714) (-551.858) * (-552.589) (-553.378) [-556.697] (-554.021) -- 0:01:19
37000 -- [-556.691] (-551.800) (-553.640) (-551.575) * (-553.835) (-552.659) [-557.396] (-555.149) -- 0:01:18
37500 -- (-555.146) [-552.418] (-552.823) (-551.695) * (-551.560) (-550.011) (-555.925) [-554.236] -- 0:01:17
38000 -- (-552.966) (-551.642) (-555.807) [-550.861] * (-550.009) (-555.026) (-557.448) [-551.691] -- 0:01:15
38500 -- [-549.888] (-551.581) (-554.466) (-552.767) * (-548.347) (-551.878) [-556.236] (-550.475) -- 0:01:14
39000 -- [-551.259] (-551.484) (-548.643) (-551.015) * [-550.020] (-550.922) (-562.636) (-550.118) -- 0:01:13
39500 -- (-557.191) (-549.159) [-548.994] (-550.614) * [-549.971] (-551.743) (-556.504) (-550.292) -- 0:01:12
40000 -- [-558.289] (-552.644) (-551.571) (-553.875) * [-552.723] (-551.965) (-564.190) (-552.968) -- 0:01:12
Average standard deviation of split frequencies: 0.049128
40500 -- [-558.789] (-551.718) (-550.976) (-553.169) * (-557.889) (-552.059) [-555.119] (-551.366) -- 0:01:11
41000 -- [-551.761] (-549.549) (-548.560) (-551.209) * (-558.684) (-551.790) (-559.803) [-552.796] -- 0:01:10
41500 -- (-557.609) [-549.645] (-554.883) (-552.566) * (-555.022) [-550.530] (-555.260) (-552.164) -- 0:01:09
42000 -- [-557.435] (-550.208) (-549.329) (-551.729) * [-549.767] (-553.450) (-557.071) (-551.366) -- 0:01:08
42500 -- [-552.692] (-552.840) (-550.137) (-551.388) * (-551.681) (-554.550) [-556.047] (-552.053) -- 0:01:07
43000 -- (-553.728) [-550.041] (-552.093) (-552.273) * (-555.213) (-550.620) (-562.090) [-550.068] -- 0:01:06
43500 -- [-552.677] (-550.147) (-548.699) (-551.459) * [-551.807] (-552.949) (-560.056) (-551.933) -- 0:01:05
44000 -- (-562.715) [-548.458] (-550.286) (-550.577) * [-550.657] (-550.999) (-556.372) (-551.232) -- 0:01:05
44500 -- (-560.650) (-550.268) [-550.156] (-557.773) * (-551.150) [-550.539] (-558.563) (-552.946) -- 0:01:25
45000 -- [-556.704] (-548.645) (-549.282) (-552.398) * (-553.585) (-551.260) [-553.285] (-551.042) -- 0:01:24
Average standard deviation of split frequencies: 0.039209
45500 -- [-551.149] (-550.094) (-549.422) (-551.823) * (-551.759) (-550.412) [-552.723] (-552.303) -- 0:01:23
46000 -- [-556.553] (-551.511) (-554.128) (-550.628) * (-550.531) (-550.559) (-554.780) [-552.867] -- 0:01:22
46500 -- (-561.775) (-550.377) [-551.972] (-550.919) * (-551.479) (-551.225) (-582.530) [-551.486] -- 0:01:22
47000 -- [-557.773] (-550.611) (-550.577) (-554.154) * (-550.748) [-550.491] (-583.235) (-552.240) -- 0:01:21
47500 -- (-554.300) [-550.436] (-553.382) (-554.243) * [-550.211] (-559.769) (-568.905) (-551.467) -- 0:01:20
48000 -- (-555.177) (-552.171) (-551.959) [-551.999] * [-548.811] (-555.736) (-568.921) (-550.410) -- 0:01:19
48500 -- (-549.291) [-549.759] (-549.003) (-553.333) * [-553.030] (-555.114) (-562.828) (-553.295) -- 0:01:18
49000 -- [-549.869] (-552.914) (-551.627) (-550.719) * (-551.205) [-554.145] (-550.390) (-555.168) -- 0:01:17
49500 -- (-555.828) (-552.779) [-547.662] (-550.946) * [-549.692] (-556.048) (-550.034) (-554.713) -- 0:01:16
50000 -- [-557.332] (-554.389) (-552.442) (-550.645) * [-550.235] (-551.679) (-551.034) (-557.396) -- 0:01:16
Average standard deviation of split frequencies: 0.034890
50500 -- (-558.408) [-551.449] (-550.614) (-552.022) * (-549.420) (-553.730) (-551.786) [-554.481] -- 0:01:15
51000 -- (-556.315) (-553.216) [-552.380] (-548.920) * (-553.646) (-550.974) (-551.225) [-554.035] -- 0:01:14
51500 -- [-554.687] (-553.287) (-551.606) (-556.907) * (-558.225) (-554.574) [-550.908] (-556.070) -- 0:01:13
52000 -- (-555.890) (-551.438) (-549.530) [-549.178] * (-551.786) (-553.650) (-550.787) [-552.747] -- 0:01:12
52500 -- (-552.048) (-551.504) [-552.524] (-549.273) * [-552.466] (-553.655) (-549.692) (-552.845) -- 0:01:12
53000 -- (-560.327) (-551.118) (-552.524) [-551.239] * [-549.207] (-552.540) (-550.978) (-551.314) -- 0:01:11
53500 -- (-554.887) [-550.386] (-555.010) (-549.240) * (-553.851) (-553.365) [-553.695] (-552.017) -- 0:01:10
54000 -- [-552.437] (-552.604) (-551.531) (-549.676) * (-551.763) (-557.797) [-551.916] (-551.795) -- 0:01:10
54500 -- [-557.446] (-550.882) (-551.914) (-552.763) * (-553.723) [-553.350] (-552.211) (-553.650) -- 0:01:09
55000 -- (-555.866) (-552.237) (-552.139) [-552.184] * (-548.376) (-554.547) (-552.538) [-552.420] -- 0:01:08
Average standard deviation of split frequencies: 0.032068
55500 -- (-560.791) [-550.528] (-551.217) (-555.239) * (-552.594) (-552.154) (-552.947) [-551.153] -- 0:01:08
56000 -- [-553.846] (-553.147) (-557.130) (-550.696) * [-549.314] (-551.644) (-550.506) (-550.625) -- 0:01:07
56500 -- [-556.700] (-554.055) (-554.644) (-552.539) * (-550.477) (-550.844) [-550.520] (-552.619) -- 0:01:06
57000 -- [-554.328] (-552.679) (-552.365) (-549.209) * (-557.322) (-550.636) (-554.578) [-552.387] -- 0:01:06
57500 -- (-551.437) (-552.568) (-552.306) [-551.281] * (-554.577) [-550.831] (-552.921) (-552.687) -- 0:01:05
58000 -- [-556.053] (-551.821) (-553.473) (-552.673) * (-552.556) [-551.795] (-553.478) (-551.906) -- 0:01:21
58500 -- (-561.352) [-552.405] (-555.416) (-550.044) * [-550.497] (-552.773) (-550.231) (-552.374) -- 0:01:20
59000 -- (-554.366) [-551.144] (-553.678) (-551.249) * [-551.542] (-550.812) (-554.544) (-553.193) -- 0:01:19
59500 -- (-555.490) [-551.454] (-553.100) (-552.509) * (-554.730) (-550.943) [-551.164] (-551.211) -- 0:01:19
60000 -- (-553.045) (-553.188) (-549.604) [-551.960] * (-550.882) (-552.824) [-550.500] (-551.269) -- 0:01:18
Average standard deviation of split frequencies: 0.036632
60500 -- [-561.063] (-550.652) (-556.476) (-551.987) * [-551.515] (-551.905) (-553.684) (-551.141) -- 0:01:17
61000 -- (-562.569) (-550.342) (-551.660) [-552.812] * (-549.839) (-552.348) [-552.126] (-552.317) -- 0:01:16
61500 -- (-552.198) (-550.378) [-551.891] (-551.569) * [-550.653] (-551.276) (-551.198) (-552.366) -- 0:01:16
62000 -- (-553.816) (-550.710) [-551.480] (-551.434) * [-549.538] (-551.247) (-552.870) (-552.026) -- 0:01:15
62500 -- [-551.249] (-551.936) (-549.201) (-555.000) * [-552.487] (-553.328) (-554.327) (-550.541) -- 0:01:15
63000 -- [-558.317] (-556.427) (-550.714) (-552.776) * (-553.161) [-556.879] (-551.817) (-550.689) -- 0:01:14
63500 -- (-552.129) (-554.302) [-549.895] (-549.642) * [-550.372] (-557.090) (-551.253) (-553.510) -- 0:01:13
64000 -- [-553.355] (-550.592) (-553.435) (-553.496) * (-551.422) [-550.951] (-553.654) (-552.135) -- 0:01:13
64500 -- [-560.300] (-550.316) (-555.620) (-552.715) * [-550.855] (-552.086) (-552.536) (-554.814) -- 0:01:12
65000 -- (-553.973) (-552.277) [-551.948] (-551.412) * (-550.272) (-553.344) (-553.220) [-549.658] -- 0:01:11
Average standard deviation of split frequencies: 0.028570
65500 -- [-555.720] (-549.542) (-551.811) (-549.122) * (-552.040) (-550.310) [-553.629] (-550.895) -- 0:01:11
66000 -- [-558.410] (-554.469) (-554.024) (-551.320) * (-551.429) (-551.522) [-550.377] (-553.892) -- 0:01:10
66500 -- (-555.836) (-550.309) [-549.275] (-552.327) * (-550.173) (-549.461) (-549.614) [-551.921] -- 0:01:10
67000 -- (-561.669) [-553.314] (-548.828) (-551.254) * (-552.478) (-553.433) (-551.184) [-549.886] -- 0:01:09
67500 -- [-551.980] (-551.651) (-549.583) (-550.102) * (-553.178) (-550.793) (-550.729) [-552.300] -- 0:01:09
68000 -- (-555.049) (-549.754) [-548.757] (-554.641) * (-549.414) (-559.253) [-551.527] (-551.895) -- 0:01:08
68500 -- (-556.345) [-550.315] (-552.750) (-550.040) * [-548.957] (-552.186) (-551.899) (-552.645) -- 0:01:07
69000 -- (-562.729) (-554.456) (-555.238) [-550.088] * (-552.208) (-550.099) [-552.691] (-552.213) -- 0:01:07
69500 -- (-561.074) (-550.344) (-559.373) [-551.784] * (-548.683) [-551.186] (-552.377) (-553.174) -- 0:01:06
70000 -- (-550.332) [-552.463] (-554.112) (-550.949) * (-551.147) [-551.467] (-552.358) (-557.206) -- 0:01:06
Average standard deviation of split frequencies: 0.025813
70500 -- (-550.961) [-550.584] (-552.973) (-550.493) * (-553.847) [-550.232] (-551.023) (-552.290) -- 0:01:05
71000 -- [-548.425] (-550.200) (-556.225) (-553.137) * (-548.679) (-555.093) [-551.288] (-554.264) -- 0:01:05
71500 -- (-550.304) [-550.640] (-553.034) (-553.444) * (-553.532) [-552.074] (-551.361) (-553.612) -- 0:01:04
72000 -- (-551.368) (-552.369) [-551.473] (-551.140) * (-553.430) (-556.530) (-551.957) [-551.967] -- 0:01:17
72500 -- (-551.618) [-551.656] (-554.349) (-551.058) * (-551.110) (-552.596) (-552.814) [-551.801] -- 0:01:16
73000 -- (-550.337) (-550.388) [-554.187] (-551.377) * (-551.382) [-551.403] (-552.473) (-552.466) -- 0:01:16
73500 -- [-549.565] (-554.933) (-552.106) (-551.010) * (-551.553) (-551.656) [-551.919] (-551.925) -- 0:01:15
74000 -- (-551.942) (-555.510) (-552.643) [-552.984] * [-551.596] (-551.819) (-554.856) (-552.380) -- 0:01:15
74500 -- (-549.910) (-554.011) (-552.379) [-554.251] * [-551.946] (-552.227) (-551.689) (-551.737) -- 0:01:14
75000 -- (-550.698) (-549.772) (-553.079) [-551.382] * (-551.096) (-554.064) [-550.161] (-553.547) -- 0:01:14
Average standard deviation of split frequencies: 0.026583
75500 -- [-551.105] (-551.421) (-551.849) (-551.566) * [-550.854] (-550.215) (-550.153) (-553.990) -- 0:01:13
76000 -- (-551.543) (-551.913) [-551.523] (-551.365) * [-552.892] (-551.086) (-550.603) (-553.411) -- 0:01:12
76500 -- [-550.151] (-553.169) (-551.144) (-554.254) * (-555.146) [-553.987] (-550.734) (-552.656) -- 0:01:12
77000 -- (-550.044) (-550.809) [-555.270] (-553.953) * (-550.379) (-550.579) (-550.009) [-551.267] -- 0:01:11
77500 -- (-551.296) (-553.479) [-553.294] (-553.818) * (-549.706) [-550.861] (-550.635) (-555.889) -- 0:01:11
78000 -- (-550.986) (-551.201) [-551.180] (-551.798) * (-549.186) [-550.221] (-559.469) (-552.779) -- 0:01:10
78500 -- (-551.618) [-548.048] (-550.573) (-551.687) * (-552.310) (-556.192) [-554.457] (-552.876) -- 0:01:10
79000 -- (-555.960) (-548.982) [-552.973] (-550.733) * (-551.849) (-550.763) [-550.802] (-553.040) -- 0:01:09
79500 -- (-553.418) (-552.867) (-552.654) [-555.212] * (-551.445) [-550.707] (-551.774) (-552.726) -- 0:01:09
80000 -- (-554.323) (-549.039) [-552.234] (-553.714) * (-550.521) [-551.775] (-552.200) (-549.567) -- 0:01:09
Average standard deviation of split frequencies: 0.024252
80500 -- (-555.811) (-550.567) [-550.348] (-550.760) * (-551.395) [-552.932] (-557.418) (-550.797) -- 0:01:08
81000 -- (-552.135) [-554.358] (-551.342) (-553.799) * [-549.095] (-551.170) (-551.535) (-552.344) -- 0:01:08
81500 -- (-550.663) (-551.703) (-553.758) [-550.537] * [-552.069] (-551.737) (-551.214) (-550.568) -- 0:01:07
82000 -- [-550.551] (-552.381) (-552.413) (-551.575) * (-551.566) (-549.465) [-549.605] (-554.362) -- 0:01:07
82500 -- (-552.937) (-553.141) [-548.203] (-551.571) * (-548.739) (-548.508) (-551.334) [-551.393] -- 0:01:06
83000 -- (-551.851) (-552.392) [-550.353] (-550.918) * (-549.758) (-549.193) (-549.515) [-552.860] -- 0:01:06
83500 -- (-551.195) (-549.434) (-551.143) [-552.308] * (-550.462) [-552.379] (-550.685) (-557.020) -- 0:01:05
84000 -- (-549.434) (-552.951) [-552.196] (-552.696) * (-548.875) (-553.273) (-551.745) [-551.390] -- 0:01:05
84500 -- (-552.394) (-550.797) (-551.973) [-550.418] * (-552.949) (-553.587) [-553.002] (-551.427) -- 0:01:05
85000 -- [-554.265] (-550.950) (-556.995) (-550.084) * [-549.806] (-549.740) (-552.722) (-555.059) -- 0:01:04
Average standard deviation of split frequencies: 0.026311
85500 -- [-555.794] (-551.313) (-554.420) (-552.554) * [-550.729] (-549.107) (-552.762) (-558.452) -- 0:01:04
86000 -- (-552.545) (-552.101) (-552.190) [-550.933] * (-550.642) [-549.106] (-554.225) (-552.021) -- 0:01:14
86500 -- (-552.342) (-550.887) [-551.858] (-551.174) * (-549.792) [-553.104] (-553.481) (-555.068) -- 0:01:13
87000 -- (-552.078) (-552.595) [-550.916] (-551.989) * [-553.907] (-553.097) (-551.868) (-551.858) -- 0:01:13
87500 -- [-554.244] (-549.645) (-552.839) (-551.021) * [-549.963] (-553.779) (-553.222) (-553.557) -- 0:01:13
88000 -- (-551.673) (-551.767) [-552.482] (-552.305) * (-550.126) (-551.515) [-554.470] (-550.059) -- 0:01:12
88500 -- (-554.331) (-551.515) (-548.683) [-551.789] * (-552.260) [-551.983] (-551.491) (-549.859) -- 0:01:12
89000 -- [-549.803] (-551.420) (-549.063) (-550.161) * (-551.368) (-553.235) (-551.137) [-548.717] -- 0:01:11
89500 -- (-561.198) (-553.047) (-549.683) [-550.265] * [-553.031] (-552.746) (-552.650) (-550.854) -- 0:01:11
90000 -- (-553.124) (-552.097) (-553.993) [-551.057] * (-551.303) (-553.458) [-552.943] (-551.968) -- 0:01:10
Average standard deviation of split frequencies: 0.024177
90500 -- (-557.088) (-551.397) (-552.232) [-551.683] * [-551.469] (-551.738) (-552.426) (-549.186) -- 0:01:10
91000 -- (-554.630) (-550.498) [-551.069] (-551.405) * [-553.337] (-549.737) (-549.829) (-553.987) -- 0:01:09
91500 -- [-551.898] (-551.027) (-552.226) (-553.055) * (-551.425) [-551.764] (-555.099) (-553.099) -- 0:01:09
92000 -- (-553.750) [-551.657] (-551.510) (-554.865) * (-548.443) [-552.639] (-553.410) (-551.616) -- 0:01:09
92500 -- (-554.472) (-551.389) [-549.097] (-550.773) * (-550.641) (-552.564) [-555.191] (-552.572) -- 0:01:08
93000 -- (-550.348) [-554.346] (-550.992) (-549.116) * (-555.715) [-551.168] (-550.221) (-549.963) -- 0:01:08
93500 -- (-551.726) (-551.349) (-549.515) [-550.339] * (-549.952) (-552.344) (-550.078) [-550.049] -- 0:01:07
94000 -- [-552.074] (-553.845) (-549.680) (-556.472) * [-550.694] (-552.203) (-552.004) (-551.311) -- 0:01:07
94500 -- (-551.277) (-551.458) [-548.756] (-557.566) * (-551.467) (-555.407) [-550.417] (-550.073) -- 0:01:07
95000 -- [-548.766] (-552.167) (-549.997) (-552.930) * (-548.770) (-552.438) (-550.169) [-552.068] -- 0:01:06
Average standard deviation of split frequencies: 0.021193
95500 -- (-551.040) [-552.449] (-553.291) (-550.727) * (-550.737) [-552.014] (-551.170) (-551.342) -- 0:01:06
96000 -- (-549.275) (-552.365) (-552.633) [-550.344] * (-551.917) [-552.566] (-549.345) (-550.267) -- 0:01:05
96500 -- [-551.634] (-551.793) (-551.046) (-553.239) * (-549.732) [-549.567] (-551.424) (-551.277) -- 0:01:05
97000 -- [-552.584] (-551.619) (-552.113) (-552.444) * [-548.821] (-553.929) (-550.877) (-551.635) -- 0:01:05
97500 -- (-553.365) (-551.482) [-551.333] (-558.793) * (-548.522) [-552.795] (-550.062) (-552.220) -- 0:01:04
98000 -- [-551.676] (-551.194) (-555.095) (-555.755) * [-551.597] (-551.114) (-552.807) (-549.935) -- 0:01:04
98500 -- (-554.570) [-552.240] (-555.268) (-552.892) * (-553.414) [-548.354] (-551.805) (-550.444) -- 0:01:04
99000 -- (-550.892) (-551.935) [-551.300] (-553.150) * (-553.904) [-550.664] (-551.452) (-550.907) -- 0:01:03
99500 -- (-549.664) [-552.135] (-552.521) (-550.566) * [-553.510] (-551.477) (-554.794) (-552.855) -- 0:01:03
100000 -- (-550.650) [-551.441] (-553.437) (-554.207) * (-549.101) [-550.056] (-552.054) (-551.180) -- 0:01:12
Average standard deviation of split frequencies: 0.019772
100500 -- [-550.677] (-555.718) (-550.729) (-549.959) * [-548.926] (-550.876) (-552.278) (-551.416) -- 0:01:11
101000 -- [-550.733] (-554.674) (-555.024) (-553.372) * [-551.535] (-550.082) (-550.913) (-550.857) -- 0:01:11
101500 -- [-552.783] (-555.438) (-551.235) (-552.150) * (-553.173) (-551.777) (-551.681) [-552.116] -- 0:01:10
102000 -- (-553.082) (-552.887) [-550.571] (-553.525) * (-552.891) [-551.547] (-553.874) (-550.099) -- 0:01:10
102500 -- [-550.585] (-553.138) (-550.838) (-554.721) * (-552.090) [-551.136] (-550.635) (-550.929) -- 0:01:10
103000 -- (-552.223) (-552.871) [-551.232] (-555.849) * [-551.715] (-550.145) (-549.830) (-552.681) -- 0:01:09
103500 -- (-553.424) (-553.445) (-551.821) [-549.962] * (-552.697) [-551.672] (-548.971) (-551.362) -- 0:01:09
104000 -- (-550.888) (-552.979) [-551.919] (-548.141) * (-550.914) (-553.776) [-548.761] (-553.940) -- 0:01:08
104500 -- [-552.599] (-557.997) (-552.714) (-551.867) * (-549.159) [-552.531] (-550.939) (-552.040) -- 0:01:08
105000 -- [-553.020] (-553.421) (-551.624) (-551.333) * (-550.882) (-552.995) [-549.268] (-550.343) -- 0:01:08
Average standard deviation of split frequencies: 0.018011
105500 -- (-553.271) [-553.778] (-549.191) (-554.283) * [-550.006] (-553.679) (-548.130) (-550.636) -- 0:01:07
106000 -- (-553.192) (-552.197) (-549.857) [-552.679] * (-551.079) [-549.057] (-549.557) (-555.168) -- 0:01:07
106500 -- [-552.604] (-551.281) (-550.779) (-549.603) * (-553.208) [-551.932] (-549.565) (-552.330) -- 0:01:07
107000 -- [-550.987] (-550.660) (-550.904) (-549.807) * (-549.495) [-551.633] (-547.745) (-554.463) -- 0:01:06
107500 -- (-552.878) [-550.336] (-551.679) (-547.872) * (-551.756) (-551.771) [-550.988] (-549.396) -- 0:01:06
108000 -- [-551.249] (-552.629) (-552.350) (-549.644) * (-552.433) [-551.805] (-559.663) (-551.666) -- 0:01:06
108500 -- [-553.056] (-551.593) (-550.418) (-550.488) * [-550.559] (-551.064) (-551.893) (-557.788) -- 0:01:05
109000 -- (-555.712) (-551.623) (-550.834) [-554.142] * (-550.861) (-552.437) (-552.299) [-550.985] -- 0:01:05
109500 -- (-550.347) [-550.221] (-551.879) (-550.716) * (-550.186) (-551.835) (-550.137) [-552.241] -- 0:01:05
110000 -- (-551.124) [-550.399] (-550.069) (-549.486) * [-549.366] (-551.553) (-552.118) (-555.892) -- 0:01:04
Average standard deviation of split frequencies: 0.019056
110500 -- (-556.131) (-552.096) (-551.006) [-553.036] * (-548.826) (-551.559) [-550.386] (-550.614) -- 0:01:04
111000 -- [-554.769] (-553.016) (-551.163) (-549.391) * (-548.055) (-550.008) (-550.038) [-550.360] -- 0:01:04
111500 -- (-551.898) (-551.002) (-551.995) [-548.517] * (-549.931) (-553.564) [-549.639] (-550.343) -- 0:01:03
112000 -- (-552.207) [-553.758] (-552.057) (-551.516) * (-553.235) [-551.373] (-552.837) (-549.504) -- 0:01:03
112500 -- (-552.621) [-549.550] (-550.740) (-551.363) * (-551.741) (-550.200) (-552.915) [-551.931] -- 0:01:03
113000 -- (-552.023) (-552.184) [-549.907] (-548.947) * (-549.920) (-552.243) (-550.353) [-548.942] -- 0:01:02
113500 -- (-551.022) (-550.808) [-550.709] (-550.724) * (-552.343) [-550.441] (-553.528) (-553.242) -- 0:01:02
114000 -- (-549.916) [-550.436] (-554.077) (-551.832) * (-548.929) [-552.562] (-550.416) (-554.230) -- 0:01:09
114500 -- [-548.935] (-549.726) (-552.830) (-550.508) * (-550.072) (-551.781) (-550.358) [-549.011] -- 0:01:09
115000 -- (-549.296) [-557.576] (-553.185) (-550.732) * [-550.052] (-551.221) (-550.057) (-550.764) -- 0:01:09
Average standard deviation of split frequencies: 0.018739
115500 -- (-552.921) (-557.486) [-551.683] (-550.659) * [-549.840] (-550.375) (-551.014) (-551.198) -- 0:01:08
116000 -- [-549.443] (-552.581) (-552.297) (-555.251) * [-549.892] (-552.486) (-550.414) (-552.398) -- 0:01:08
116500 -- (-550.892) (-551.896) (-553.409) [-550.406] * (-548.160) (-556.196) [-551.502] (-550.759) -- 0:01:08
117000 -- (-551.808) [-551.944] (-551.733) (-550.072) * [-552.395] (-552.400) (-548.019) (-552.113) -- 0:01:07
117500 -- (-553.036) (-553.025) (-551.485) [-548.869] * (-547.543) (-550.486) [-548.574] (-551.961) -- 0:01:07
118000 -- (-551.120) (-551.121) (-552.251) [-548.031] * (-550.934) (-550.639) (-550.103) [-551.470] -- 0:01:07
118500 -- (-555.674) (-556.163) [-552.228] (-552.445) * (-550.750) (-551.624) [-548.580] (-551.034) -- 0:01:06
119000 -- (-550.432) (-552.481) (-552.811) [-551.739] * (-547.566) (-554.352) [-548.498] (-557.272) -- 0:01:06
119500 -- [-551.757] (-550.765) (-552.625) (-554.186) * (-549.059) (-553.443) [-549.871] (-555.252) -- 0:01:06
120000 -- [-549.551] (-554.294) (-554.383) (-552.139) * [-554.405] (-552.192) (-549.659) (-551.697) -- 0:01:06
Average standard deviation of split frequencies: 0.018711
120500 -- (-550.367) [-552.173] (-557.999) (-548.995) * (-548.320) [-553.254] (-547.552) (-554.989) -- 0:01:05
121000 -- (-551.317) [-552.269] (-554.638) (-550.045) * [-548.633] (-556.624) (-547.585) (-555.219) -- 0:01:05
121500 -- [-551.094] (-555.065) (-553.252) (-551.847) * [-549.120] (-552.184) (-548.214) (-551.072) -- 0:01:05
122000 -- (-553.784) (-553.274) [-554.129] (-551.548) * [-549.995] (-551.578) (-550.183) (-551.904) -- 0:01:04
122500 -- (-553.905) [-554.073] (-555.528) (-550.235) * (-549.187) (-552.513) [-550.665] (-551.837) -- 0:01:04
123000 -- (-551.001) (-549.697) (-552.741) [-554.174] * [-550.785] (-552.072) (-549.121) (-552.412) -- 0:01:04
123500 -- (-551.197) [-552.401] (-551.873) (-548.689) * (-553.894) [-550.683] (-550.394) (-552.484) -- 0:01:03
124000 -- (-551.329) (-550.827) (-551.248) [-548.775] * (-550.962) (-551.278) (-554.690) [-552.766] -- 0:01:03
124500 -- (-555.070) (-552.439) (-550.456) [-550.683] * [-548.801] (-552.777) (-552.255) (-553.483) -- 0:01:03
125000 -- (-552.470) (-551.510) [-551.308] (-551.273) * (-550.316) (-552.572) [-550.896] (-552.608) -- 0:01:03
Average standard deviation of split frequencies: 0.016649
125500 -- [-552.931] (-550.661) (-552.063) (-551.378) * (-552.234) [-552.288] (-550.042) (-554.905) -- 0:01:02
126000 -- (-554.030) [-550.933] (-554.884) (-549.001) * (-550.214) (-554.056) [-549.241] (-550.716) -- 0:01:02
126500 -- (-554.488) (-551.214) (-553.318) [-554.215] * (-554.351) [-550.898] (-550.560) (-552.292) -- 0:01:02
127000 -- (-550.667) (-550.836) [-552.863] (-553.022) * (-550.979) (-550.977) (-555.037) [-552.402] -- 0:01:01
127500 -- (-550.215) (-551.206) (-551.831) [-552.105] * (-549.199) [-550.461] (-551.837) (-554.343) -- 0:01:01
128000 -- (-548.790) [-550.556] (-551.943) (-551.120) * (-549.698) (-552.724) [-549.245] (-553.429) -- 0:01:01
128500 -- (-549.442) (-552.389) (-552.394) [-550.351] * (-551.862) [-551.884] (-549.347) (-556.614) -- 0:01:07
129000 -- (-553.105) (-554.022) (-551.174) [-549.366] * (-551.994) (-549.857) [-550.034] (-552.592) -- 0:01:07
129500 -- (-552.002) [-550.738] (-551.523) (-552.148) * (-556.722) (-553.339) [-550.276] (-550.628) -- 0:01:07
130000 -- (-550.843) (-554.425) (-550.168) [-552.335] * (-549.966) [-551.674] (-549.686) (-554.387) -- 0:01:06
Average standard deviation of split frequencies: 0.017497
130500 -- (-551.363) [-551.621] (-552.790) (-549.575) * [-549.668] (-550.434) (-549.986) (-550.867) -- 0:01:06
131000 -- (-550.357) [-550.617] (-551.076) (-550.907) * (-554.993) (-552.802) (-551.024) [-549.800] -- 0:01:06
131500 -- [-549.853] (-551.730) (-550.745) (-551.562) * [-553.053] (-548.406) (-552.343) (-552.088) -- 0:01:06
132000 -- (-554.330) (-554.129) [-551.122] (-557.067) * [-550.840] (-551.368) (-553.203) (-551.363) -- 0:01:05
132500 -- (-550.357) (-553.559) [-553.231] (-550.366) * (-552.936) (-550.107) [-550.161] (-550.900) -- 0:01:05
133000 -- [-550.730] (-549.196) (-549.967) (-550.746) * (-551.024) (-554.393) (-556.479) [-552.727] -- 0:01:05
133500 -- (-553.422) (-550.208) (-553.592) [-551.716] * [-551.131] (-549.651) (-550.025) (-555.017) -- 0:01:04
134000 -- (-550.986) (-550.255) (-553.600) [-552.153] * (-552.392) [-551.298] (-551.141) (-551.429) -- 0:01:04
134500 -- (-550.661) [-550.443] (-556.361) (-554.830) * (-553.035) (-550.629) [-551.585] (-550.741) -- 0:01:04
135000 -- [-550.867] (-554.566) (-554.262) (-552.771) * [-550.225] (-550.389) (-551.493) (-553.895) -- 0:01:04
Average standard deviation of split frequencies: 0.019237
135500 -- (-549.735) (-551.231) [-551.908] (-549.588) * [-548.925] (-548.965) (-553.241) (-551.120) -- 0:01:03
136000 -- (-554.428) [-553.619] (-549.387) (-551.715) * (-552.047) (-551.349) [-552.905] (-553.253) -- 0:01:03
136500 -- (-553.821) [-552.091] (-554.517) (-551.644) * (-553.181) (-551.206) [-554.014] (-558.905) -- 0:01:03
137000 -- (-560.524) (-551.770) [-552.027] (-554.862) * (-551.697) (-554.825) [-550.966] (-554.467) -- 0:01:02
137500 -- (-554.729) (-552.875) [-552.102] (-552.511) * (-551.311) (-551.292) [-551.191] (-554.087) -- 0:01:02
138000 -- (-551.594) (-550.444) (-551.762) [-556.955] * (-550.452) [-550.932] (-549.815) (-551.590) -- 0:01:02
138500 -- [-552.536] (-548.469) (-549.414) (-552.437) * (-550.643) (-551.456) (-552.955) [-550.870] -- 0:01:02
139000 -- (-554.949) (-549.949) (-551.096) [-552.819] * (-551.191) (-549.858) (-551.673) [-551.868] -- 0:01:01
139500 -- (-554.953) (-553.365) [-552.128] (-552.862) * (-551.705) (-552.334) [-552.035] (-553.953) -- 0:01:01
140000 -- (-552.621) (-549.439) [-552.020] (-553.413) * (-551.932) [-550.937] (-550.653) (-560.088) -- 0:01:01
Average standard deviation of split frequencies: 0.017687
140500 -- (-550.311) [-549.189] (-550.996) (-551.442) * [-551.348] (-553.863) (-555.302) (-552.437) -- 0:01:01
141000 -- (-552.972) (-551.381) (-551.393) [-551.156] * (-550.132) (-553.380) [-550.125] (-552.806) -- 0:01:00
141500 -- [-551.542] (-548.711) (-552.904) (-550.446) * (-553.785) (-551.123) [-550.136] (-553.631) -- 0:01:00
142000 -- (-550.928) (-552.452) [-553.464] (-554.443) * (-552.280) (-553.668) [-549.340] (-553.314) -- 0:01:00
142500 -- (-552.356) [-550.868] (-553.067) (-554.912) * (-552.067) (-551.186) (-550.781) [-549.273] -- 0:01:06
143000 -- (-551.831) [-548.376] (-550.428) (-551.092) * [-549.849] (-553.527) (-549.075) (-552.491) -- 0:01:05
143500 -- (-557.841) (-550.473) [-554.479] (-552.583) * [-553.715] (-552.506) (-550.442) (-550.333) -- 0:01:05
144000 -- (-551.799) (-554.965) [-550.819] (-553.933) * (-552.256) (-555.958) [-549.059] (-549.965) -- 0:01:05
144500 -- (-549.867) (-552.045) (-551.587) [-554.485] * (-551.890) (-549.870) [-551.070] (-550.914) -- 0:01:05
145000 -- (-549.871) [-548.460] (-554.609) (-552.123) * (-551.228) (-552.857) (-551.607) [-549.937] -- 0:01:04
Average standard deviation of split frequencies: 0.015634
145500 -- [-549.286] (-550.846) (-553.068) (-555.134) * (-555.808) (-552.894) [-549.573] (-551.794) -- 0:01:04
146000 -- [-551.470] (-551.134) (-552.780) (-550.504) * (-551.141) (-552.538) [-549.964] (-550.071) -- 0:01:04
146500 -- (-554.339) (-552.395) (-557.792) [-552.687] * (-551.617) [-553.487] (-550.585) (-551.302) -- 0:01:04
147000 -- [-554.659] (-554.647) (-551.406) (-552.712) * (-554.271) (-553.075) [-548.821] (-550.064) -- 0:01:03
147500 -- (-549.528) (-551.354) (-555.839) [-551.019] * (-554.300) (-552.417) (-551.121) [-554.675] -- 0:01:03
148000 -- (-549.326) (-553.393) (-553.764) [-557.546] * (-551.342) (-549.597) (-550.903) [-552.084] -- 0:01:03
148500 -- [-552.590] (-552.317) (-550.997) (-554.303) * [-551.014] (-550.680) (-550.905) (-555.816) -- 0:01:03
149000 -- (-549.790) (-555.439) (-549.700) [-551.367] * [-554.373] (-551.794) (-553.265) (-552.220) -- 0:01:02
149500 -- (-547.943) (-552.034) (-552.885) [-550.480] * [-551.378] (-555.133) (-551.309) (-553.300) -- 0:01:02
150000 -- [-548.596] (-551.450) (-551.986) (-551.299) * [-552.297] (-549.876) (-552.187) (-553.415) -- 0:01:02
Average standard deviation of split frequencies: 0.016303
150500 -- (-550.328) (-550.602) [-552.125] (-550.296) * (-553.832) [-550.646] (-551.469) (-553.775) -- 0:01:02
151000 -- (-550.855) [-551.592] (-553.340) (-551.978) * (-554.263) (-551.968) [-553.505] (-552.277) -- 0:01:01
151500 -- (-551.499) [-552.043] (-551.199) (-552.026) * [-553.912] (-551.358) (-551.316) (-550.159) -- 0:01:01
152000 -- [-550.934] (-552.584) (-550.549) (-552.044) * (-552.610) [-549.705] (-554.953) (-549.799) -- 0:01:01
152500 -- (-556.722) [-557.055] (-555.584) (-549.646) * (-556.767) [-553.012] (-551.318) (-552.913) -- 0:01:01
153000 -- (-552.170) (-551.630) (-553.055) [-551.656] * [-550.759] (-550.317) (-550.444) (-549.613) -- 0:01:00
153500 -- (-549.234) (-549.211) [-553.583] (-550.084) * (-553.420) (-550.397) [-553.657] (-549.247) -- 0:01:00
154000 -- (-553.261) [-550.698] (-553.856) (-548.574) * (-550.274) [-551.174] (-555.517) (-550.992) -- 0:01:00
154500 -- [-550.297] (-551.546) (-552.292) (-552.635) * (-551.015) (-549.406) [-548.998] (-553.122) -- 0:01:00
155000 -- (-549.291) (-551.937) (-551.422) [-554.030] * [-552.018] (-554.311) (-550.844) (-551.754) -- 0:00:59
Average standard deviation of split frequencies: 0.016063
155500 -- [-548.933] (-550.446) (-551.313) (-552.036) * (-550.975) [-553.268] (-552.107) (-550.126) -- 0:00:59
156000 -- (-558.501) [-551.786] (-551.326) (-551.560) * (-552.899) (-553.128) [-552.781] (-548.434) -- 0:00:59
156500 -- [-552.761] (-552.267) (-551.203) (-548.963) * (-553.249) [-551.474] (-553.961) (-555.058) -- 0:01:04
157000 -- (-550.347) (-552.198) [-549.184] (-553.902) * (-550.999) [-550.133] (-554.486) (-549.868) -- 0:01:04
157500 -- [-551.826] (-559.773) (-551.266) (-551.552) * (-553.885) (-551.273) (-550.306) [-550.868] -- 0:01:04
158000 -- (-551.740) [-553.667] (-551.301) (-556.425) * [-551.046] (-550.580) (-553.323) (-553.752) -- 0:01:03
158500 -- (-551.796) (-550.714) [-552.803] (-549.844) * (-552.078) (-551.958) [-557.936] (-551.801) -- 0:01:03
159000 -- (-550.450) (-553.108) (-548.534) [-549.968] * (-552.525) [-553.054] (-558.215) (-548.387) -- 0:01:03
159500 -- (-551.763) (-550.495) [-549.748] (-552.202) * (-551.784) [-554.155] (-551.347) (-552.951) -- 0:01:03
160000 -- (-551.227) (-551.250) [-551.868] (-551.584) * (-551.916) (-557.436) (-552.191) [-552.204] -- 0:01:02
Average standard deviation of split frequencies: 0.015597
160500 -- [-550.632] (-548.748) (-551.641) (-551.690) * (-553.341) [-554.519] (-551.578) (-551.354) -- 0:01:02
161000 -- (-553.482) (-555.092) (-553.867) [-548.373] * [-551.682] (-550.067) (-554.826) (-551.758) -- 0:01:02
161500 -- (-549.973) (-551.548) (-552.509) [-550.052] * (-551.635) (-548.635) (-549.878) [-552.338] -- 0:01:02
162000 -- (-550.533) [-552.851] (-551.727) (-551.118) * (-553.859) [-550.612] (-551.071) (-552.919) -- 0:01:02
162500 -- [-549.863] (-548.903) (-550.767) (-550.143) * (-550.920) (-550.193) [-552.666] (-553.458) -- 0:01:01
163000 -- [-552.636] (-548.852) (-548.908) (-550.151) * [-554.904] (-551.674) (-550.971) (-552.368) -- 0:01:01
163500 -- [-552.210] (-548.952) (-551.686) (-552.661) * (-554.271) [-552.632] (-551.315) (-551.617) -- 0:01:01
164000 -- (-549.302) [-550.063] (-552.311) (-549.387) * (-552.545) (-550.925) [-551.487] (-551.182) -- 0:01:01
164500 -- [-551.091] (-550.722) (-553.845) (-547.494) * (-550.956) (-548.703) (-549.765) [-551.690] -- 0:01:00
165000 -- (-549.893) [-549.870] (-553.728) (-552.297) * (-552.537) (-551.161) (-549.903) [-553.802] -- 0:01:00
Average standard deviation of split frequencies: 0.016329
165500 -- (-556.889) [-550.312] (-552.906) (-553.227) * (-550.647) [-551.058] (-551.308) (-555.694) -- 0:01:00
166000 -- (-552.177) (-551.447) (-556.451) [-550.631] * [-551.880] (-550.402) (-550.549) (-551.771) -- 0:01:00
166500 -- (-550.608) [-551.454] (-552.366) (-548.883) * [-552.098] (-553.538) (-551.145) (-551.378) -- 0:01:00
167000 -- (-552.213) [-550.499] (-550.107) (-549.643) * [-553.887] (-552.650) (-552.331) (-549.090) -- 0:00:59
167500 -- (-550.342) (-549.785) [-551.917] (-552.138) * [-550.249] (-553.645) (-549.962) (-553.598) -- 0:00:59
168000 -- [-551.251] (-549.643) (-558.400) (-550.054) * (-553.011) (-552.760) [-550.466] (-552.770) -- 0:00:59
168500 -- [-551.877] (-553.955) (-550.992) (-550.479) * (-554.558) (-551.973) [-550.013] (-549.410) -- 0:00:59
169000 -- (-552.079) (-556.339) [-550.763] (-549.278) * (-551.457) (-552.590) (-550.192) [-552.028] -- 0:00:59
169500 -- (-552.210) (-550.839) (-553.048) [-550.303] * (-551.866) [-553.511] (-552.652) (-554.161) -- 0:00:58
170000 -- (-554.502) (-552.093) [-553.089] (-551.429) * [-551.388] (-551.271) (-551.899) (-558.164) -- 0:00:58
Average standard deviation of split frequencies: 0.016282
170500 -- (-552.004) [-553.090] (-551.266) (-549.298) * (-552.169) (-553.593) [-551.247] (-549.027) -- 0:01:03
171000 -- (-548.701) (-553.218) (-550.569) [-550.255] * (-553.769) (-552.316) [-549.538] (-553.878) -- 0:01:03
171500 -- [-548.700] (-553.371) (-549.376) (-550.956) * (-550.420) [-551.896] (-552.430) (-550.032) -- 0:01:02
172000 -- (-550.978) (-552.460) (-553.946) [-552.551] * [-549.080] (-554.580) (-550.737) (-552.356) -- 0:01:02
172500 -- (-550.033) (-551.222) [-552.345] (-550.478) * (-551.760) (-551.797) [-549.961] (-552.794) -- 0:01:02
173000 -- (-550.252) (-552.227) (-549.757) [-548.175] * [-549.993] (-550.519) (-551.327) (-555.204) -- 0:01:02
173500 -- (-552.484) (-550.255) (-554.894) [-549.667] * (-551.164) (-554.430) (-551.324) [-550.184] -- 0:01:01
174000 -- (-553.787) (-549.534) [-552.807] (-554.062) * (-550.162) (-553.042) [-551.391] (-550.866) -- 0:01:01
174500 -- (-549.881) (-553.144) (-550.786) [-550.248] * (-551.664) (-553.723) (-550.571) [-553.135] -- 0:01:01
175000 -- (-552.240) (-549.361) [-552.106] (-550.685) * (-550.427) [-551.174] (-548.979) (-549.216) -- 0:01:01
Average standard deviation of split frequencies: 0.015789
175500 -- (-550.988) (-549.217) (-552.032) [-551.945] * (-551.926) (-552.013) [-553.226] (-550.114) -- 0:01:01
176000 -- (-552.166) (-551.670) (-553.082) [-553.811] * [-555.251] (-553.736) (-550.188) (-551.711) -- 0:01:00
176500 -- (-549.068) (-551.220) (-551.189) [-553.631] * (-550.826) (-552.322) (-550.379) [-549.226] -- 0:01:00
177000 -- [-549.228] (-550.639) (-553.454) (-548.490) * [-551.576] (-551.632) (-549.342) (-550.887) -- 0:01:00
177500 -- (-552.612) [-550.424] (-554.520) (-550.443) * (-552.937) (-554.333) (-550.497) [-551.005] -- 0:01:00
178000 -- (-551.518) (-550.477) (-551.077) [-551.681] * (-554.508) (-551.195) (-552.307) [-550.918] -- 0:01:00
178500 -- [-551.574] (-550.610) (-551.483) (-550.503) * (-552.512) (-549.673) (-552.593) [-549.163] -- 0:00:59
179000 -- (-548.158) (-553.959) (-550.417) [-550.154] * (-552.456) (-553.021) [-548.849] (-549.920) -- 0:00:59
179500 -- [-550.132] (-548.663) (-551.666) (-548.833) * (-552.267) (-552.724) [-550.203] (-551.872) -- 0:00:59
180000 -- (-549.272) (-554.539) (-552.332) [-551.617] * [-551.024] (-551.562) (-550.665) (-553.589) -- 0:00:59
Average standard deviation of split frequencies: 0.016342
180500 -- (-551.153) (-552.205) (-551.946) [-551.712] * (-551.333) [-552.316] (-555.563) (-551.178) -- 0:00:59
181000 -- [-555.540] (-553.749) (-553.360) (-550.910) * (-552.065) [-551.759] (-551.115) (-552.812) -- 0:00:58
181500 -- (-551.767) [-556.178] (-552.088) (-551.538) * [-551.334] (-552.493) (-551.025) (-554.645) -- 0:00:58
182000 -- (-550.182) (-552.655) (-551.878) [-551.593] * (-551.340) (-552.571) [-551.413] (-554.532) -- 0:00:58
182500 -- (-551.325) (-550.334) [-549.494] (-551.774) * [-549.436] (-551.714) (-549.408) (-549.266) -- 0:00:58
183000 -- (-550.873) [-551.527] (-551.731) (-553.433) * (-554.437) (-553.495) [-549.913] (-551.376) -- 0:00:58
183500 -- [-551.966] (-552.536) (-552.176) (-553.164) * (-554.363) [-551.219] (-549.177) (-551.248) -- 0:00:57
184000 -- [-550.752] (-551.975) (-550.692) (-551.896) * (-553.420) (-561.215) (-550.957) [-553.698] -- 0:00:57
184500 -- (-552.194) (-551.391) [-549.570] (-555.248) * (-552.927) (-552.132) (-555.616) [-549.843] -- 0:01:01
185000 -- (-549.252) (-554.259) (-550.512) [-553.455] * [-555.237] (-551.642) (-550.310) (-550.875) -- 0:01:01
Average standard deviation of split frequencies: 0.016007
185500 -- (-551.149) (-558.622) (-549.501) [-550.921] * [-552.053] (-550.540) (-549.786) (-550.372) -- 0:01:01
186000 -- (-552.065) (-554.420) [-550.904] (-552.556) * (-551.209) (-551.261) [-551.335] (-552.223) -- 0:01:01
186500 -- (-552.909) (-552.851) (-551.583) [-550.328] * (-552.560) (-551.645) [-551.064] (-549.226) -- 0:01:01
187000 -- (-551.103) [-553.706] (-554.725) (-550.569) * [-550.891] (-554.018) (-549.938) (-553.613) -- 0:01:00
187500 -- (-550.918) (-554.123) (-552.427) [-554.259] * (-552.779) (-552.017) (-549.142) [-549.897] -- 0:01:00
188000 -- (-550.277) (-552.156) (-550.516) [-549.483] * (-550.786) [-550.774] (-550.673) (-552.863) -- 0:01:00
188500 -- (-548.536) (-551.558) (-553.007) [-550.017] * [-549.758] (-550.800) (-556.268) (-549.657) -- 0:01:00
189000 -- [-549.268] (-551.843) (-552.737) (-552.524) * (-550.547) [-551.278] (-551.725) (-553.970) -- 0:01:00
189500 -- (-550.037) (-550.443) (-550.910) [-550.247] * [-550.596] (-550.971) (-550.128) (-548.471) -- 0:00:59
190000 -- (-555.726) [-551.928] (-551.478) (-550.703) * [-551.611] (-550.512) (-550.940) (-554.920) -- 0:00:59
Average standard deviation of split frequencies: 0.016526
190500 -- (-554.943) (-552.075) [-550.752] (-551.181) * (-550.340) (-549.592) [-550.202] (-553.819) -- 0:00:59
191000 -- (-557.866) [-548.889] (-551.690) (-552.343) * (-551.338) (-549.919) [-548.772] (-550.854) -- 0:00:59
191500 -- (-552.218) [-550.200] (-551.912) (-553.652) * (-550.132) (-554.890) (-550.702) [-552.223] -- 0:00:59
192000 -- (-549.068) [-550.102] (-550.965) (-550.753) * (-551.989) (-549.184) (-550.659) [-551.611] -- 0:00:58
192500 -- [-550.195] (-551.929) (-550.181) (-551.536) * (-552.318) [-549.738] (-550.912) (-551.086) -- 0:00:58
193000 -- (-550.195) (-551.437) [-552.818] (-549.738) * (-548.257) [-551.424] (-549.053) (-551.499) -- 0:00:58
193500 -- (-552.663) [-550.735] (-550.965) (-553.186) * (-550.422) [-549.810] (-551.896) (-553.833) -- 0:00:58
194000 -- (-551.180) [-550.489] (-552.614) (-553.126) * (-550.848) (-550.764) [-552.467] (-553.070) -- 0:00:58
194500 -- [-549.563] (-552.004) (-551.458) (-552.363) * (-547.849) (-552.951) (-550.871) [-549.090] -- 0:00:57
195000 -- [-550.568] (-552.102) (-550.651) (-551.341) * [-550.511] (-554.789) (-549.407) (-552.573) -- 0:00:57
Average standard deviation of split frequencies: 0.014832
195500 -- (-553.450) [-551.656] (-551.690) (-552.641) * [-549.334] (-550.144) (-548.552) (-550.647) -- 0:00:57
196000 -- (-553.449) [-551.924] (-555.584) (-553.809) * (-551.274) (-551.244) (-551.615) [-551.328] -- 0:00:57
196500 -- [-551.963] (-557.275) (-551.227) (-553.079) * (-551.167) (-549.990) (-548.834) [-551.023] -- 0:00:57
197000 -- (-550.527) (-551.390) [-550.741] (-556.015) * (-550.452) (-553.007) [-550.591] (-551.331) -- 0:00:57
197500 -- (-551.645) [-550.881] (-551.620) (-552.667) * [-549.666] (-554.763) (-552.235) (-549.833) -- 0:00:56
198000 -- [-549.938] (-549.577) (-557.232) (-553.576) * (-552.666) [-552.169] (-550.374) (-551.920) -- 0:00:56
198500 -- (-551.753) [-550.313] (-552.145) (-553.132) * (-549.681) (-551.172) (-550.266) [-550.034] -- 0:01:00
199000 -- (-550.455) (-550.717) [-550.218] (-553.372) * (-550.340) [-550.401] (-550.277) (-548.542) -- 0:01:00
199500 -- [-554.793] (-554.918) (-554.069) (-552.599) * (-554.311) [-548.129] (-553.950) (-549.722) -- 0:01:00
200000 -- (-553.992) (-553.423) (-552.320) [-549.249] * (-551.993) [-549.909] (-550.864) (-550.958) -- 0:00:59
Average standard deviation of split frequencies: 0.013965
200500 -- (-556.865) (-554.185) [-553.899] (-551.738) * [-550.219] (-555.635) (-552.878) (-550.369) -- 0:00:59
201000 -- (-551.962) (-553.424) [-552.716] (-552.071) * (-550.588) [-554.265] (-553.103) (-550.803) -- 0:00:59
201500 -- (-553.130) [-552.028] (-554.865) (-550.956) * (-553.637) (-549.333) [-550.671] (-551.516) -- 0:00:59
202000 -- (-551.731) (-552.953) [-552.680] (-550.316) * (-553.229) [-552.687] (-551.640) (-552.725) -- 0:00:59
202500 -- (-552.638) (-552.098) [-548.676] (-552.961) * [-553.805] (-549.246) (-551.544) (-551.511) -- 0:00:59
203000 -- (-551.572) (-552.710) [-550.696] (-551.186) * (-550.063) (-551.790) (-550.823) [-550.456] -- 0:00:58
203500 -- (-550.193) [-548.365] (-554.365) (-552.206) * (-549.290) [-550.181] (-552.409) (-550.729) -- 0:00:58
204000 -- (-550.030) (-551.756) (-552.305) [-551.065] * [-552.347] (-550.746) (-553.171) (-552.990) -- 0:00:58
204500 -- (-549.908) (-550.183) [-552.714] (-550.460) * (-551.756) [-553.601] (-550.103) (-553.755) -- 0:00:58
205000 -- (-551.830) [-550.170] (-551.237) (-554.616) * (-550.608) (-552.588) [-555.438] (-551.637) -- 0:00:58
Average standard deviation of split frequencies: 0.014453
205500 -- (-549.509) [-551.386] (-552.888) (-550.997) * [-548.602] (-551.636) (-552.392) (-552.135) -- 0:00:57
206000 -- (-553.008) (-550.200) (-548.731) [-550.718] * (-550.012) (-550.217) [-548.778] (-551.374) -- 0:00:57
206500 -- (-550.174) [-552.940] (-549.180) (-555.558) * [-550.786] (-553.211) (-552.413) (-550.204) -- 0:00:57
207000 -- [-551.211] (-551.039) (-550.876) (-549.993) * (-549.445) [-550.803] (-550.262) (-549.160) -- 0:00:57
207500 -- (-551.446) [-550.407] (-552.413) (-548.376) * (-554.315) [-551.654] (-552.348) (-554.444) -- 0:00:57
208000 -- (-552.995) [-550.292] (-551.475) (-551.350) * (-552.231) (-548.661) (-548.704) [-549.414] -- 0:00:57
208500 -- (-548.895) (-550.578) [-550.406] (-551.399) * (-551.018) (-551.587) (-549.125) [-549.786] -- 0:00:56
209000 -- [-550.316] (-551.743) (-551.487) (-549.671) * [-550.526] (-551.684) (-553.525) (-553.963) -- 0:00:56
209500 -- (-549.965) [-550.652] (-551.856) (-552.392) * (-548.942) (-551.078) [-554.788] (-550.276) -- 0:00:56
210000 -- (-549.918) [-551.118] (-552.584) (-552.207) * [-550.120] (-552.886) (-556.491) (-549.857) -- 0:00:56
Average standard deviation of split frequencies: 0.015166
210500 -- (-549.723) (-551.067) (-551.727) [-551.155] * (-555.428) (-550.060) [-553.790] (-552.537) -- 0:00:56
211000 -- (-552.273) [-551.430] (-550.717) (-551.217) * (-549.777) (-550.974) (-553.381) [-552.135] -- 0:00:56
211500 -- (-550.530) [-556.171] (-548.546) (-552.545) * [-549.544] (-551.843) (-549.471) (-552.208) -- 0:00:55
212000 -- [-549.034] (-556.002) (-551.865) (-553.977) * (-549.605) (-550.041) (-549.726) [-551.762] -- 0:00:55
212500 -- (-552.494) [-553.901] (-555.130) (-550.922) * (-551.345) (-554.335) [-549.555] (-551.492) -- 0:00:59
213000 -- [-554.579] (-557.012) (-554.556) (-550.528) * (-551.009) [-549.302] (-550.970) (-550.752) -- 0:00:59
213500 -- (-557.079) (-550.834) (-553.083) [-551.309] * (-551.123) [-551.161] (-549.801) (-551.056) -- 0:00:58
214000 -- (-552.596) (-553.475) (-553.205) [-552.021] * (-555.396) (-551.572) (-554.491) [-554.193] -- 0:00:58
214500 -- (-551.684) (-551.786) [-548.965] (-553.177) * (-551.262) (-553.469) [-553.429] (-551.936) -- 0:00:58
215000 -- (-554.978) (-553.287) [-550.433] (-557.045) * (-548.568) (-555.674) (-554.554) [-551.523] -- 0:00:58
Average standard deviation of split frequencies: 0.015883
215500 -- (-550.511) (-550.921) [-550.628] (-549.135) * [-550.179] (-556.339) (-554.522) (-551.940) -- 0:00:58
216000 -- [-548.186] (-551.895) (-550.163) (-550.508) * (-549.750) [-551.644] (-555.584) (-549.129) -- 0:00:58
216500 -- (-552.069) (-554.398) [-549.937] (-550.987) * (-551.111) (-550.906) (-552.810) [-550.283] -- 0:00:57
217000 -- (-550.954) [-549.745] (-548.848) (-553.099) * (-554.278) (-551.030) (-551.892) [-552.166] -- 0:00:57
217500 -- (-551.322) [-552.792] (-548.981) (-555.212) * (-551.492) (-548.808) [-551.239] (-552.355) -- 0:00:57
218000 -- (-550.676) [-552.192] (-550.021) (-554.947) * (-549.940) (-550.544) [-551.663] (-552.519) -- 0:00:57
218500 -- [-550.334] (-550.592) (-550.194) (-552.622) * (-552.229) (-552.844) (-550.834) [-552.461] -- 0:00:57
219000 -- (-549.167) (-550.485) (-550.660) [-551.885] * (-552.189) (-550.431) [-549.264] (-553.135) -- 0:00:57
219500 -- (-549.976) (-548.823) (-550.689) [-552.532] * (-549.816) (-550.768) (-552.889) [-553.025] -- 0:00:56
220000 -- [-549.652] (-551.120) (-556.183) (-551.009) * [-548.466] (-552.198) (-550.675) (-552.629) -- 0:00:56
Average standard deviation of split frequencies: 0.016022
220500 -- (-550.041) [-551.160] (-550.636) (-549.781) * (-550.030) (-549.943) (-551.050) [-548.935] -- 0:00:56
221000 -- (-551.982) (-550.283) [-551.189] (-552.105) * (-550.859) (-550.976) (-551.464) [-549.949] -- 0:00:56
221500 -- [-549.896] (-551.062) (-550.242) (-550.876) * (-549.685) [-550.400] (-553.048) (-549.160) -- 0:00:56
222000 -- (-549.694) (-553.850) (-550.369) [-552.384] * (-550.893) (-554.165) [-550.540] (-551.747) -- 0:00:56
222500 -- (-551.953) [-553.006] (-550.215) (-553.484) * (-553.100) [-551.654] (-551.782) (-554.913) -- 0:00:55
223000 -- (-549.043) (-553.685) (-555.619) [-551.469] * (-554.196) [-552.014] (-550.495) (-551.217) -- 0:00:55
223500 -- [-550.969] (-550.832) (-552.119) (-551.197) * (-552.269) (-552.300) (-548.973) [-550.141] -- 0:00:55
224000 -- (-548.671) (-551.812) [-554.418] (-552.524) * [-551.995] (-550.448) (-552.619) (-553.211) -- 0:00:55
224500 -- (-549.388) (-552.513) [-551.398] (-552.995) * (-551.026) (-551.820) [-553.597] (-551.808) -- 0:00:55
225000 -- (-552.633) [-550.855] (-551.537) (-552.383) * (-549.284) (-550.260) [-551.458] (-553.574) -- 0:00:55
Average standard deviation of split frequencies: 0.015479
225500 -- (-553.094) [-552.295] (-553.502) (-550.476) * [-549.338] (-550.033) (-551.679) (-552.354) -- 0:00:54
226000 -- (-551.336) (-550.913) (-553.978) [-548.303] * [-549.002] (-552.611) (-550.960) (-552.494) -- 0:00:54
226500 -- (-555.605) [-551.833] (-553.777) (-551.153) * (-549.948) (-550.232) (-550.916) [-551.482] -- 0:00:58
227000 -- (-552.952) (-551.488) [-552.677] (-552.216) * [-549.091] (-549.131) (-551.895) (-556.002) -- 0:00:57
227500 -- (-555.443) (-551.988) [-549.727] (-552.874) * (-549.543) [-548.734] (-551.920) (-553.558) -- 0:00:57
228000 -- (-551.654) [-552.472] (-552.197) (-550.495) * (-550.451) (-552.589) [-551.872] (-548.188) -- 0:00:57
228500 -- (-551.207) [-551.281] (-553.036) (-550.907) * (-553.290) [-551.937] (-551.229) (-550.239) -- 0:00:57
229000 -- (-550.584) (-550.916) [-551.228] (-554.004) * (-550.841) (-554.646) [-554.861] (-554.059) -- 0:00:57
229500 -- (-550.757) (-551.196) [-552.818] (-553.326) * (-550.863) (-549.521) (-552.369) [-552.488] -- 0:00:57
230000 -- (-551.398) (-553.012) (-552.683) [-551.535] * (-552.214) [-553.367] (-551.932) (-550.470) -- 0:00:56
Average standard deviation of split frequencies: 0.016576
230500 -- [-549.111] (-554.866) (-553.900) (-549.966) * (-551.067) (-551.909) [-551.393] (-553.310) -- 0:00:56
231000 -- (-549.309) (-551.715) (-554.057) [-550.802] * (-555.049) [-552.416] (-552.755) (-549.206) -- 0:00:56
231500 -- (-551.657) (-551.182) [-553.185] (-548.845) * (-550.012) (-550.288) (-550.928) [-548.945] -- 0:00:56
232000 -- (-550.358) (-550.074) (-555.884) [-552.429] * [-552.518] (-548.143) (-551.192) (-553.137) -- 0:00:56
232500 -- (-552.595) (-553.607) [-550.803] (-548.805) * [-549.812] (-548.978) (-550.403) (-548.975) -- 0:00:56
233000 -- (-552.328) [-553.709] (-552.950) (-550.879) * (-551.457) (-552.522) (-552.237) [-550.038] -- 0:00:55
233500 -- (-553.124) (-551.477) [-552.881] (-549.093) * (-549.514) (-555.262) (-551.559) [-553.289] -- 0:00:55
234000 -- (-552.302) (-551.562) (-552.272) [-550.735] * (-552.385) [-556.638] (-555.582) (-550.279) -- 0:00:55
234500 -- (-551.455) (-551.331) [-550.864] (-554.219) * (-550.601) (-552.897) [-552.724] (-553.798) -- 0:00:55
235000 -- [-551.772] (-551.558) (-552.983) (-550.500) * (-551.833) (-552.199) [-551.757] (-552.494) -- 0:00:55
Average standard deviation of split frequencies: 0.017533
235500 -- (-553.447) [-551.018] (-550.907) (-550.374) * (-554.623) (-549.957) (-551.323) [-549.779] -- 0:00:55
236000 -- [-550.571] (-549.736) (-550.808) (-550.472) * (-552.849) (-549.678) (-553.262) [-550.094] -- 0:00:55
236500 -- (-553.290) (-552.935) (-550.296) [-551.310] * [-553.762] (-548.665) (-551.195) (-548.943) -- 0:00:54
237000 -- [-550.222] (-550.125) (-550.749) (-552.606) * (-554.133) (-550.369) [-551.505] (-551.858) -- 0:00:54
237500 -- (-550.569) (-552.193) [-550.259] (-552.146) * (-555.298) (-549.989) (-555.236) [-549.303] -- 0:00:54
238000 -- [-551.357] (-553.551) (-554.014) (-556.253) * [-551.216] (-551.480) (-554.813) (-552.758) -- 0:00:54
238500 -- (-553.277) (-553.084) (-552.971) [-552.144] * [-551.110] (-550.803) (-551.579) (-549.104) -- 0:00:54
239000 -- (-550.307) (-552.160) (-551.303) [-550.760] * (-553.666) (-549.935) (-552.261) [-548.998] -- 0:00:54
239500 -- [-552.537] (-551.731) (-550.367) (-551.102) * (-553.188) (-549.455) [-552.272] (-549.989) -- 0:00:53
240000 -- [-549.777] (-553.057) (-550.527) (-548.495) * (-554.969) (-553.292) (-551.540) [-550.982] -- 0:00:53
Average standard deviation of split frequencies: 0.016976
240500 -- (-552.685) [-552.862] (-551.097) (-550.968) * (-553.220) (-556.412) (-551.461) [-551.628] -- 0:00:56
241000 -- (-553.027) [-551.300] (-553.441) (-549.570) * [-554.387] (-557.164) (-552.659) (-550.122) -- 0:00:56
241500 -- (-555.957) (-552.736) [-552.634] (-550.712) * (-552.117) (-554.720) (-558.316) [-550.520] -- 0:00:56
242000 -- (-555.230) [-550.373] (-552.384) (-553.648) * (-555.991) (-557.448) [-551.860] (-552.448) -- 0:00:56
242500 -- (-555.557) (-553.365) [-550.818] (-550.614) * (-550.417) (-549.479) [-552.513] (-554.465) -- 0:00:56
243000 -- [-551.546] (-552.485) (-554.472) (-552.164) * [-552.724] (-548.132) (-553.917) (-556.678) -- 0:00:56
243500 -- (-554.256) (-553.852) (-554.861) [-550.971] * (-551.307) [-549.960] (-550.609) (-554.832) -- 0:00:55
244000 -- (-553.180) [-553.454] (-549.701) (-551.992) * (-547.868) (-552.971) [-550.189] (-551.219) -- 0:00:55
244500 -- [-553.110] (-551.068) (-553.287) (-551.465) * (-553.873) (-550.543) [-552.218] (-548.955) -- 0:00:55
245000 -- (-552.125) [-552.674] (-551.919) (-550.404) * [-548.803] (-550.261) (-551.466) (-553.117) -- 0:00:55
Average standard deviation of split frequencies: 0.015756
245500 -- (-550.224) (-552.604) [-550.956] (-552.607) * (-548.207) [-555.535] (-555.490) (-555.082) -- 0:00:55
246000 -- [-554.333] (-555.117) (-551.457) (-550.253) * [-550.136] (-556.504) (-554.151) (-551.506) -- 0:00:55
246500 -- (-552.608) (-552.681) [-549.670] (-552.025) * (-551.619) (-554.610) [-550.790] (-551.153) -- 0:00:55
247000 -- (-557.433) (-549.789) (-548.855) [-554.075] * (-549.886) [-551.626] (-551.093) (-551.392) -- 0:00:54
247500 -- (-555.724) (-556.169) [-548.671] (-550.015) * (-551.169) [-557.681] (-552.471) (-551.436) -- 0:00:54
248000 -- (-553.102) [-553.033] (-553.342) (-553.861) * (-550.687) (-550.090) (-550.548) [-553.080] -- 0:00:54
248500 -- [-550.664] (-554.114) (-551.407) (-550.082) * (-552.143) [-551.933] (-554.932) (-552.150) -- 0:00:54
249000 -- (-551.829) [-549.161] (-551.655) (-554.460) * (-550.175) [-553.121] (-553.938) (-551.145) -- 0:00:54
249500 -- (-551.228) (-549.251) (-555.945) [-550.308] * [-548.488] (-550.974) (-551.581) (-553.141) -- 0:00:54
250000 -- (-552.206) (-548.939) [-550.834] (-553.268) * (-552.511) [-550.222] (-550.582) (-551.487) -- 0:00:54
Average standard deviation of split frequencies: 0.014522
250500 -- [-551.291] (-554.306) (-553.997) (-552.829) * [-551.469] (-551.775) (-550.779) (-552.787) -- 0:00:53
251000 -- (-553.575) (-553.160) [-555.678] (-551.451) * (-551.431) [-552.494] (-553.436) (-550.076) -- 0:00:53
251500 -- (-552.050) (-552.089) [-549.011] (-554.008) * [-549.563] (-550.313) (-555.302) (-556.537) -- 0:00:53
252000 -- (-552.275) [-550.703] (-550.325) (-555.349) * (-550.011) (-552.545) (-554.856) [-550.857] -- 0:00:53
252500 -- [-551.851] (-553.521) (-550.070) (-555.091) * (-548.854) (-548.780) [-552.493] (-553.102) -- 0:00:53
253000 -- (-550.371) (-551.857) [-551.367] (-553.075) * (-552.045) (-553.527) [-552.316] (-552.067) -- 0:00:53
253500 -- (-555.630) [-549.552] (-553.145) (-551.310) * (-551.425) [-550.127] (-551.382) (-552.421) -- 0:00:53
254000 -- (-554.668) (-549.406) [-550.861] (-550.827) * (-551.483) (-550.318) [-549.065] (-558.679) -- 0:00:52
254500 -- (-550.189) [-552.771] (-555.817) (-551.248) * (-553.713) (-551.189) (-549.551) [-557.856] -- 0:00:55
255000 -- (-552.686) (-550.757) (-550.202) [-549.262] * (-553.306) (-552.176) (-550.821) [-556.002] -- 0:00:55
Average standard deviation of split frequencies: 0.013606
255500 -- (-551.452) [-549.190] (-553.818) (-557.566) * [-550.150] (-550.940) (-551.170) (-554.182) -- 0:00:55
256000 -- (-551.998) (-551.895) (-551.601) [-550.921] * (-551.705) (-551.347) [-554.078] (-553.044) -- 0:00:55
256500 -- (-550.654) [-549.268] (-551.646) (-550.851) * (-549.625) (-550.441) (-551.188) [-550.376] -- 0:00:55
257000 -- (-551.207) (-552.133) (-552.668) [-550.935] * (-550.258) (-550.903) (-553.616) [-551.272] -- 0:00:54
257500 -- [-551.500] (-550.884) (-556.856) (-549.060) * (-549.556) (-553.265) (-554.489) [-548.455] -- 0:00:54
258000 -- (-549.026) (-551.629) (-553.607) [-552.332] * (-550.542) (-551.865) (-552.037) [-550.978] -- 0:00:54
258500 -- (-551.804) (-552.622) [-552.499] (-558.190) * (-555.859) (-550.307) [-553.202] (-549.970) -- 0:00:54
259000 -- (-551.385) [-555.187] (-550.960) (-549.306) * (-552.257) [-551.373] (-551.038) (-552.421) -- 0:00:54
259500 -- [-549.766] (-552.258) (-552.655) (-549.898) * [-549.883] (-555.063) (-552.881) (-552.495) -- 0:00:54
260000 -- (-550.446) (-553.870) [-552.327] (-551.066) * (-548.680) [-557.240] (-551.490) (-552.360) -- 0:00:54
Average standard deviation of split frequencies: 0.013563
260500 -- (-557.439) (-553.262) (-550.555) [-551.388] * [-550.702] (-549.937) (-552.832) (-551.087) -- 0:00:53
261000 -- [-549.944] (-550.593) (-551.944) (-552.881) * (-551.978) (-548.705) (-550.342) [-549.851] -- 0:00:53
261500 -- [-549.033] (-550.999) (-550.851) (-550.857) * [-551.327] (-553.074) (-553.039) (-550.542) -- 0:00:53
262000 -- [-549.747] (-550.250) (-550.677) (-555.843) * [-550.159] (-552.130) (-551.420) (-551.398) -- 0:00:53
262500 -- (-550.529) [-550.396] (-549.461) (-552.460) * (-552.210) (-550.963) (-557.127) [-550.942] -- 0:00:53
263000 -- [-551.177] (-554.424) (-550.414) (-552.815) * (-553.642) [-551.943] (-554.192) (-551.782) -- 0:00:53
263500 -- (-550.667) [-550.587] (-550.723) (-553.250) * [-551.417] (-552.551) (-554.688) (-551.692) -- 0:00:53
264000 -- (-549.227) (-550.689) (-553.331) [-549.359] * (-548.407) (-551.033) [-549.792] (-551.822) -- 0:00:52
264500 -- [-549.558] (-551.302) (-553.475) (-552.579) * (-550.614) (-554.235) [-552.542] (-550.788) -- 0:00:52
265000 -- [-551.802] (-552.925) (-552.990) (-553.169) * (-548.881) (-557.305) (-555.112) [-552.408] -- 0:00:52
Average standard deviation of split frequencies: 0.014644
265500 -- [-549.059] (-552.387) (-549.872) (-550.501) * (-549.669) (-551.767) [-554.531] (-553.255) -- 0:00:52
266000 -- (-551.272) [-552.161] (-549.623) (-551.462) * (-551.740) (-552.410) [-553.971] (-554.033) -- 0:00:52
266500 -- (-548.501) (-550.216) (-550.064) [-550.940] * (-550.168) (-550.690) (-553.599) [-551.887] -- 0:00:52
267000 -- (-549.658) [-549.669] (-552.512) (-550.848) * (-552.096) [-551.321] (-549.684) (-553.916) -- 0:00:52
267500 -- [-549.057] (-550.076) (-552.897) (-550.902) * (-549.156) (-551.788) [-550.700] (-553.412) -- 0:00:52
268000 -- (-551.084) (-551.126) [-553.979] (-554.066) * (-550.153) (-552.354) (-551.413) [-552.591] -- 0:00:51
268500 -- (-549.049) (-551.089) [-551.108] (-550.678) * [-552.320] (-550.738) (-557.443) (-552.884) -- 0:00:54
269000 -- (-549.108) (-551.621) [-553.628] (-552.931) * (-554.605) [-552.952] (-555.725) (-552.098) -- 0:00:54
269500 -- (-549.420) (-552.912) [-552.300] (-549.971) * (-552.756) (-553.677) (-551.893) [-551.169] -- 0:00:54
270000 -- [-556.755] (-550.098) (-551.690) (-552.485) * (-552.787) [-552.521] (-553.364) (-550.821) -- 0:00:54
Average standard deviation of split frequencies: 0.014417
270500 -- (-551.182) (-550.781) [-553.118] (-550.579) * (-552.058) [-553.584] (-552.238) (-551.357) -- 0:00:53
271000 -- (-548.351) (-549.727) (-553.346) [-550.554] * (-552.399) (-554.984) [-551.272] (-550.166) -- 0:00:53
271500 -- (-551.994) [-551.760] (-550.729) (-552.524) * (-551.508) (-550.674) (-553.930) [-550.812] -- 0:00:53
272000 -- (-551.420) [-552.058] (-551.924) (-553.682) * (-551.118) (-550.039) [-550.291] (-551.511) -- 0:00:53
272500 -- (-550.405) (-553.550) (-553.531) [-552.201] * (-551.593) (-550.583) (-549.906) [-552.358] -- 0:00:53
273000 -- (-549.975) (-551.783) (-550.576) [-551.296] * (-553.680) (-552.084) [-550.762] (-550.563) -- 0:00:53
273500 -- (-552.431) (-550.099) [-551.770] (-551.791) * (-552.395) (-552.834) (-550.172) [-551.506] -- 0:00:53
274000 -- [-554.410] (-551.000) (-550.411) (-553.652) * [-554.542] (-556.874) (-550.048) (-552.471) -- 0:00:52
274500 -- (-552.263) (-551.476) (-551.726) [-552.277] * [-551.268] (-553.177) (-549.837) (-557.017) -- 0:00:52
275000 -- (-550.288) [-552.022] (-553.010) (-550.458) * [-550.470] (-553.746) (-553.547) (-555.273) -- 0:00:52
Average standard deviation of split frequencies: 0.014669
275500 -- (-552.569) (-550.410) [-550.221] (-551.344) * (-550.014) [-551.950] (-551.016) (-554.654) -- 0:00:52
276000 -- (-550.960) (-557.795) [-550.728] (-552.899) * (-552.881) (-553.875) [-554.315] (-551.896) -- 0:00:52
276500 -- (-550.681) (-551.744) (-552.573) [-554.573] * (-549.764) [-551.109] (-553.216) (-551.117) -- 0:00:52
277000 -- (-549.893) (-555.054) (-553.407) [-549.500] * (-552.536) (-550.423) (-551.587) [-553.520] -- 0:00:52
277500 -- [-550.028] (-556.417) (-552.838) (-551.369) * (-550.498) (-551.568) (-552.453) [-551.788] -- 0:00:52
278000 -- (-552.586) (-550.043) (-553.187) [-553.093] * [-551.970] (-554.015) (-553.169) (-552.090) -- 0:00:51
278500 -- (-552.525) [-552.912] (-551.207) (-553.344) * [-550.392] (-550.340) (-553.830) (-551.527) -- 0:00:51
279000 -- (-550.664) (-550.591) (-553.377) [-549.090] * (-550.165) (-552.323) (-550.279) [-549.630] -- 0:00:51
279500 -- (-549.404) [-550.505] (-556.033) (-550.942) * (-552.009) (-550.458) [-551.803] (-549.849) -- 0:00:51
280000 -- [-549.486] (-550.517) (-554.198) (-556.699) * (-550.895) [-551.327] (-552.768) (-554.455) -- 0:00:51
Average standard deviation of split frequencies: 0.013733
280500 -- (-551.640) (-551.337) (-553.501) [-554.292] * (-554.145) (-551.027) [-550.783] (-551.275) -- 0:00:51
281000 -- (-552.221) [-550.782] (-557.362) (-551.700) * (-551.015) [-551.440] (-550.348) (-550.026) -- 0:00:51
281500 -- (-552.445) (-554.405) (-554.917) [-550.604] * [-551.139] (-549.899) (-550.469) (-551.908) -- 0:00:51
282000 -- (-551.523) (-555.397) (-554.219) [-550.862] * (-551.965) [-550.060] (-552.633) (-548.181) -- 0:00:50
282500 -- (-549.622) [-551.008] (-552.014) (-553.552) * (-551.534) (-552.499) (-550.009) [-549.110] -- 0:00:53
283000 -- [-549.989] (-551.817) (-553.001) (-550.730) * (-550.577) (-549.358) [-552.933] (-550.062) -- 0:00:53
283500 -- [-552.158] (-550.089) (-552.639) (-550.511) * (-550.978) (-551.339) [-555.633] (-549.254) -- 0:00:53
284000 -- (-554.098) (-550.354) [-551.898] (-552.084) * (-553.019) [-551.256] (-558.315) (-552.932) -- 0:00:52
284500 -- (-551.909) [-550.130] (-553.382) (-551.128) * (-552.183) (-555.306) (-549.606) [-550.137] -- 0:00:52
285000 -- (-555.941) [-550.487] (-556.105) (-551.895) * (-552.347) (-554.052) [-550.856] (-552.118) -- 0:00:52
Average standard deviation of split frequencies: 0.014156
285500 -- (-551.973) (-554.275) (-551.639) [-550.447] * (-553.292) (-551.233) [-550.530] (-563.343) -- 0:00:52
286000 -- (-551.903) (-549.250) (-550.593) [-553.924] * (-550.862) (-550.441) (-551.101) [-552.109] -- 0:00:52
286500 -- [-548.725] (-555.023) (-552.106) (-556.377) * (-556.054) (-551.605) (-551.128) [-550.295] -- 0:00:52
287000 -- [-549.492] (-553.484) (-551.723) (-552.452) * (-550.809) (-551.768) (-551.709) [-551.507] -- 0:00:52
287500 -- [-551.311] (-549.545) (-556.137) (-550.861) * (-551.582) [-551.702] (-550.162) (-552.384) -- 0:00:52
288000 -- [-548.775] (-554.018) (-553.296) (-551.726) * [-551.116] (-549.538) (-552.058) (-554.058) -- 0:00:51
288500 -- (-551.282) [-550.323] (-554.481) (-552.391) * (-551.946) (-552.508) (-552.126) [-554.246] -- 0:00:51
289000 -- [-549.477] (-549.996) (-552.912) (-553.916) * (-550.971) (-553.516) [-552.811] (-552.149) -- 0:00:51
289500 -- (-550.854) [-548.573] (-553.785) (-552.049) * [-550.762] (-551.306) (-551.975) (-551.447) -- 0:00:51
290000 -- (-555.930) [-548.114] (-551.508) (-552.407) * (-551.387) (-552.522) [-551.597] (-550.775) -- 0:00:51
Average standard deviation of split frequencies: 0.014501
290500 -- [-550.982] (-548.919) (-553.145) (-554.589) * (-551.122) (-549.498) [-550.645] (-551.292) -- 0:00:51
291000 -- (-552.714) (-552.090) [-549.390] (-548.549) * [-550.189] (-550.348) (-551.948) (-551.880) -- 0:00:51
291500 -- (-552.389) (-551.313) [-551.245] (-557.113) * (-551.132) [-553.239] (-551.908) (-552.857) -- 0:00:51
292000 -- (-550.110) [-551.207] (-552.231) (-554.184) * (-554.883) (-550.484) (-548.501) [-551.738] -- 0:00:50
292500 -- (-552.955) (-550.610) (-551.173) [-548.902] * (-551.134) (-556.209) [-551.004] (-552.937) -- 0:00:50
293000 -- (-550.663) (-551.601) [-551.535] (-553.616) * (-550.754) [-551.333] (-557.106) (-553.460) -- 0:00:50
293500 -- (-551.578) [-550.581] (-553.355) (-551.839) * (-553.702) (-556.317) (-558.125) [-550.724] -- 0:00:50
294000 -- (-549.922) [-551.133] (-550.667) (-551.297) * (-550.452) (-549.810) [-551.491] (-551.229) -- 0:00:50
294500 -- [-552.647] (-553.283) (-553.341) (-550.194) * [-550.493] (-548.881) (-550.283) (-550.199) -- 0:00:50
295000 -- (-553.669) (-549.568) (-551.054) [-550.964] * (-551.484) [-550.063] (-550.881) (-553.894) -- 0:00:50
Average standard deviation of split frequencies: 0.014895
295500 -- (-551.235) (-551.261) (-555.657) [-549.213] * (-549.929) (-552.464) [-551.361] (-552.911) -- 0:00:50
296000 -- (-550.111) (-553.811) (-550.865) [-551.320] * [-550.250] (-550.314) (-551.559) (-553.279) -- 0:00:52
296500 -- (-554.169) (-550.660) [-551.450] (-548.594) * (-554.490) (-548.870) [-550.505] (-549.639) -- 0:00:52
297000 -- (-550.472) (-550.026) (-551.548) [-549.057] * (-551.713) [-550.281] (-553.212) (-551.438) -- 0:00:52
297500 -- [-554.063] (-549.504) (-552.259) (-550.960) * (-553.542) (-550.935) (-554.527) [-550.481] -- 0:00:51
298000 -- [-551.996] (-550.179) (-552.504) (-553.055) * (-551.568) (-551.210) (-554.307) [-551.917] -- 0:00:51
298500 -- [-550.012] (-551.528) (-557.188) (-554.469) * (-550.799) (-549.528) [-550.858] (-550.564) -- 0:00:51
299000 -- (-554.097) [-550.460] (-553.958) (-556.305) * (-550.675) (-551.791) [-552.519] (-554.203) -- 0:00:51
299500 -- (-553.830) [-551.401] (-551.929) (-554.070) * (-549.870) [-551.385] (-551.907) (-552.828) -- 0:00:51
300000 -- (-556.328) (-550.568) (-556.228) [-548.545] * (-548.889) (-550.211) [-550.443] (-553.402) -- 0:00:51
Average standard deviation of split frequencies: 0.014849
300500 -- [-555.180] (-550.620) (-553.596) (-552.861) * (-551.717) [-552.487] (-554.040) (-551.493) -- 0:00:51
301000 -- (-551.215) (-550.579) [-551.689] (-552.315) * [-551.631] (-552.296) (-553.150) (-550.707) -- 0:00:51
301500 -- (-550.784) (-553.053) [-551.050] (-549.471) * (-555.548) (-552.866) [-558.540] (-549.493) -- 0:00:50
302000 -- (-548.907) [-551.613] (-551.050) (-549.953) * (-551.408) (-550.696) (-552.114) [-551.137] -- 0:00:50
302500 -- (-548.841) [-551.214] (-551.711) (-553.717) * (-551.789) (-550.233) [-548.885] (-548.730) -- 0:00:50
303000 -- (-549.709) [-550.463] (-556.480) (-550.201) * [-551.664] (-551.983) (-555.395) (-548.778) -- 0:00:50
303500 -- (-551.932) (-551.767) (-553.479) [-552.799] * (-551.368) [-552.871] (-555.130) (-553.179) -- 0:00:50
304000 -- (-549.660) (-549.090) (-551.604) [-549.849] * (-550.656) [-551.183] (-553.637) (-550.121) -- 0:00:50
304500 -- [-551.272] (-550.476) (-551.258) (-552.104) * [-555.537] (-551.479) (-551.321) (-552.149) -- 0:00:50
305000 -- (-548.216) (-549.568) [-550.555] (-549.278) * [-550.467] (-555.258) (-551.125) (-554.373) -- 0:00:50
Average standard deviation of split frequencies: 0.015405
305500 -- [-549.255] (-550.127) (-551.253) (-547.675) * [-551.005] (-554.001) (-550.683) (-551.255) -- 0:00:50
306000 -- [-553.067] (-550.203) (-549.973) (-550.964) * (-550.870) (-551.340) (-553.066) [-549.802] -- 0:00:49
306500 -- (-552.243) (-550.274) [-550.130] (-549.498) * [-550.487] (-551.916) (-552.952) (-549.925) -- 0:00:49
307000 -- (-552.459) [-548.777] (-550.938) (-551.198) * (-554.837) [-550.206] (-549.835) (-551.784) -- 0:00:49
307500 -- (-550.469) (-552.511) (-550.807) [-548.894] * (-551.065) (-556.153) (-551.444) [-550.884] -- 0:00:49
308000 -- [-549.649] (-551.062) (-551.746) (-550.369) * (-551.750) (-550.162) [-550.930] (-551.793) -- 0:00:49
308500 -- (-550.491) (-553.665) [-548.961] (-550.238) * [-552.533] (-550.978) (-550.540) (-550.413) -- 0:00:49
309000 -- (-550.652) (-552.174) [-550.449] (-552.995) * (-553.631) [-551.582] (-550.635) (-551.425) -- 0:00:49
309500 -- (-551.684) [-552.301] (-549.796) (-551.379) * (-554.825) (-550.446) [-551.034] (-549.460) -- 0:00:51
310000 -- (-553.287) [-551.895] (-550.140) (-549.142) * (-549.993) (-553.713) (-549.700) [-551.028] -- 0:00:51
Average standard deviation of split frequencies: 0.014103
310500 -- (-547.937) (-549.808) (-553.932) [-552.805] * (-556.271) [-549.648] (-548.630) (-551.526) -- 0:00:51
311000 -- [-551.231] (-550.517) (-550.351) (-552.955) * [-553.101] (-549.448) (-551.333) (-550.135) -- 0:00:50
311500 -- (-556.256) (-551.464) (-553.077) [-555.631] * (-551.221) (-551.034) [-549.094] (-550.020) -- 0:00:50
312000 -- (-552.052) (-550.707) (-550.157) [-556.560] * (-550.731) (-551.190) [-549.215] (-547.841) -- 0:00:50
312500 -- (-560.129) [-550.945] (-549.918) (-550.925) * [-551.055] (-551.568) (-551.469) (-552.688) -- 0:00:50
313000 -- (-553.748) [-549.054] (-553.146) (-553.435) * [-551.290] (-550.944) (-549.058) (-551.325) -- 0:00:50
313500 -- (-554.883) (-550.310) [-551.087] (-551.508) * (-550.142) (-550.116) (-551.551) [-550.693] -- 0:00:50
314000 -- [-551.871] (-556.618) (-550.775) (-550.385) * (-549.214) [-550.865] (-551.346) (-550.460) -- 0:00:50
314500 -- [-550.949] (-552.431) (-551.514) (-551.360) * [-551.969] (-551.428) (-549.706) (-548.594) -- 0:00:50
315000 -- (-550.480) (-554.938) [-551.014] (-557.277) * (-550.722) (-550.621) [-549.499] (-551.894) -- 0:00:50
Average standard deviation of split frequencies: 0.014669
315500 -- [-550.120] (-553.484) (-549.770) (-554.659) * (-552.033) [-552.184] (-551.353) (-554.349) -- 0:00:49
316000 -- (-552.217) (-553.130) (-550.008) [-551.757] * [-551.699] (-551.032) (-548.868) (-550.342) -- 0:00:49
316500 -- (-550.368) (-554.810) (-551.620) [-553.742] * (-552.207) (-553.322) (-547.726) [-552.907] -- 0:00:49
317000 -- (-550.051) [-552.321] (-552.229) (-553.371) * (-552.134) (-551.760) [-548.585] (-554.302) -- 0:00:49
317500 -- (-549.528) (-552.788) (-557.391) [-552.159] * (-552.465) (-550.876) [-551.659] (-553.842) -- 0:00:49
318000 -- [-552.062] (-549.146) (-552.049) (-551.591) * (-548.879) (-552.343) [-549.700] (-551.980) -- 0:00:49
318500 -- (-550.062) (-551.601) [-551.008] (-554.716) * (-555.741) (-555.885) [-550.178] (-556.486) -- 0:00:49
319000 -- [-550.860] (-550.571) (-553.024) (-551.439) * (-551.653) (-552.784) [-552.096] (-554.803) -- 0:00:49
319500 -- [-550.855] (-551.322) (-550.705) (-554.090) * [-548.334] (-552.216) (-554.225) (-548.404) -- 0:00:48
320000 -- (-558.929) (-558.856) [-552.532] (-554.191) * (-550.304) (-553.270) (-551.135) [-550.364] -- 0:00:48
Average standard deviation of split frequencies: 0.014517
320500 -- (-548.942) (-553.231) (-548.899) [-552.280] * (-553.184) (-552.118) [-550.318] (-557.122) -- 0:00:48
321000 -- (-555.135) [-552.074] (-550.154) (-554.683) * (-551.021) [-550.340] (-549.350) (-551.688) -- 0:00:48
321500 -- (-549.711) (-550.881) (-548.691) [-551.435] * [-551.376] (-554.260) (-552.129) (-550.856) -- 0:00:48
322000 -- [-552.124] (-552.747) (-549.655) (-549.936) * [-548.888] (-555.386) (-554.707) (-555.004) -- 0:00:48
322500 -- [-549.694] (-552.179) (-552.051) (-556.086) * (-550.492) (-551.853) [-554.117] (-554.467) -- 0:00:48
323000 -- (-552.099) (-550.149) (-549.695) [-553.049] * (-553.484) [-550.087] (-554.060) (-553.031) -- 0:00:48
323500 -- (-552.050) [-549.734] (-549.195) (-552.241) * (-551.499) (-551.580) (-553.744) [-550.839] -- 0:00:50
324000 -- [-550.249] (-555.412) (-550.753) (-550.125) * (-554.313) [-551.153] (-550.633) (-556.541) -- 0:00:50
324500 -- (-552.989) [-554.317] (-551.675) (-550.704) * (-547.661) (-550.366) [-552.144] (-550.556) -- 0:00:49
325000 -- (-556.300) (-550.472) [-553.217] (-552.980) * [-552.154] (-555.042) (-554.286) (-552.712) -- 0:00:49
Average standard deviation of split frequencies: 0.014035
325500 -- [-551.788] (-558.717) (-551.118) (-552.405) * (-554.655) (-554.748) [-550.978] (-554.444) -- 0:00:49
326000 -- [-549.882] (-553.379) (-549.997) (-551.229) * (-552.722) [-551.525] (-554.342) (-551.935) -- 0:00:49
326500 -- (-551.514) (-552.720) [-552.329] (-551.368) * (-551.492) [-554.864] (-549.805) (-551.708) -- 0:00:49
327000 -- [-551.334] (-553.605) (-552.617) (-558.966) * [-549.395] (-552.828) (-553.013) (-550.446) -- 0:00:49
327500 -- [-552.314] (-553.293) (-555.249) (-551.767) * (-550.175) [-549.875] (-550.151) (-553.844) -- 0:00:49
328000 -- (-554.780) (-552.260) (-551.669) [-550.209] * [-552.524] (-550.912) (-551.898) (-551.301) -- 0:00:49
328500 -- [-550.274] (-556.148) (-549.138) (-551.507) * (-550.958) (-551.682) (-552.085) [-551.335] -- 0:00:49
329000 -- (-551.143) (-552.273) (-555.178) [-553.678] * (-552.648) (-552.724) [-552.489] (-554.554) -- 0:00:48
329500 -- [-551.654] (-551.491) (-550.599) (-551.716) * (-552.322) (-550.913) [-551.805] (-554.832) -- 0:00:48
330000 -- (-551.945) (-550.560) [-552.698] (-552.614) * [-549.353] (-554.291) (-552.162) (-555.300) -- 0:00:48
Average standard deviation of split frequencies: 0.014078
330500 -- (-551.340) (-552.325) (-550.310) [-550.317] * (-554.051) (-552.382) [-550.727] (-551.828) -- 0:00:48
331000 -- (-550.829) (-553.172) [-550.026] (-552.097) * (-553.301) [-552.288] (-552.434) (-551.941) -- 0:00:48
331500 -- (-552.660) [-553.699] (-550.894) (-555.911) * (-550.399) (-554.910) (-554.188) [-549.517] -- 0:00:48
332000 -- (-552.949) (-550.519) (-555.015) [-550.427] * (-551.658) [-554.247] (-550.344) (-552.279) -- 0:00:48
332500 -- (-556.162) (-553.757) (-552.360) [-550.773] * (-554.313) [-550.609] (-555.594) (-550.840) -- 0:00:48
333000 -- (-549.169) (-550.440) [-550.628] (-552.352) * (-552.709) (-551.228) (-552.217) [-551.779] -- 0:00:48
333500 -- (-551.310) [-551.959] (-551.463) (-550.332) * [-548.398] (-552.016) (-551.190) (-554.271) -- 0:00:47
334000 -- (-552.112) (-556.245) [-552.246] (-553.051) * (-554.269) (-552.920) (-552.330) [-550.852] -- 0:00:47
334500 -- [-551.611] (-549.031) (-551.550) (-550.989) * [-553.025] (-551.602) (-551.421) (-550.715) -- 0:00:47
335000 -- [-550.622] (-549.779) (-551.832) (-552.389) * (-549.723) (-552.204) [-553.501] (-548.937) -- 0:00:47
Average standard deviation of split frequencies: 0.013065
335500 -- (-550.200) (-549.992) [-556.387] (-551.505) * (-550.842) (-552.799) (-553.469) [-551.512] -- 0:00:47
336000 -- (-549.279) [-549.521] (-553.485) (-551.467) * [-551.723] (-551.431) (-555.123) (-555.138) -- 0:00:47
336500 -- (-552.309) (-549.338) (-551.023) [-553.241] * (-550.338) [-551.543] (-549.804) (-551.018) -- 0:00:47
337000 -- [-550.424] (-551.654) (-550.833) (-551.495) * (-548.960) [-551.859] (-554.763) (-552.223) -- 0:00:47
337500 -- [-550.425] (-552.116) (-550.725) (-553.910) * [-550.352] (-554.031) (-551.647) (-551.373) -- 0:00:49
338000 -- (-550.224) (-553.025) (-554.918) [-552.794] * (-549.346) (-552.568) (-549.976) [-552.116] -- 0:00:48
338500 -- (-551.051) (-551.640) (-551.678) [-552.042] * (-552.129) [-551.997] (-552.836) (-551.989) -- 0:00:48
339000 -- (-550.348) [-549.825] (-551.948) (-552.817) * (-549.901) (-555.284) (-553.126) [-554.016] -- 0:00:48
339500 -- (-549.361) [-552.851] (-553.756) (-550.590) * (-550.148) (-552.011) [-551.294] (-550.264) -- 0:00:48
340000 -- (-551.840) [-553.474] (-552.506) (-554.218) * [-549.849] (-550.972) (-552.971) (-550.176) -- 0:00:48
Average standard deviation of split frequencies: 0.013319
340500 -- (-552.186) [-553.471] (-551.647) (-552.990) * (-555.446) (-556.040) [-551.726] (-550.690) -- 0:00:48
341000 -- (-549.868) (-555.032) (-553.860) [-550.597] * [-550.842] (-554.205) (-554.642) (-550.759) -- 0:00:48
341500 -- (-550.641) (-557.048) (-554.455) [-550.049] * [-549.907] (-553.668) (-552.145) (-551.247) -- 0:00:48
342000 -- (-551.023) [-558.390] (-555.383) (-550.268) * [-550.176] (-553.064) (-553.347) (-548.886) -- 0:00:48
342500 -- (-551.979) [-550.120] (-550.543) (-550.544) * (-557.373) [-550.310] (-554.110) (-551.133) -- 0:00:47
343000 -- (-552.465) (-551.063) [-550.633] (-554.692) * (-550.796) (-550.480) (-554.634) [-549.610] -- 0:00:47
343500 -- (-554.267) (-554.335) [-551.622] (-551.811) * [-549.945] (-556.172) (-549.818) (-550.515) -- 0:00:47
344000 -- [-554.198] (-554.777) (-554.699) (-554.511) * (-550.678) (-557.965) (-550.474) [-548.912] -- 0:00:47
344500 -- [-551.104] (-551.309) (-551.979) (-553.496) * (-550.128) [-551.751] (-549.577) (-554.380) -- 0:00:47
345000 -- (-552.185) [-550.581] (-555.165) (-553.084) * [-553.294] (-553.085) (-551.958) (-554.390) -- 0:00:47
Average standard deviation of split frequencies: 0.012517
345500 -- [-551.393] (-550.585) (-552.539) (-554.675) * (-551.737) [-553.076] (-551.149) (-552.029) -- 0:00:47
346000 -- (-556.258) (-550.950) [-551.643] (-553.544) * (-551.171) (-550.281) (-552.735) [-552.850] -- 0:00:47
346500 -- [-550.669] (-552.027) (-552.402) (-549.411) * [-552.504] (-555.986) (-551.934) (-551.286) -- 0:00:47
347000 -- (-550.978) (-551.475) (-550.292) [-551.929] * (-549.191) (-552.368) (-550.806) [-549.631] -- 0:00:47
347500 -- (-548.845) [-551.493] (-551.101) (-551.212) * (-552.705) (-552.334) (-551.033) [-548.986] -- 0:00:46
348000 -- (-552.718) [-552.074] (-550.622) (-552.485) * (-557.774) [-550.972] (-555.627) (-554.853) -- 0:00:46
348500 -- (-551.820) (-554.384) (-549.500) [-551.990] * (-552.438) [-548.884] (-552.030) (-552.084) -- 0:00:46
349000 -- (-553.186) [-551.112] (-549.966) (-549.993) * [-551.294] (-549.837) (-553.273) (-550.704) -- 0:00:46
349500 -- (-551.032) [-550.776] (-552.490) (-551.407) * (-552.590) (-553.194) (-549.824) [-553.118] -- 0:00:46
350000 -- (-550.756) (-551.119) (-554.313) [-550.161] * (-551.318) [-554.108] (-554.368) (-552.199) -- 0:00:46
Average standard deviation of split frequencies: 0.012183
350500 -- [-551.442] (-551.681) (-554.146) (-551.160) * (-556.587) (-551.661) [-551.582] (-553.859) -- 0:00:46
351000 -- [-551.967] (-553.899) (-551.790) (-550.384) * (-554.128) [-550.825] (-551.274) (-551.346) -- 0:00:46
351500 -- [-548.427] (-551.683) (-551.370) (-553.050) * [-551.019] (-550.567) (-550.779) (-551.791) -- 0:00:47
352000 -- (-548.938) (-552.960) [-549.457] (-552.722) * (-550.444) (-551.990) [-549.789] (-551.066) -- 0:00:47
352500 -- (-550.604) (-552.136) [-553.879] (-553.215) * (-550.031) (-552.996) [-548.535] (-554.231) -- 0:00:47
353000 -- [-551.351] (-549.373) (-552.479) (-549.789) * (-551.039) (-552.153) (-551.027) [-551.620] -- 0:00:47
353500 -- [-549.667] (-551.349) (-550.908) (-553.829) * (-553.006) (-552.079) [-549.706] (-553.481) -- 0:00:47
354000 -- (-547.539) (-551.493) [-552.483] (-551.436) * [-549.091] (-551.085) (-552.725) (-554.283) -- 0:00:47
354500 -- (-551.374) (-554.832) (-551.605) [-551.346] * [-550.180] (-552.643) (-550.560) (-549.635) -- 0:00:47
355000 -- [-550.190] (-551.087) (-551.222) (-551.417) * [-551.618] (-550.936) (-550.606) (-549.218) -- 0:00:47
Average standard deviation of split frequencies: 0.011835
355500 -- (-551.054) (-551.562) (-552.060) [-551.621] * (-552.496) (-551.848) (-552.907) [-551.564] -- 0:00:47
356000 -- (-549.862) [-550.164] (-554.920) (-553.588) * [-554.047] (-553.508) (-550.228) (-552.302) -- 0:00:47
356500 -- (-550.486) (-552.383) [-551.104] (-549.628) * (-552.356) (-551.145) [-551.534] (-550.926) -- 0:00:46
357000 -- (-552.064) [-552.410] (-552.513) (-550.844) * (-549.941) [-550.993] (-551.147) (-551.744) -- 0:00:46
357500 -- (-550.365) [-550.509] (-553.664) (-549.907) * (-553.264) [-551.610] (-551.378) (-552.127) -- 0:00:46
358000 -- [-550.075] (-550.192) (-551.226) (-551.426) * (-553.121) (-548.900) [-550.255] (-554.191) -- 0:00:46
358500 -- (-550.604) (-553.652) (-549.882) [-551.778] * (-549.771) [-551.040] (-550.957) (-552.371) -- 0:00:46
359000 -- (-550.264) [-550.142] (-551.501) (-552.204) * (-549.826) [-548.877] (-551.627) (-550.226) -- 0:00:46
359500 -- (-554.714) [-550.583] (-551.803) (-552.357) * (-550.163) (-549.812) (-552.522) [-551.791] -- 0:00:46
360000 -- (-553.122) [-550.407] (-557.801) (-550.174) * (-551.318) [-551.386] (-555.372) (-551.165) -- 0:00:46
Average standard deviation of split frequencies: 0.011845
360500 -- (-553.833) (-553.452) [-552.113] (-552.727) * [-550.481] (-549.611) (-551.358) (-550.870) -- 0:00:46
361000 -- (-551.148) (-553.216) [-550.275] (-552.528) * (-549.378) (-550.241) [-550.906] (-550.413) -- 0:00:46
361500 -- (-551.541) (-559.018) (-550.532) [-554.138] * (-553.161) (-551.800) [-552.127] (-551.455) -- 0:00:45
362000 -- (-550.246) (-550.844) [-553.430] (-556.711) * (-552.303) [-551.474] (-553.633) (-552.113) -- 0:00:45
362500 -- (-550.987) (-556.206) [-549.689] (-551.658) * [-551.322] (-551.477) (-555.369) (-552.279) -- 0:00:45
363000 -- (-552.512) [-554.189] (-549.031) (-551.360) * (-550.766) (-550.806) [-550.308] (-550.510) -- 0:00:45
363500 -- [-551.935] (-558.951) (-550.513) (-552.399) * [-549.573] (-550.465) (-552.440) (-550.851) -- 0:00:45
364000 -- (-551.497) (-552.117) (-550.066) [-550.228] * (-557.339) [-550.819] (-550.432) (-552.627) -- 0:00:45
364500 -- (-551.509) (-553.435) (-550.807) [-550.804] * (-552.802) [-552.129] (-556.670) (-553.477) -- 0:00:45
365000 -- (-549.718) (-550.605) [-548.769] (-552.412) * [-552.836] (-549.640) (-551.557) (-558.520) -- 0:00:45
Average standard deviation of split frequencies: 0.012155
365500 -- [-549.426] (-551.105) (-554.526) (-551.622) * [-556.881] (-550.736) (-551.264) (-552.969) -- 0:00:46
366000 -- (-557.768) (-553.322) [-549.940] (-552.384) * (-554.055) [-553.483] (-553.989) (-551.898) -- 0:00:46
366500 -- (-551.292) [-556.824] (-549.054) (-551.501) * (-551.623) [-551.161] (-550.125) (-551.849) -- 0:00:46
367000 -- [-550.499] (-551.005) (-550.886) (-555.652) * [-551.687] (-552.498) (-553.011) (-557.839) -- 0:00:46
367500 -- (-551.013) [-551.565] (-551.356) (-550.108) * (-551.523) [-553.336] (-549.326) (-552.594) -- 0:00:46
368000 -- [-550.480] (-552.326) (-550.361) (-555.068) * (-550.199) (-551.745) (-551.655) [-551.985] -- 0:00:46
368500 -- [-549.456] (-554.911) (-552.855) (-556.072) * (-552.576) (-554.255) [-551.077] (-553.093) -- 0:00:46
369000 -- [-552.075] (-557.425) (-549.827) (-552.472) * (-552.676) (-553.520) [-554.285] (-553.696) -- 0:00:46
369500 -- (-550.358) (-552.806) [-549.478] (-553.724) * (-551.130) (-556.131) [-551.650] (-551.425) -- 0:00:46
370000 -- (-549.982) [-550.985] (-550.668) (-550.879) * (-552.110) (-551.776) [-550.793] (-555.250) -- 0:00:45
Average standard deviation of split frequencies: 0.012161
370500 -- (-550.616) (-551.568) (-551.741) [-553.449] * (-556.316) (-549.459) [-550.803] (-552.614) -- 0:00:45
371000 -- [-549.944] (-550.597) (-551.822) (-550.179) * (-551.717) [-549.763] (-549.785) (-551.795) -- 0:00:45
371500 -- (-550.309) (-549.997) (-550.487) [-549.844] * [-553.246] (-551.289) (-550.688) (-550.979) -- 0:00:45
372000 -- [-552.643] (-552.372) (-548.731) (-550.299) * (-551.352) [-551.167] (-550.180) (-552.166) -- 0:00:45
372500 -- (-550.478) [-552.583] (-549.547) (-551.374) * [-548.306] (-551.009) (-551.382) (-552.847) -- 0:00:45
373000 -- (-552.648) [-550.695] (-550.375) (-550.558) * [-551.917] (-551.612) (-550.007) (-550.547) -- 0:00:45
373500 -- (-548.644) (-551.384) (-552.600) [-552.425] * (-550.693) (-550.762) [-550.169] (-552.838) -- 0:00:45
374000 -- (-551.218) (-550.631) (-553.157) [-550.678] * (-551.263) (-553.890) [-550.041] (-550.679) -- 0:00:45
374500 -- (-551.248) (-549.361) [-549.426] (-552.905) * (-552.053) [-551.366] (-548.913) (-550.082) -- 0:00:45
375000 -- (-551.937) (-553.079) [-551.298] (-552.839) * (-551.181) (-552.826) [-550.530] (-551.527) -- 0:00:45
Average standard deviation of split frequencies: 0.013791
375500 -- [-551.167] (-556.618) (-551.329) (-556.890) * (-553.421) (-552.140) [-549.515] (-551.336) -- 0:00:44
376000 -- (-549.817) (-553.589) (-554.032) [-553.194] * [-551.391] (-555.865) (-548.909) (-553.148) -- 0:00:44
376500 -- (-553.911) (-550.290) (-551.836) [-552.096] * [-548.975] (-549.816) (-549.066) (-554.031) -- 0:00:44
377000 -- [-548.816] (-549.772) (-551.415) (-551.526) * (-549.961) (-551.403) (-549.142) [-551.261] -- 0:00:44
377500 -- [-554.254] (-551.979) (-555.471) (-551.172) * [-553.441] (-552.279) (-552.277) (-551.788) -- 0:00:44
378000 -- (-556.260) [-551.964] (-557.632) (-549.858) * (-550.794) [-552.227] (-552.149) (-552.373) -- 0:00:44
378500 -- (-550.950) [-552.618] (-549.614) (-551.670) * (-552.503) (-552.460) [-548.640] (-551.291) -- 0:00:44
379000 -- (-551.748) [-550.414] (-552.399) (-553.100) * (-553.288) (-553.361) [-548.802] (-550.955) -- 0:00:44
379500 -- (-549.301) [-549.099] (-553.813) (-552.551) * [-553.465] (-550.899) (-549.730) (-550.031) -- 0:00:45
380000 -- (-552.244) (-551.412) (-552.311) [-551.191] * (-550.013) [-551.500] (-554.671) (-550.964) -- 0:00:45
Average standard deviation of split frequencies: 0.013854
380500 -- (-554.620) (-549.147) (-549.577) [-550.913] * (-552.704) (-549.695) (-547.955) [-550.056] -- 0:00:45
381000 -- (-552.355) (-552.273) [-550.672] (-555.503) * (-550.724) (-548.802) [-550.576] (-553.251) -- 0:00:45
381500 -- (-551.044) (-552.471) [-552.180] (-550.616) * [-552.044] (-555.201) (-552.612) (-551.418) -- 0:00:45
382000 -- (-552.576) (-554.108) [-550.430] (-551.465) * (-553.445) [-550.397] (-550.580) (-551.470) -- 0:00:45
382500 -- (-550.586) (-552.757) (-552.771) [-551.759] * (-555.644) [-551.950] (-551.640) (-550.201) -- 0:00:45
383000 -- (-551.574) (-549.118) [-552.741] (-556.783) * (-552.457) (-550.288) [-549.146] (-553.277) -- 0:00:45
383500 -- [-552.872] (-549.785) (-552.710) (-556.792) * [-552.147] (-552.188) (-551.172) (-551.508) -- 0:00:45
384000 -- (-555.455) (-553.403) [-552.210] (-551.918) * (-552.715) [-556.328] (-549.237) (-554.506) -- 0:00:44
384500 -- (-550.930) (-550.559) (-551.031) [-554.970] * (-553.917) [-551.699] (-552.640) (-556.023) -- 0:00:44
385000 -- (-551.210) [-550.373] (-550.705) (-551.477) * [-549.665] (-551.124) (-551.277) (-551.755) -- 0:00:44
Average standard deviation of split frequencies: 0.013968
385500 -- [-557.684] (-550.622) (-552.188) (-555.819) * (-551.867) (-551.182) [-552.556] (-550.623) -- 0:00:44
386000 -- (-556.123) (-553.727) [-552.469] (-553.376) * [-551.934] (-549.231) (-550.312) (-550.616) -- 0:00:44
386500 -- (-551.302) [-551.731] (-549.120) (-555.623) * (-550.811) (-558.509) [-550.876] (-551.158) -- 0:00:44
387000 -- [-552.899] (-551.616) (-549.694) (-553.116) * (-551.758) (-552.921) [-554.280] (-551.909) -- 0:00:44
387500 -- [-554.359] (-553.994) (-555.574) (-552.247) * (-549.968) [-551.406] (-552.780) (-552.115) -- 0:00:44
388000 -- [-551.890] (-554.433) (-558.787) (-554.359) * (-554.694) (-551.298) (-552.021) [-551.812] -- 0:00:44
388500 -- [-550.465] (-551.916) (-553.899) (-553.531) * (-551.682) (-551.843) (-550.474) [-550.297] -- 0:00:44
389000 -- (-553.334) [-550.432] (-548.430) (-554.178) * (-550.516) [-552.997] (-549.965) (-553.926) -- 0:00:43
389500 -- (-550.977) (-550.629) [-548.578] (-551.923) * (-552.463) (-552.305) (-551.048) [-551.177] -- 0:00:43
390000 -- [-551.937] (-551.518) (-551.403) (-551.064) * [-553.661] (-552.481) (-551.829) (-553.549) -- 0:00:43
Average standard deviation of split frequencies: 0.013273
390500 -- (-553.871) (-555.321) (-552.238) [-554.558] * [-550.981] (-554.235) (-550.068) (-551.077) -- 0:00:43
391000 -- (-550.263) (-551.095) [-547.921] (-551.512) * (-551.525) [-554.130] (-549.722) (-551.534) -- 0:00:43
391500 -- (-550.574) (-549.981) (-551.082) [-549.842] * (-551.557) (-551.003) [-548.799] (-552.954) -- 0:00:43
392000 -- [-552.108] (-548.132) (-552.689) (-551.154) * [-552.019] (-553.651) (-551.870) (-554.615) -- 0:00:43
392500 -- (-553.152) (-553.061) [-549.848] (-554.264) * (-551.306) (-555.968) [-549.774] (-552.811) -- 0:00:43
393000 -- (-550.493) (-551.222) [-550.141] (-553.133) * (-552.860) (-550.901) [-550.693] (-556.350) -- 0:00:43
393500 -- (-549.690) (-549.303) [-549.740] (-551.105) * (-556.122) [-551.063] (-551.701) (-553.397) -- 0:00:44
394000 -- [-550.568] (-549.534) (-548.003) (-551.363) * (-551.338) (-552.332) (-552.599) [-550.121] -- 0:00:44
394500 -- (-549.500) [-551.830] (-550.114) (-551.623) * (-551.468) (-550.971) (-551.203) [-549.264] -- 0:00:44
395000 -- (-551.660) (-554.288) (-551.664) [-552.460] * [-550.614] (-551.932) (-553.150) (-551.693) -- 0:00:44
Average standard deviation of split frequencies: 0.013392
395500 -- (-549.190) (-553.336) (-549.935) [-551.933] * (-555.707) [-552.472] (-548.179) (-553.454) -- 0:00:44
396000 -- [-551.451] (-550.326) (-550.675) (-550.652) * (-551.401) (-550.936) (-550.707) [-550.717] -- 0:00:44
396500 -- (-550.970) (-551.481) [-550.869] (-550.083) * [-550.453] (-550.994) (-549.188) (-555.314) -- 0:00:44
397000 -- [-550.336] (-551.123) (-549.403) (-552.095) * (-553.572) (-550.347) [-555.361] (-549.753) -- 0:00:44
397500 -- (-549.950) (-552.379) [-551.208] (-551.680) * (-553.670) (-551.968) (-548.214) [-550.416] -- 0:00:43
398000 -- (-554.307) [-549.262] (-551.110) (-552.049) * (-556.916) (-554.092) (-549.133) [-549.162] -- 0:00:43
398500 -- (-553.484) (-551.063) [-548.618] (-553.617) * (-552.151) [-552.312] (-552.846) (-554.821) -- 0:00:43
399000 -- (-551.746) (-550.822) [-548.097] (-551.812) * (-548.651) [-549.597] (-552.333) (-552.512) -- 0:00:43
399500 -- [-551.629] (-550.268) (-549.243) (-553.430) * (-549.824) (-553.218) [-551.262] (-553.081) -- 0:00:43
400000 -- (-550.521) (-549.358) [-549.813] (-554.089) * [-550.678] (-550.704) (-552.934) (-553.960) -- 0:00:43
Average standard deviation of split frequencies: 0.013898
400500 -- (-551.002) (-553.736) [-551.176] (-551.493) * (-553.925) (-552.569) [-553.068] (-552.705) -- 0:00:43
401000 -- (-555.981) (-549.596) [-549.327] (-552.092) * (-555.063) (-550.122) (-548.742) [-553.208] -- 0:00:43
401500 -- (-550.415) (-550.261) (-549.454) [-555.780] * (-553.161) (-551.323) [-550.540] (-552.090) -- 0:00:43
402000 -- (-551.219) (-551.945) [-551.005] (-554.128) * (-551.668) [-549.498] (-551.023) (-550.879) -- 0:00:43
402500 -- (-550.154) (-557.577) [-551.115] (-553.569) * (-555.127) (-550.892) [-552.360] (-552.251) -- 0:00:43
403000 -- (-553.812) (-552.405) [-549.561] (-553.771) * (-552.902) (-549.652) [-553.922] (-551.410) -- 0:00:42
403500 -- (-554.748) (-556.111) [-551.449] (-551.485) * (-551.852) [-551.109] (-551.325) (-552.698) -- 0:00:42
404000 -- (-553.741) [-553.043] (-550.452) (-551.169) * (-551.563) (-554.580) (-551.575) [-550.734] -- 0:00:42
404500 -- (-553.508) (-553.081) [-553.053] (-552.349) * [-551.045] (-549.318) (-549.344) (-551.128) -- 0:00:42
405000 -- (-551.120) (-552.046) [-555.057] (-551.619) * (-553.155) (-553.476) [-549.760] (-551.693) -- 0:00:42
Average standard deviation of split frequencies: 0.013062
405500 -- (-551.959) [-550.485] (-551.206) (-554.199) * [-550.724] (-548.976) (-549.841) (-555.402) -- 0:00:42
406000 -- (-552.325) (-552.669) [-553.114] (-551.056) * (-551.687) (-551.175) [-552.114] (-551.629) -- 0:00:42
406500 -- (-554.935) (-555.690) (-553.002) [-550.389] * [-555.477] (-556.833) (-548.716) (-551.590) -- 0:00:42
407000 -- (-552.884) (-550.813) [-551.405] (-552.971) * (-555.078) (-549.066) (-550.113) [-551.361] -- 0:00:42
407500 -- [-549.164] (-554.221) (-550.733) (-550.511) * (-552.415) (-550.525) (-548.218) [-550.252] -- 0:00:43
408000 -- (-550.479) (-550.654) [-549.960] (-551.238) * (-552.956) (-555.487) (-552.116) [-551.344] -- 0:00:43
408500 -- (-555.040) (-550.637) (-549.512) [-552.349] * (-551.381) (-550.417) [-550.532] (-551.791) -- 0:00:43
409000 -- (-551.216) (-550.019) [-550.247] (-552.286) * [-550.296] (-550.052) (-554.159) (-554.236) -- 0:00:43
409500 -- (-550.105) (-549.676) (-550.789) [-550.117] * (-553.273) [-550.401] (-550.524) (-550.919) -- 0:00:43
410000 -- [-551.743] (-550.896) (-551.160) (-551.381) * (-552.433) [-554.318] (-551.388) (-552.828) -- 0:00:43
Average standard deviation of split frequencies: 0.012842
410500 -- [-549.570] (-551.455) (-550.873) (-550.534) * [-551.807] (-556.605) (-550.525) (-551.834) -- 0:00:43
411000 -- [-548.116] (-550.856) (-549.819) (-553.937) * (-551.058) (-552.457) (-553.128) [-550.275] -- 0:00:42
411500 -- [-549.562] (-552.798) (-551.236) (-551.045) * (-550.685) (-553.119) [-550.512] (-550.150) -- 0:00:42
412000 -- (-550.419) (-550.789) [-551.813] (-551.734) * [-554.007] (-551.547) (-555.599) (-550.293) -- 0:00:42
412500 -- (-552.464) (-555.803) (-552.572) [-553.176] * (-549.203) [-550.525] (-553.933) (-550.514) -- 0:00:42
413000 -- (-555.586) (-555.200) [-551.553] (-552.748) * (-551.327) (-551.264) (-552.501) [-550.609] -- 0:00:42
413500 -- [-547.896] (-553.787) (-551.697) (-553.121) * (-549.313) (-552.594) (-552.372) [-555.872] -- 0:00:42
414000 -- (-550.193) (-554.026) [-550.556] (-555.120) * (-550.917) (-553.596) (-558.278) [-551.032] -- 0:00:42
414500 -- (-551.897) (-552.182) [-549.991] (-551.020) * [-551.132] (-549.443) (-552.691) (-551.039) -- 0:00:42
415000 -- (-549.496) [-550.641] (-549.544) (-552.903) * (-551.735) (-552.600) (-554.478) [-551.702] -- 0:00:42
Average standard deviation of split frequencies: 0.014023
415500 -- (-551.154) (-552.818) (-554.561) [-549.622] * (-553.091) (-550.752) [-548.064] (-550.231) -- 0:00:42
416000 -- (-554.507) (-551.269) (-557.746) [-552.364] * (-549.555) (-554.528) [-552.087] (-552.345) -- 0:00:42
416500 -- [-552.076] (-554.900) (-552.882) (-551.607) * (-551.409) (-551.713) (-552.992) [-552.073] -- 0:00:42
417000 -- [-550.442] (-554.804) (-551.829) (-551.738) * [-550.972] (-553.311) (-550.732) (-552.762) -- 0:00:41
417500 -- [-552.307] (-554.281) (-551.845) (-551.289) * [-552.717] (-550.589) (-548.959) (-549.572) -- 0:00:41
418000 -- (-552.137) (-557.392) (-553.399) [-553.861] * (-554.391) (-550.056) (-548.680) [-551.107] -- 0:00:41
418500 -- (-551.040) (-555.630) [-548.507] (-556.887) * [-552.229] (-552.141) (-554.816) (-552.894) -- 0:00:41
419000 -- [-552.921] (-552.138) (-549.500) (-551.489) * (-556.118) (-551.550) (-552.027) [-553.954] -- 0:00:41
419500 -- (-550.557) (-553.093) [-550.368] (-551.000) * (-550.294) [-551.688] (-551.301) (-552.461) -- 0:00:41
420000 -- [-552.344] (-552.332) (-550.030) (-553.684) * (-552.338) [-553.110] (-550.381) (-554.001) -- 0:00:41
Average standard deviation of split frequencies: 0.012327
420500 -- (-549.268) [-550.925] (-549.907) (-552.766) * (-553.090) [-551.566] (-552.009) (-552.015) -- 0:00:41
421000 -- (-551.651) [-550.497] (-556.259) (-551.298) * (-551.150) (-549.839) [-552.678] (-550.596) -- 0:00:41
421500 -- [-549.179] (-556.698) (-550.565) (-552.642) * (-555.109) (-553.366) (-551.839) [-549.993] -- 0:00:42
422000 -- (-550.061) [-552.865] (-554.379) (-556.766) * [-553.617] (-553.794) (-554.011) (-549.933) -- 0:00:42
422500 -- [-550.174] (-551.188) (-551.565) (-552.655) * (-550.474) (-548.948) (-551.969) [-551.406] -- 0:00:42
423000 -- (-553.323) [-552.578] (-552.718) (-551.966) * [-552.033] (-552.385) (-556.179) (-550.337) -- 0:00:42
423500 -- [-552.381] (-553.592) (-550.631) (-549.663) * (-552.030) [-554.231] (-556.772) (-551.548) -- 0:00:42
424000 -- (-551.458) [-552.154] (-553.891) (-554.019) * (-552.659) [-550.296] (-560.564) (-549.069) -- 0:00:42
424500 -- (-551.884) (-550.761) [-552.204] (-551.071) * (-553.688) (-554.720) [-553.081] (-550.369) -- 0:00:42
425000 -- (-552.662) (-551.015) (-551.825) [-552.378] * (-554.089) (-554.089) (-550.440) [-550.634] -- 0:00:41
Average standard deviation of split frequencies: 0.012242
425500 -- (-550.701) (-552.053) (-551.446) [-550.535] * (-552.343) (-551.621) [-550.586] (-556.529) -- 0:00:41
426000 -- (-550.174) (-553.300) [-551.132] (-551.035) * [-552.502] (-552.118) (-550.810) (-552.041) -- 0:00:41
426500 -- (-552.595) [-550.966] (-555.133) (-553.722) * (-552.541) (-555.488) [-552.243] (-556.987) -- 0:00:41
427000 -- (-551.010) [-550.595] (-551.699) (-552.087) * (-553.843) [-551.725] (-551.477) (-558.526) -- 0:00:41
427500 -- (-550.152) (-551.160) (-554.698) [-550.772] * (-550.034) (-550.718) [-551.977] (-556.336) -- 0:00:41
428000 -- (-550.771) (-553.019) [-550.030] (-553.066) * [-550.895] (-552.509) (-551.129) (-550.314) -- 0:00:41
428500 -- [-552.131] (-551.116) (-551.514) (-552.344) * (-551.250) (-551.055) (-554.830) [-553.202] -- 0:00:41
429000 -- [-551.320] (-551.378) (-550.440) (-550.530) * (-551.141) (-550.270) [-550.695] (-551.838) -- 0:00:41
429500 -- (-550.842) (-551.719) (-551.148) [-550.210] * [-549.298] (-549.265) (-551.149) (-548.626) -- 0:00:41
430000 -- (-553.966) (-551.007) [-549.325] (-549.881) * (-552.659) (-552.199) [-550.058] (-551.384) -- 0:00:41
Average standard deviation of split frequencies: 0.012519
430500 -- (-551.161) [-550.667] (-553.088) (-555.027) * [-557.048] (-549.683) (-550.974) (-551.972) -- 0:00:41
431000 -- (-553.746) (-549.883) [-550.715] (-551.407) * (-553.376) [-551.943] (-551.050) (-548.952) -- 0:00:40
431500 -- [-551.436] (-550.992) (-552.148) (-552.148) * [-552.535] (-549.347) (-551.174) (-551.440) -- 0:00:40
432000 -- [-550.926] (-552.573) (-552.984) (-555.292) * [-551.193] (-552.383) (-555.595) (-552.163) -- 0:00:40
432500 -- (-554.844) (-551.668) [-550.734] (-552.299) * (-552.252) [-556.260] (-551.014) (-552.339) -- 0:00:40
433000 -- (-551.608) (-551.521) (-549.312) [-551.761] * (-553.188) (-555.168) [-551.548] (-551.545) -- 0:00:40
433500 -- (-551.913) (-552.989) [-550.011] (-552.948) * (-556.163) (-550.961) [-552.114] (-552.090) -- 0:00:40
434000 -- (-557.588) (-553.476) (-554.661) [-553.561] * [-550.137] (-550.096) (-551.838) (-555.535) -- 0:00:40
434500 -- (-554.301) (-554.804) [-551.137] (-552.481) * [-550.426] (-552.554) (-551.376) (-551.135) -- 0:00:40
435000 -- (-549.947) [-551.836] (-549.365) (-551.310) * (-551.203) (-550.623) (-551.543) [-553.334] -- 0:00:40
Average standard deviation of split frequencies: 0.013447
435500 -- (-555.372) (-552.029) (-550.588) [-559.990] * (-551.691) (-550.257) [-550.461] (-551.930) -- 0:00:41
436000 -- (-552.655) (-551.403) (-552.559) [-553.220] * (-551.893) [-550.698] (-551.623) (-554.860) -- 0:00:41
436500 -- (-553.101) (-551.659) [-552.512] (-555.128) * (-552.564) [-549.161] (-554.012) (-552.183) -- 0:00:41
437000 -- [-554.746] (-549.211) (-550.645) (-554.045) * (-552.157) (-550.681) [-552.671] (-552.211) -- 0:00:41
437500 -- (-550.997) (-549.778) [-550.258] (-553.717) * (-552.638) (-550.708) (-550.797) [-552.295] -- 0:00:41
438000 -- (-549.782) [-550.611] (-550.052) (-551.381) * (-553.372) [-549.795] (-550.977) (-553.151) -- 0:00:41
438500 -- [-552.723] (-550.457) (-550.623) (-549.553) * (-554.069) [-553.583] (-554.163) (-551.835) -- 0:00:40
439000 -- (-550.377) (-549.211) (-553.434) [-551.887] * (-550.993) [-550.874] (-550.573) (-553.198) -- 0:00:40
439500 -- (-550.894) (-549.495) (-551.463) [-550.856] * [-556.918] (-550.771) (-551.244) (-551.792) -- 0:00:40
440000 -- (-550.418) (-551.433) [-550.956] (-550.684) * [-557.001] (-556.498) (-556.470) (-551.283) -- 0:00:40
Average standard deviation of split frequencies: 0.012703
440500 -- [-550.890] (-550.866) (-550.731) (-551.570) * (-549.026) (-549.289) (-552.382) [-550.083] -- 0:00:40
441000 -- (-548.007) [-549.748] (-549.656) (-552.095) * (-549.668) (-553.673) (-550.983) [-551.658] -- 0:00:40
441500 -- (-549.585) (-549.562) [-550.642] (-552.720) * (-552.368) (-551.952) (-550.399) [-550.734] -- 0:00:40
442000 -- (-549.799) (-550.837) (-551.181) [-550.935] * (-552.070) [-553.805] (-550.426) (-552.267) -- 0:00:40
442500 -- (-550.968) (-549.952) [-552.071] (-551.714) * (-553.108) (-555.021) [-549.633] (-551.922) -- 0:00:40
443000 -- [-548.772] (-551.400) (-551.716) (-553.460) * (-554.100) (-552.554) [-550.613] (-550.838) -- 0:00:40
443500 -- [-555.464] (-552.601) (-551.639) (-549.238) * (-551.872) (-551.284) [-549.399] (-551.205) -- 0:00:40
444000 -- [-549.112] (-548.571) (-551.377) (-550.125) * (-550.474) (-551.932) (-551.908) [-550.529] -- 0:00:40
444500 -- (-548.387) [-551.793] (-551.281) (-551.085) * (-554.316) [-551.641] (-550.565) (-552.789) -- 0:00:39
445000 -- (-549.254) (-552.076) [-548.093] (-549.235) * (-550.673) [-551.267] (-549.849) (-551.874) -- 0:00:39
Average standard deviation of split frequencies: 0.012551
445500 -- [-549.878] (-549.963) (-548.514) (-551.569) * (-551.739) (-552.903) (-551.068) [-551.261] -- 0:00:39
446000 -- (-551.462) [-551.688] (-550.848) (-550.650) * [-550.258] (-552.344) (-551.903) (-550.166) -- 0:00:39
446500 -- (-552.104) [-549.766] (-549.842) (-553.341) * (-551.288) [-550.547] (-550.626) (-551.784) -- 0:00:39
447000 -- (-550.278) [-550.361] (-550.973) (-549.770) * (-550.226) [-550.748] (-550.061) (-552.890) -- 0:00:39
447500 -- [-549.836] (-552.024) (-551.542) (-551.207) * (-551.082) (-551.606) (-549.429) [-550.148] -- 0:00:39
448000 -- (-552.838) (-551.137) (-552.376) [-548.675] * (-551.304) (-552.111) [-549.510] (-548.783) -- 0:00:39
448500 -- (-550.356) (-551.100) (-551.485) [-552.891] * (-549.383) (-551.696) (-551.181) [-553.270] -- 0:00:39
449000 -- (-552.548) (-551.700) [-554.002] (-552.894) * (-551.367) (-551.052) (-551.300) [-550.079] -- 0:00:39
449500 -- (-550.430) [-553.796] (-550.311) (-553.075) * (-553.509) (-551.968) (-551.096) [-549.812] -- 0:00:40
450000 -- (-550.762) (-550.827) [-550.832] (-550.345) * [-552.809] (-555.352) (-556.280) (-553.926) -- 0:00:40
Average standard deviation of split frequencies: 0.012552
450500 -- [-552.144] (-550.753) (-550.804) (-554.387) * (-554.168) [-550.136] (-549.773) (-550.514) -- 0:00:40
451000 -- (-549.956) (-552.075) (-550.835) [-550.634] * (-552.338) (-554.628) [-550.168] (-552.367) -- 0:00:40
451500 -- (-551.075) (-550.445) (-553.679) [-550.290] * (-552.214) (-552.435) [-548.550] (-552.523) -- 0:00:40
452000 -- (-551.695) (-551.935) [-550.378] (-551.338) * (-556.503) (-552.509) [-551.442] (-556.109) -- 0:00:40
452500 -- (-553.850) (-551.182) (-549.977) [-550.486] * (-552.197) (-551.590) [-555.394] (-556.038) -- 0:00:39
453000 -- (-553.839) [-549.877] (-550.723) (-552.341) * [-549.803] (-552.614) (-554.280) (-552.088) -- 0:00:39
453500 -- (-550.727) (-548.336) [-551.612] (-551.771) * (-551.693) (-550.782) [-550.383] (-550.782) -- 0:00:39
454000 -- (-558.449) (-550.063) (-549.903) [-554.288] * (-552.064) (-553.508) (-548.184) [-551.260] -- 0:00:39
454500 -- (-552.172) [-550.522] (-550.284) (-551.050) * (-557.313) [-551.757] (-552.000) (-553.213) -- 0:00:39
455000 -- (-552.265) (-550.040) (-550.345) [-551.349] * (-557.931) [-552.766] (-551.993) (-551.206) -- 0:00:39
Average standard deviation of split frequencies: 0.013051
455500 -- (-551.612) (-555.149) (-551.228) [-550.510] * (-549.014) (-555.093) [-551.083] (-550.050) -- 0:00:39
456000 -- (-548.801) [-551.050] (-551.960) (-552.083) * (-550.678) [-556.794] (-549.557) (-550.992) -- 0:00:39
456500 -- [-549.995] (-553.976) (-554.068) (-551.247) * (-550.187) (-551.273) [-550.075] (-552.566) -- 0:00:39
457000 -- [-550.048] (-555.469) (-553.642) (-551.701) * (-552.615) [-550.269] (-551.733) (-552.281) -- 0:00:39
457500 -- [-552.013] (-551.385) (-552.886) (-549.866) * (-553.105) [-552.932] (-550.512) (-551.567) -- 0:00:39
458000 -- [-549.639] (-556.204) (-556.868) (-551.788) * [-551.855] (-549.651) (-549.813) (-549.514) -- 0:00:39
458500 -- (-551.116) [-551.219] (-555.336) (-551.309) * (-550.773) (-553.093) (-548.298) [-549.935] -- 0:00:38
459000 -- (-550.246) [-552.201] (-551.701) (-549.781) * (-552.194) [-558.284] (-551.815) (-548.863) -- 0:00:38
459500 -- (-554.781) (-552.281) (-550.606) [-549.382] * (-553.633) [-548.926] (-551.781) (-550.927) -- 0:00:38
460000 -- (-550.315) (-551.294) (-553.757) [-552.477] * (-550.341) (-551.810) [-550.979] (-551.970) -- 0:00:38
Average standard deviation of split frequencies: 0.013559
460500 -- (-551.895) (-553.714) (-556.407) [-551.276] * [-550.141] (-551.990) (-556.970) (-551.472) -- 0:00:38
461000 -- (-551.238) [-551.426] (-556.466) (-550.641) * [-549.447] (-552.527) (-551.864) (-550.714) -- 0:00:38
461500 -- (-551.139) (-548.866) [-555.286] (-550.034) * (-550.293) [-549.135] (-551.499) (-553.746) -- 0:00:38
462000 -- [-550.281] (-553.317) (-554.910) (-551.715) * (-553.150) (-550.926) (-552.418) [-553.523] -- 0:00:38
462500 -- [-550.664] (-551.000) (-550.438) (-553.081) * [-557.237] (-550.474) (-549.183) (-550.452) -- 0:00:38
463000 -- [-550.451] (-557.921) (-550.723) (-552.095) * (-552.169) (-551.886) [-548.316] (-550.241) -- 0:00:38
463500 -- (-550.881) [-553.860] (-551.877) (-552.799) * (-551.951) [-551.114] (-550.187) (-552.708) -- 0:00:39
464000 -- (-554.162) (-549.785) [-550.832] (-552.684) * (-551.265) [-554.118] (-550.769) (-552.040) -- 0:00:39
464500 -- (-557.288) (-556.025) (-551.970) [-552.055] * [-550.506] (-553.272) (-551.177) (-551.635) -- 0:00:39
465000 -- (-550.223) (-550.772) [-551.199] (-552.655) * (-551.659) [-553.045] (-553.557) (-552.103) -- 0:00:39
Average standard deviation of split frequencies: 0.012202
465500 -- (-550.075) (-549.846) (-551.156) [-549.466] * (-550.753) (-548.966) [-551.240] (-549.147) -- 0:00:39
466000 -- (-548.449) [-550.747] (-553.985) (-550.153) * (-552.040) [-549.128] (-550.942) (-553.138) -- 0:00:38
466500 -- (-550.742) (-550.886) [-552.043] (-550.290) * (-551.863) (-550.548) (-551.769) [-550.873] -- 0:00:38
467000 -- (-551.183) (-552.110) (-548.732) [-550.269] * (-550.749) [-551.237] (-550.949) (-550.128) -- 0:00:38
467500 -- (-551.345) (-552.132) [-551.930] (-553.691) * (-553.662) (-553.360) [-549.971] (-550.736) -- 0:00:38
468000 -- (-551.744) (-549.135) [-549.106] (-554.958) * (-552.281) (-552.554) [-551.258] (-554.701) -- 0:00:38
468500 -- (-552.339) (-553.225) [-551.000] (-550.480) * (-554.572) (-551.893) [-550.620] (-552.068) -- 0:00:38
469000 -- (-550.101) (-552.890) (-549.265) [-552.237] * (-550.677) (-553.316) (-550.227) [-552.238] -- 0:00:38
469500 -- (-550.435) [-551.980] (-548.815) (-552.398) * (-550.799) (-548.979) (-554.599) [-551.309] -- 0:00:38
470000 -- (-554.968) (-552.607) [-550.239] (-551.638) * (-554.973) (-552.317) (-553.223) [-549.764] -- 0:00:38
Average standard deviation of split frequencies: 0.011393
470500 -- (-552.088) (-556.022) (-551.685) [-549.195] * (-550.866) (-551.465) (-552.242) [-550.303] -- 0:00:38
471000 -- (-553.778) [-550.370] (-551.108) (-550.612) * (-552.110) (-550.659) (-557.618) [-550.706] -- 0:00:38
471500 -- (-558.562) (-550.785) (-550.668) [-552.186] * [-551.256] (-549.537) (-551.105) (-549.642) -- 0:00:38
472000 -- (-550.331) (-548.955) (-550.614) [-548.827] * [-551.539] (-551.599) (-550.979) (-549.905) -- 0:00:38
472500 -- (-551.386) (-552.586) [-550.234] (-551.514) * (-550.380) (-550.455) [-551.087] (-552.741) -- 0:00:37
473000 -- (-550.936) (-551.772) [-552.919] (-551.301) * (-550.270) [-549.147] (-553.359) (-550.033) -- 0:00:37
473500 -- (-553.139) [-551.707] (-552.331) (-551.099) * [-551.861] (-550.583) (-553.793) (-551.323) -- 0:00:37
474000 -- (-554.820) (-554.542) (-551.642) [-549.135] * (-554.595) [-547.997] (-549.415) (-551.190) -- 0:00:37
474500 -- (-551.488) (-551.988) [-550.014] (-550.452) * (-553.982) (-550.665) [-548.687] (-552.987) -- 0:00:37
475000 -- (-550.842) (-551.172) (-555.722) [-551.128] * [-553.395] (-547.957) (-553.087) (-551.438) -- 0:00:37
Average standard deviation of split frequencies: 0.011946
475500 -- (-551.004) (-553.435) [-549.156] (-553.190) * [-552.139] (-552.805) (-550.370) (-553.832) -- 0:00:37
476000 -- (-550.331) (-555.874) [-551.628] (-548.500) * (-552.516) [-550.190] (-552.032) (-550.982) -- 0:00:37
476500 -- [-550.865] (-551.305) (-549.646) (-549.350) * (-552.835) (-551.735) [-551.285] (-550.798) -- 0:00:37
477000 -- (-550.862) [-550.327] (-552.012) (-549.472) * (-551.110) (-549.769) [-550.922] (-555.657) -- 0:00:37
477500 -- (-551.854) [-549.450] (-551.870) (-557.908) * (-553.572) [-547.980] (-550.562) (-549.274) -- 0:00:37
478000 -- (-552.752) (-552.004) [-550.428] (-547.378) * (-551.839) [-549.605] (-552.209) (-551.171) -- 0:00:38
478500 -- (-551.235) [-549.613] (-549.625) (-548.468) * (-557.352) [-551.422] (-549.879) (-550.701) -- 0:00:38
479000 -- (-552.705) (-552.252) (-550.211) [-551.446] * (-549.624) (-551.110) [-555.233] (-552.632) -- 0:00:38
479500 -- [-550.143] (-550.470) (-550.195) (-554.558) * (-550.879) (-549.826) [-551.265] (-553.802) -- 0:00:37
480000 -- (-552.407) [-555.311] (-553.851) (-552.077) * (-552.964) [-552.314] (-552.221) (-557.792) -- 0:00:37
Average standard deviation of split frequencies: 0.011340
480500 -- (-550.993) (-555.578) [-551.375] (-551.431) * (-550.437) [-549.808] (-552.208) (-552.958) -- 0:00:37
481000 -- (-552.131) (-553.466) (-551.154) [-550.058] * (-550.153) (-553.848) (-551.486) [-553.519] -- 0:00:37
481500 -- (-549.799) [-550.657] (-551.205) (-551.932) * (-549.510) (-554.498) [-548.979] (-552.523) -- 0:00:37
482000 -- [-549.656] (-554.240) (-554.467) (-550.049) * [-550.685] (-553.132) (-550.015) (-555.259) -- 0:00:37
482500 -- (-550.976) [-550.521] (-551.368) (-549.909) * [-551.325] (-549.415) (-549.011) (-551.895) -- 0:00:37
483000 -- (-551.752) (-551.632) [-550.832] (-550.495) * (-552.327) (-548.113) (-555.099) [-555.542] -- 0:00:37
483500 -- (-550.424) (-551.879) [-549.776] (-550.822) * (-554.327) [-548.821] (-551.155) (-554.899) -- 0:00:37
484000 -- (-552.903) (-550.432) (-553.792) [-550.055] * [-549.733] (-552.923) (-548.492) (-549.574) -- 0:00:37
484500 -- [-552.898] (-550.246) (-549.975) (-548.160) * [-550.465] (-549.610) (-552.250) (-552.829) -- 0:00:37
485000 -- [-551.978] (-551.154) (-554.882) (-551.360) * (-551.998) [-551.135] (-550.983) (-553.914) -- 0:00:37
Average standard deviation of split frequencies: 0.011397
485500 -- [-550.368] (-551.826) (-555.405) (-551.605) * [-551.560] (-549.812) (-549.017) (-552.504) -- 0:00:37
486000 -- [-551.473] (-552.022) (-551.690) (-552.957) * (-550.964) [-550.461] (-550.841) (-554.479) -- 0:00:37
486500 -- [-549.834] (-552.209) (-554.885) (-550.835) * (-551.143) [-548.762] (-554.509) (-551.473) -- 0:00:36
487000 -- [-548.826] (-549.253) (-553.589) (-552.872) * [-547.905] (-549.165) (-550.953) (-550.966) -- 0:00:36
487500 -- (-553.470) (-548.919) [-551.435] (-550.621) * [-549.376] (-555.281) (-549.418) (-550.857) -- 0:00:36
488000 -- (-550.174) (-552.158) [-549.996] (-551.134) * (-549.090) [-552.207] (-551.388) (-553.008) -- 0:00:36
488500 -- [-551.047] (-550.923) (-553.563) (-552.010) * [-549.950] (-550.762) (-549.428) (-550.863) -- 0:00:36
489000 -- [-550.240] (-551.952) (-553.731) (-551.718) * (-549.653) [-550.307] (-551.247) (-550.056) -- 0:00:36
489500 -- (-553.548) [-553.317] (-554.730) (-549.092) * [-550.614] (-548.034) (-553.984) (-552.978) -- 0:00:36
490000 -- (-550.812) [-549.605] (-552.169) (-550.893) * (-550.834) (-550.121) [-551.508] (-551.818) -- 0:00:36
Average standard deviation of split frequencies: 0.011709
490500 -- (-550.270) [-549.782] (-551.751) (-552.554) * (-552.276) (-551.964) [-551.887] (-553.993) -- 0:00:36
491000 -- [-549.837] (-549.945) (-549.711) (-550.782) * [-550.088] (-552.705) (-555.711) (-556.412) -- 0:00:36
491500 -- [-551.449] (-550.198) (-552.656) (-550.452) * (-549.077) (-551.870) (-551.089) [-552.059] -- 0:00:36
492000 -- (-549.538) [-550.789] (-553.898) (-549.060) * (-552.218) (-550.792) (-551.737) [-552.364] -- 0:00:37
492500 -- (-549.723) (-551.701) (-553.278) [-550.306] * (-551.804) [-550.429] (-549.948) (-554.097) -- 0:00:37
493000 -- (-548.089) [-552.724] (-552.290) (-551.113) * (-553.345) (-550.597) [-552.324] (-551.567) -- 0:00:37
493500 -- (-549.493) [-550.458] (-549.014) (-555.296) * (-552.705) [-551.115] (-551.136) (-551.191) -- 0:00:36
494000 -- (-550.025) [-550.892] (-552.453) (-552.800) * (-555.268) (-556.242) (-551.817) [-551.045] -- 0:00:36
494500 -- (-550.974) (-548.684) [-549.043] (-553.341) * (-548.122) (-550.914) [-549.327] (-553.148) -- 0:00:36
495000 -- (-549.710) [-551.389] (-550.344) (-552.831) * (-552.348) (-553.606) [-548.125] (-552.591) -- 0:00:36
Average standard deviation of split frequencies: 0.011940
495500 -- [-549.377] (-554.463) (-550.740) (-551.632) * (-550.053) [-550.911] (-556.246) (-555.928) -- 0:00:36
496000 -- (-552.935) [-547.784] (-551.157) (-551.296) * (-549.564) (-551.142) (-552.139) [-553.461] -- 0:00:36
496500 -- (-550.455) [-547.451] (-554.510) (-553.051) * (-551.460) [-549.726] (-551.239) (-549.702) -- 0:00:36
497000 -- [-551.667] (-550.679) (-555.227) (-555.259) * [-549.891] (-549.090) (-551.362) (-552.137) -- 0:00:36
497500 -- (-553.012) (-551.598) (-551.680) [-554.169] * [-550.485] (-551.609) (-551.102) (-551.651) -- 0:00:36
498000 -- [-551.347] (-553.520) (-550.064) (-552.280) * (-549.502) (-552.239) (-548.366) [-554.224] -- 0:00:36
498500 -- [-552.219] (-554.232) (-550.706) (-556.334) * (-549.410) [-554.653] (-554.413) (-550.684) -- 0:00:36
499000 -- [-550.122] (-551.113) (-550.847) (-553.428) * (-548.400) (-551.288) (-550.479) [-551.948] -- 0:00:36
499500 -- (-549.281) (-549.259) [-549.694] (-551.621) * (-551.042) (-556.728) (-552.451) [-549.401] -- 0:00:36
500000 -- (-548.583) (-553.454) [-552.208] (-554.595) * (-549.576) (-555.193) (-550.515) [-554.387] -- 0:00:36
Average standard deviation of split frequencies: 0.011240
500500 -- (-549.984) [-552.634] (-549.945) (-549.138) * [-551.340] (-553.499) (-552.529) (-551.855) -- 0:00:35
501000 -- (-553.009) [-550.311] (-552.722) (-550.865) * (-550.710) [-552.153] (-548.615) (-555.931) -- 0:00:35
501500 -- (-552.194) [-550.674] (-551.907) (-550.219) * (-552.302) [-548.940] (-550.512) (-557.572) -- 0:00:35
502000 -- (-548.734) (-552.499) (-552.342) [-552.368] * (-548.468) (-551.709) [-551.455] (-551.205) -- 0:00:35
502500 -- (-552.456) [-550.275] (-554.429) (-549.297) * (-551.327) [-549.729] (-551.558) (-555.557) -- 0:00:35
503000 -- (-550.420) (-550.985) [-552.072] (-552.449) * (-551.415) [-552.255] (-549.608) (-551.157) -- 0:00:35
503500 -- (-551.220) [-552.778] (-550.980) (-549.972) * (-552.615) (-551.140) (-548.876) [-552.048] -- 0:00:35
504000 -- (-553.179) [-552.309] (-549.750) (-551.062) * (-554.590) (-549.502) [-550.989] (-551.969) -- 0:00:35
504500 -- [-550.614] (-556.007) (-556.438) (-550.789) * (-550.861) [-550.876] (-551.060) (-553.469) -- 0:00:35
505000 -- (-549.923) (-549.784) (-553.323) [-555.274] * (-552.586) (-549.715) (-550.873) [-551.971] -- 0:00:35
Average standard deviation of split frequencies: 0.011673
505500 -- [-550.877] (-552.202) (-551.054) (-553.198) * [-552.573] (-549.517) (-554.161) (-550.666) -- 0:00:35
506000 -- (-550.002) (-551.212) (-551.658) [-550.015] * (-550.110) (-549.006) (-549.611) [-551.603] -- 0:00:36
506500 -- (-548.727) (-553.363) [-552.413] (-554.108) * [-550.182] (-550.581) (-549.113) (-551.236) -- 0:00:36
507000 -- (-549.160) (-551.815) (-551.348) [-551.295] * (-554.793) (-548.598) (-549.711) [-553.811] -- 0:00:35
507500 -- [-549.776] (-552.146) (-548.659) (-551.201) * [-550.625] (-551.511) (-550.830) (-552.346) -- 0:00:35
508000 -- (-553.843) (-553.570) (-548.911) [-556.584] * (-552.044) (-555.991) (-555.568) [-551.345] -- 0:00:35
508500 -- (-553.206) (-550.036) [-549.578] (-553.144) * (-552.916) (-548.951) (-555.943) [-552.981] -- 0:00:35
509000 -- (-550.831) (-555.068) (-550.043) [-553.043] * (-554.702) (-548.799) [-552.090] (-552.864) -- 0:00:35
509500 -- (-548.223) [-551.798] (-552.733) (-551.838) * (-550.632) (-551.131) (-551.400) [-551.130] -- 0:00:35
510000 -- (-549.998) [-551.216] (-553.012) (-550.989) * (-550.927) (-551.038) [-552.047] (-551.994) -- 0:00:35
Average standard deviation of split frequencies: 0.010500
510500 -- (-549.788) (-551.113) (-553.888) [-551.711] * [-550.832] (-549.947) (-551.855) (-552.192) -- 0:00:35
511000 -- [-550.371] (-550.416) (-551.075) (-552.694) * (-550.849) (-554.748) [-552.811] (-551.184) -- 0:00:35
511500 -- (-550.699) (-551.587) [-550.942] (-551.611) * (-553.126) [-553.360] (-556.324) (-551.595) -- 0:00:35
512000 -- [-551.321] (-550.150) (-551.398) (-553.168) * (-550.917) (-553.135) [-550.858] (-554.551) -- 0:00:35
512500 -- (-551.249) (-549.603) (-551.959) [-554.219] * (-552.206) (-551.393) [-555.351] (-551.906) -- 0:00:35
513000 -- (-555.833) (-552.916) [-550.539] (-551.754) * (-550.678) (-554.246) [-551.416] (-550.103) -- 0:00:35
513500 -- (-548.754) (-551.664) (-553.134) [-555.664] * (-550.168) [-553.312] (-549.333) (-549.877) -- 0:00:35
514000 -- [-549.925] (-551.275) (-551.837) (-552.218) * (-551.677) (-554.981) (-552.590) [-549.569] -- 0:00:34
514500 -- (-550.485) (-556.768) (-551.953) [-548.555] * [-557.180] (-550.971) (-550.768) (-549.871) -- 0:00:34
515000 -- (-549.382) (-551.311) [-551.425] (-552.316) * [-549.763] (-553.512) (-554.690) (-552.933) -- 0:00:34
Average standard deviation of split frequencies: 0.009878
515500 -- [-551.848] (-555.789) (-550.356) (-550.710) * [-549.147] (-556.394) (-553.257) (-551.795) -- 0:00:34
516000 -- [-549.270] (-550.720) (-550.594) (-549.710) * (-551.781) [-554.459] (-551.321) (-552.779) -- 0:00:34
516500 -- (-554.638) [-550.938] (-552.208) (-549.568) * (-551.041) (-554.629) (-550.514) [-553.567] -- 0:00:34
517000 -- (-550.432) [-555.485] (-552.188) (-551.039) * (-551.614) (-554.387) (-551.515) [-549.353] -- 0:00:34
517500 -- [-547.969] (-549.193) (-551.536) (-549.769) * [-549.329] (-555.892) (-552.589) (-548.473) -- 0:00:34
518000 -- (-549.133) (-550.587) (-555.127) [-548.982] * [-551.226] (-551.401) (-552.318) (-550.465) -- 0:00:34
518500 -- (-550.518) (-553.198) (-553.537) [-551.928] * (-551.697) [-551.410] (-552.139) (-556.027) -- 0:00:34
519000 -- (-551.081) (-549.786) [-551.114] (-552.327) * [-552.063] (-555.677) (-553.019) (-554.189) -- 0:00:34
519500 -- [-550.420] (-552.503) (-554.431) (-550.658) * (-556.187) (-552.939) (-552.520) [-549.376] -- 0:00:34
520000 -- (-551.295) [-551.525] (-550.541) (-549.405) * (-554.558) (-556.940) [-550.927] (-552.091) -- 0:00:34
Average standard deviation of split frequencies: 0.009507
520500 -- [-551.039] (-550.331) (-550.232) (-550.483) * (-552.903) (-555.923) (-551.598) [-551.455] -- 0:00:35
521000 -- (-550.893) (-551.136) [-549.194] (-551.353) * (-552.041) (-553.157) [-553.405] (-552.176) -- 0:00:34
521500 -- (-556.819) (-553.250) [-550.136] (-550.385) * [-550.802] (-553.875) (-552.136) (-552.908) -- 0:00:34
522000 -- (-553.539) (-552.655) [-553.548] (-548.951) * [-551.678] (-555.038) (-552.438) (-552.989) -- 0:00:34
522500 -- [-548.477] (-551.839) (-549.029) (-551.527) * (-551.120) [-551.566] (-551.354) (-550.415) -- 0:00:34
523000 -- (-549.725) (-552.317) [-548.441] (-553.998) * (-551.370) [-552.601] (-552.835) (-551.759) -- 0:00:34
523500 -- (-549.698) (-550.933) [-549.505] (-554.053) * (-552.242) (-553.865) [-551.892] (-552.483) -- 0:00:34
524000 -- (-555.124) (-554.063) (-550.004) [-555.898] * (-551.876) (-554.251) [-551.183] (-550.509) -- 0:00:34
524500 -- (-555.136) (-553.652) [-549.145] (-558.687) * (-551.366) (-550.367) (-549.668) [-551.806] -- 0:00:34
525000 -- (-550.282) (-553.729) [-551.296] (-554.975) * (-551.636) [-551.791] (-550.771) (-553.854) -- 0:00:34
Average standard deviation of split frequencies: 0.010227
525500 -- [-556.204] (-552.800) (-552.362) (-550.920) * (-554.320) [-552.378] (-553.323) (-550.064) -- 0:00:34
526000 -- (-555.167) (-550.820) (-549.913) [-553.756] * (-552.209) [-550.811] (-552.404) (-550.148) -- 0:00:34
526500 -- (-548.974) (-551.128) (-551.386) [-551.964] * (-553.541) (-550.070) [-552.562] (-551.035) -- 0:00:34
527000 -- (-555.461) [-550.909] (-550.275) (-553.505) * (-555.013) (-551.791) (-550.880) [-550.982] -- 0:00:34
527500 -- [-548.790] (-550.510) (-551.710) (-551.843) * (-553.161) [-555.378] (-551.391) (-551.393) -- 0:00:34
528000 -- (-552.785) (-550.417) [-552.863] (-551.527) * [-551.156] (-556.133) (-553.578) (-552.263) -- 0:00:33
528500 -- (-551.834) [-550.972] (-551.515) (-551.333) * [-552.772] (-552.923) (-551.025) (-552.184) -- 0:00:33
529000 -- (-549.493) (-550.957) [-548.425] (-551.817) * [-551.387] (-550.490) (-552.952) (-549.671) -- 0:00:33
529500 -- (-550.628) [-549.307] (-550.265) (-553.940) * (-553.026) [-552.251] (-553.307) (-551.360) -- 0:00:33
530000 -- (-551.134) (-552.699) (-550.571) [-552.419] * (-556.704) (-551.346) (-551.999) [-552.039] -- 0:00:33
Average standard deviation of split frequencies: 0.010608
530500 -- (-550.978) (-549.752) (-551.930) [-549.608] * (-558.168) (-552.006) (-560.834) [-550.885] -- 0:00:33
531000 -- (-551.515) (-549.243) [-549.947] (-550.477) * [-554.529] (-551.147) (-556.670) (-557.790) -- 0:00:33
531500 -- (-550.093) [-548.865] (-551.072) (-553.723) * [-551.858] (-551.083) (-550.492) (-553.227) -- 0:00:33
532000 -- [-550.344] (-550.421) (-552.105) (-551.792) * [-553.623] (-552.232) (-552.359) (-552.691) -- 0:00:33
532500 -- (-548.838) [-549.783] (-549.781) (-557.127) * [-554.705] (-554.317) (-550.570) (-550.409) -- 0:00:33
533000 -- (-549.798) (-549.900) (-551.177) [-560.119] * [-551.577] (-551.381) (-548.901) (-549.868) -- 0:00:34
533500 -- (-548.403) (-549.013) [-552.932] (-556.375) * (-550.082) (-552.409) (-552.373) [-549.332] -- 0:00:34
534000 -- (-550.872) (-552.639) [-553.013] (-550.446) * (-549.648) (-550.747) (-551.303) [-550.490] -- 0:00:34
534500 -- (-548.703) (-550.933) (-551.155) [-551.281] * [-550.233] (-553.805) (-550.447) (-550.161) -- 0:00:33
535000 -- (-551.292) (-551.313) [-551.525] (-551.004) * (-550.179) (-550.974) (-551.151) [-552.964] -- 0:00:33
Average standard deviation of split frequencies: 0.010114
535500 -- [-548.915] (-550.486) (-554.909) (-550.032) * (-551.418) (-553.891) [-554.639] (-552.140) -- 0:00:33
536000 -- (-553.390) (-550.960) (-549.522) [-549.291] * (-552.195) (-558.122) [-552.239] (-552.926) -- 0:00:33
536500 -- (-548.425) (-549.149) (-550.852) [-550.737] * (-559.547) (-551.455) [-552.145] (-551.803) -- 0:00:33
537000 -- (-552.235) [-551.268] (-551.183) (-551.954) * (-552.472) (-550.624) [-549.856] (-549.861) -- 0:00:33
537500 -- (-550.645) [-548.848] (-554.898) (-555.411) * [-551.205] (-552.426) (-551.421) (-551.724) -- 0:00:33
538000 -- (-550.106) (-550.235) [-550.683] (-553.768) * (-549.988) [-550.819] (-552.643) (-550.660) -- 0:00:33
538500 -- (-548.716) (-553.061) [-549.476] (-553.794) * [-549.267] (-557.377) (-551.709) (-550.947) -- 0:00:33
539000 -- (-549.181) (-553.336) [-550.803] (-551.947) * [-549.822] (-554.313) (-549.634) (-551.972) -- 0:00:33
539500 -- (-551.160) (-552.437) (-553.937) [-550.055] * [-551.949] (-551.683) (-550.006) (-551.016) -- 0:00:33
540000 -- (-548.675) [-549.915] (-551.959) (-551.037) * (-552.294) (-550.659) (-549.599) [-551.627] -- 0:00:33
Average standard deviation of split frequencies: 0.010245
540500 -- [-550.344] (-550.599) (-551.306) (-550.305) * (-551.455) (-552.348) (-550.939) [-551.190] -- 0:00:33
541000 -- [-549.259] (-549.323) (-553.453) (-550.811) * (-551.161) (-552.068) (-554.169) [-550.980] -- 0:00:33
541500 -- (-548.408) (-553.579) (-550.529) [-554.945] * [-553.260] (-554.210) (-552.558) (-552.311) -- 0:00:33
542000 -- (-550.782) (-551.355) (-553.511) [-549.423] * [-551.613] (-552.283) (-550.737) (-550.732) -- 0:00:32
542500 -- (-551.703) [-549.381] (-551.979) (-549.950) * [-551.200] (-551.015) (-554.373) (-551.912) -- 0:00:32
543000 -- (-551.958) [-552.022] (-551.036) (-553.934) * (-555.043) (-551.650) (-551.874) [-550.974] -- 0:00:32
543500 -- (-551.999) (-556.226) (-550.058) [-551.722] * (-552.825) [-551.936] (-550.756) (-550.960) -- 0:00:32
544000 -- [-551.587] (-555.847) (-550.407) (-550.373) * (-550.709) (-552.002) [-550.440] (-553.391) -- 0:00:32
544500 -- (-550.655) [-550.769] (-551.127) (-553.327) * [-553.569] (-551.127) (-552.468) (-553.989) -- 0:00:32
545000 -- (-553.872) (-549.837) (-552.144) [-551.942] * (-555.851) [-550.408] (-552.643) (-550.865) -- 0:00:32
Average standard deviation of split frequencies: 0.010462
545500 -- [-551.001] (-550.246) (-553.824) (-549.547) * (-551.482) (-552.346) [-550.573] (-554.010) -- 0:00:32
546000 -- [-551.746] (-548.737) (-550.570) (-554.658) * (-549.869) (-553.468) [-550.174] (-551.604) -- 0:00:33
546500 -- (-549.316) (-548.162) (-555.055) [-551.867] * (-550.987) (-552.349) [-550.654] (-550.531) -- 0:00:33
547000 -- (-551.120) (-550.064) [-550.714] (-553.126) * (-551.122) (-551.294) (-553.027) [-551.733] -- 0:00:33
547500 -- [-550.613] (-550.764) (-552.806) (-551.818) * (-555.990) (-551.390) [-551.913] (-552.738) -- 0:00:33
548000 -- (-549.844) (-551.440) (-551.980) [-552.240] * [-557.050] (-552.197) (-550.441) (-551.717) -- 0:00:32
548500 -- [-548.919] (-553.781) (-553.554) (-551.123) * (-550.805) (-551.749) (-549.372) [-551.808] -- 0:00:32
549000 -- (-548.548) (-553.188) (-550.702) [-551.073] * (-550.204) (-553.428) (-554.994) [-551.591] -- 0:00:32
549500 -- (-551.389) [-550.940] (-548.934) (-551.206) * (-550.915) (-553.801) [-553.432] (-552.981) -- 0:00:32
550000 -- (-550.453) (-550.656) (-551.286) [-552.738] * [-551.144] (-550.382) (-548.988) (-556.035) -- 0:00:32
Average standard deviation of split frequencies: 0.010726
550500 -- (-548.938) (-549.613) [-553.442] (-556.373) * (-557.066) (-550.893) (-551.595) [-550.803] -- 0:00:32
551000 -- (-553.897) (-553.124) (-550.688) [-551.143] * (-552.326) [-551.588] (-556.543) (-554.002) -- 0:00:32
551500 -- [-551.686] (-551.434) (-551.767) (-552.457) * [-549.375] (-550.353) (-552.205) (-554.846) -- 0:00:32
552000 -- (-551.505) [-551.219] (-551.386) (-551.565) * (-550.679) (-552.016) [-552.390] (-551.469) -- 0:00:32
552500 -- [-551.472] (-550.666) (-554.336) (-552.215) * [-555.382] (-551.703) (-553.914) (-555.272) -- 0:00:32
553000 -- (-550.313) [-551.079] (-550.300) (-553.093) * (-559.881) [-550.101] (-552.587) (-551.758) -- 0:00:32
553500 -- (-548.911) [-550.294] (-553.038) (-551.108) * [-555.409] (-551.796) (-551.930) (-553.578) -- 0:00:32
554000 -- [-548.109] (-551.756) (-549.368) (-554.359) * (-551.052) (-549.906) (-556.199) [-549.127] -- 0:00:32
554500 -- [-554.419] (-555.231) (-555.201) (-552.560) * (-552.042) (-550.774) (-552.649) [-551.192] -- 0:00:32
555000 -- [-550.766] (-556.580) (-552.412) (-553.714) * (-552.505) [-555.594] (-549.362) (-549.828) -- 0:00:32
Average standard deviation of split frequencies: 0.010623
555500 -- (-552.000) (-549.316) (-552.321) [-549.339] * (-551.286) (-551.256) (-549.390) [-551.017] -- 0:00:32
556000 -- (-554.678) [-549.770] (-551.511) (-549.930) * (-551.727) [-551.191] (-549.165) (-551.134) -- 0:00:31
556500 -- (-550.234) [-548.434] (-554.054) (-551.405) * (-552.424) (-552.799) (-550.221) [-550.718] -- 0:00:31
557000 -- [-550.945] (-549.619) (-554.977) (-548.637) * (-551.366) (-553.374) [-549.105] (-552.162) -- 0:00:31
557500 -- [-550.024] (-554.554) (-552.629) (-551.423) * [-552.249] (-552.418) (-550.725) (-549.686) -- 0:00:32
558000 -- (-551.236) [-549.745] (-553.713) (-552.267) * [-550.678] (-554.679) (-552.135) (-551.977) -- 0:00:32
558500 -- (-549.320) (-551.012) (-553.379) [-550.878] * (-552.042) (-551.575) [-548.659] (-552.136) -- 0:00:32
559000 -- (-552.234) (-556.441) (-551.448) [-550.010] * (-551.172) (-551.055) (-549.350) [-549.854] -- 0:00:32
559500 -- (-555.317) (-549.835) (-549.203) [-552.979] * (-550.930) (-553.441) [-553.318] (-551.678) -- 0:00:32
560000 -- (-556.874) [-552.991] (-554.140) (-550.404) * (-550.982) (-551.124) [-551.420] (-552.609) -- 0:00:32
Average standard deviation of split frequencies: 0.010195
560500 -- (-553.662) (-551.634) [-550.038] (-550.755) * [-551.239] (-551.098) (-554.588) (-552.716) -- 0:00:32
561000 -- (-552.441) [-551.760] (-550.743) (-550.722) * (-552.559) [-551.825] (-554.345) (-552.221) -- 0:00:32
561500 -- (-552.236) (-551.743) [-552.526] (-553.069) * (-553.601) (-550.779) [-553.943] (-552.633) -- 0:00:32
562000 -- (-550.755) (-550.529) [-548.811] (-552.257) * [-550.954] (-552.645) (-551.619) (-550.079) -- 0:00:31
562500 -- [-552.107] (-551.363) (-552.107) (-551.657) * (-553.098) (-550.315) [-551.317] (-551.232) -- 0:00:31
563000 -- [-552.936] (-551.317) (-552.083) (-557.072) * (-555.709) [-552.090] (-553.245) (-550.607) -- 0:00:31
563500 -- (-548.585) [-552.048] (-551.165) (-557.395) * (-551.911) (-551.068) (-550.158) [-550.048] -- 0:00:31
564000 -- (-553.569) [-552.772] (-553.172) (-552.618) * (-551.205) [-550.912] (-552.504) (-551.279) -- 0:00:31
564500 -- (-550.348) [-551.641] (-550.723) (-553.472) * [-552.332] (-553.914) (-553.841) (-550.748) -- 0:00:31
565000 -- [-550.885] (-549.424) (-558.948) (-555.445) * (-553.233) (-552.687) [-552.838] (-552.920) -- 0:00:31
Average standard deviation of split frequencies: 0.010099
565500 -- (-551.697) [-552.489] (-552.698) (-556.843) * (-550.674) [-553.900] (-553.955) (-552.646) -- 0:00:31
566000 -- (-551.007) (-549.213) [-553.177] (-550.784) * (-552.103) (-554.368) (-554.002) [-551.560] -- 0:00:31
566500 -- [-553.905] (-552.590) (-550.241) (-550.497) * [-550.599] (-548.740) (-550.463) (-549.969) -- 0:00:31
567000 -- (-555.016) (-552.326) [-551.039] (-550.905) * (-551.929) [-551.087] (-551.153) (-550.439) -- 0:00:31
567500 -- (-551.247) (-552.429) (-552.610) [-551.932] * (-554.824) (-548.489) (-551.923) [-550.433] -- 0:00:31
568000 -- [-552.938] (-550.621) (-549.439) (-554.615) * (-551.255) (-549.408) [-551.434] (-551.867) -- 0:00:31
568500 -- (-554.460) (-551.364) [-549.987] (-551.555) * (-551.639) [-551.607] (-551.278) (-551.194) -- 0:00:31
569000 -- (-552.415) (-550.040) (-551.937) [-551.494] * (-550.870) [-549.631] (-552.027) (-550.247) -- 0:00:31
569500 -- (-550.267) (-551.092) [-552.347] (-549.537) * (-554.240) (-551.320) [-553.364] (-557.030) -- 0:00:30
570000 -- [-551.762] (-551.367) (-551.224) (-551.033) * (-551.683) [-550.856] (-556.640) (-551.100) -- 0:00:31
Average standard deviation of split frequencies: 0.009748
570500 -- (-549.671) (-553.189) [-549.858] (-552.762) * (-553.278) (-553.900) [-551.167] (-550.111) -- 0:00:31
571000 -- (-552.961) (-554.430) (-553.684) [-551.810] * (-551.113) (-554.531) [-552.892] (-555.113) -- 0:00:31
571500 -- [-553.472] (-551.096) (-550.894) (-550.782) * [-551.513] (-552.574) (-551.257) (-555.293) -- 0:00:31
572000 -- (-552.111) (-550.990) [-553.778] (-551.152) * (-552.410) (-552.045) (-554.237) [-552.689] -- 0:00:31
572500 -- (-551.690) (-551.309) [-553.774] (-551.554) * (-551.104) [-552.500] (-550.597) (-551.960) -- 0:00:31
573000 -- (-551.009) (-551.142) [-548.634] (-550.271) * (-558.926) (-551.878) [-550.915] (-552.773) -- 0:00:31
573500 -- [-548.771] (-551.159) (-552.878) (-553.564) * (-552.388) [-551.032] (-550.924) (-552.405) -- 0:00:31
574000 -- (-551.382) [-550.529] (-552.615) (-553.020) * (-553.865) (-550.065) (-552.438) [-551.945] -- 0:00:31
574500 -- (-549.822) (-549.911) [-550.293] (-560.149) * [-552.767] (-550.350) (-553.511) (-553.138) -- 0:00:31
575000 -- (-551.549) [-549.276] (-550.880) (-553.623) * (-552.062) [-556.370] (-555.449) (-552.092) -- 0:00:31
Average standard deviation of split frequencies: 0.010148
575500 -- (-550.455) (-551.571) (-551.788) [-553.138] * (-550.122) [-552.870] (-552.442) (-550.346) -- 0:00:30
576000 -- (-556.674) (-550.496) (-550.732) [-551.631] * (-552.068) (-550.995) (-552.808) [-548.303] -- 0:00:30
576500 -- (-557.261) [-550.268] (-552.559) (-552.440) * [-552.369] (-553.468) (-554.919) (-554.313) -- 0:00:30
577000 -- (-550.677) (-549.684) (-551.732) [-550.840] * (-553.586) [-551.146] (-548.109) (-550.848) -- 0:00:30
577500 -- [-552.408] (-552.120) (-551.991) (-551.440) * [-552.458] (-552.524) (-554.934) (-551.570) -- 0:00:30
578000 -- (-552.618) (-554.038) (-554.880) [-550.765] * (-562.452) (-552.547) [-552.606] (-551.432) -- 0:00:30
578500 -- (-549.479) (-555.515) [-550.964] (-554.374) * (-551.287) (-552.162) [-549.355] (-553.874) -- 0:00:30
579000 -- [-549.880] (-552.973) (-551.573) (-551.378) * (-549.892) (-551.569) [-551.704] (-550.128) -- 0:00:30
579500 -- [-549.881] (-549.729) (-556.487) (-551.014) * (-553.702) [-551.799] (-550.572) (-551.679) -- 0:00:30
580000 -- [-549.129] (-554.344) (-552.440) (-551.734) * (-552.446) [-551.029] (-548.635) (-552.845) -- 0:00:30
Average standard deviation of split frequencies: 0.010391
580500 -- [-548.498] (-554.829) (-551.785) (-554.364) * [-550.409] (-551.479) (-553.310) (-555.677) -- 0:00:30
581000 -- [-549.281] (-552.563) (-551.236) (-550.945) * [-550.108] (-550.438) (-552.055) (-552.033) -- 0:00:31
581500 -- (-551.645) (-552.039) (-550.289) [-550.042] * (-550.259) (-550.725) [-550.882] (-556.149) -- 0:00:30
582000 -- [-549.145] (-552.005) (-551.421) (-548.199) * [-550.526] (-550.515) (-553.714) (-554.407) -- 0:00:30
582500 -- (-549.103) [-552.172] (-549.864) (-551.391) * (-551.961) [-550.655] (-551.925) (-549.727) -- 0:00:30
583000 -- (-550.451) (-552.860) (-549.860) [-553.008] * (-550.898) [-550.384] (-551.441) (-552.538) -- 0:00:30
583500 -- (-554.868) (-552.888) [-552.150] (-551.506) * (-553.079) [-552.585] (-550.253) (-552.029) -- 0:00:30
584000 -- (-553.824) (-553.880) [-550.376] (-550.633) * (-554.930) (-551.143) [-549.535] (-551.973) -- 0:00:30
584500 -- [-552.141] (-551.960) (-552.018) (-554.056) * [-552.412] (-551.081) (-551.226) (-553.203) -- 0:00:30
585000 -- (-552.784) (-552.450) [-552.209] (-550.682) * [-549.996] (-552.373) (-551.432) (-552.584) -- 0:00:30
Average standard deviation of split frequencies: 0.010619
585500 -- (-554.724) (-549.813) [-551.241] (-552.317) * (-550.394) (-553.105) (-549.676) [-552.210] -- 0:00:30
586000 -- (-549.787) [-552.176] (-554.451) (-550.050) * (-551.372) (-550.570) [-551.047] (-550.956) -- 0:00:30
586500 -- [-551.698] (-551.572) (-551.495) (-551.183) * (-554.765) (-551.476) (-552.072) [-550.225] -- 0:00:30
587000 -- (-551.290) (-555.422) (-552.567) [-551.393] * [-552.186] (-556.809) (-549.504) (-553.396) -- 0:00:30
587500 -- [-550.600] (-550.533) (-550.967) (-553.162) * (-549.129) [-551.622] (-551.156) (-551.042) -- 0:00:30
588000 -- (-551.287) [-552.086] (-551.336) (-550.376) * (-551.280) [-550.766] (-552.757) (-553.032) -- 0:00:30
588500 -- (-550.604) (-552.487) (-553.565) [-552.508] * (-551.105) (-554.317) [-550.557] (-550.924) -- 0:00:30
589000 -- [-553.307] (-551.553) (-551.862) (-551.119) * (-550.686) [-549.325] (-551.278) (-552.856) -- 0:00:30
589500 -- (-551.627) (-550.770) [-548.904] (-555.661) * [-552.126] (-547.978) (-549.801) (-552.369) -- 0:00:29
590000 -- (-553.119) (-552.742) [-548.428] (-553.909) * (-553.114) (-549.292) [-552.908] (-552.383) -- 0:00:29
Average standard deviation of split frequencies: 0.010275
590500 -- [-550.406] (-551.722) (-550.915) (-551.911) * (-550.563) [-550.853] (-552.102) (-551.921) -- 0:00:29
591000 -- (-550.896) (-550.469) (-553.592) [-552.299] * (-554.617) (-549.732) [-550.129] (-551.116) -- 0:00:29
591500 -- (-550.903) [-550.374] (-549.089) (-550.074) * (-551.496) [-552.136] (-551.750) (-552.478) -- 0:00:29
592000 -- (-550.313) [-548.778] (-550.035) (-550.722) * [-554.074] (-552.791) (-551.401) (-553.319) -- 0:00:29
592500 -- [-549.088] (-551.674) (-551.838) (-552.721) * (-551.616) [-552.346] (-552.158) (-551.088) -- 0:00:30
593000 -- (-548.988) (-552.035) [-556.254] (-553.881) * [-551.540] (-552.020) (-554.186) (-551.700) -- 0:00:30
593500 -- [-550.479] (-551.066) (-550.300) (-553.327) * (-551.785) [-551.385] (-551.147) (-551.818) -- 0:00:30
594000 -- (-550.464) (-548.708) [-553.607] (-553.003) * (-553.714) (-548.106) [-550.758] (-552.975) -- 0:00:30
594500 -- (-550.121) [-550.354] (-554.359) (-551.653) * (-559.506) (-550.319) [-549.494] (-552.249) -- 0:00:30
595000 -- [-550.241] (-558.859) (-552.363) (-555.490) * (-556.216) (-553.133) [-552.384] (-550.784) -- 0:00:29
Average standard deviation of split frequencies: 0.010599
595500 -- (-551.031) (-554.413) (-550.590) [-552.301] * [-552.159] (-550.794) (-551.768) (-550.501) -- 0:00:29
596000 -- (-550.965) (-555.023) (-552.236) [-552.040] * (-551.128) (-550.588) (-552.657) [-554.441] -- 0:00:29
596500 -- [-552.571] (-552.045) (-552.434) (-553.028) * [-550.690] (-553.261) (-548.382) (-552.632) -- 0:00:29
597000 -- (-550.665) [-548.655] (-550.412) (-551.687) * (-553.195) (-550.469) [-549.882] (-555.002) -- 0:00:29
597500 -- (-552.122) (-550.988) [-550.921] (-551.636) * (-550.299) (-550.601) (-550.425) [-555.363] -- 0:00:29
598000 -- [-548.906] (-554.641) (-555.272) (-554.491) * (-553.508) (-552.638) [-550.275] (-554.449) -- 0:00:29
598500 -- (-558.353) [-554.752] (-553.455) (-556.670) * (-551.186) (-553.026) (-551.743) [-550.995] -- 0:00:29
599000 -- [-549.831] (-552.007) (-551.726) (-552.893) * (-551.361) (-549.827) (-550.544) [-551.308] -- 0:00:29
599500 -- [-551.585] (-552.644) (-552.189) (-550.237) * (-551.119) (-550.332) (-550.735) [-552.256] -- 0:00:29
600000 -- (-550.581) (-553.486) (-554.418) [-554.723] * (-551.926) (-552.399) [-559.754] (-552.963) -- 0:00:29
Average standard deviation of split frequencies: 0.010412
600500 -- (-553.898) (-554.243) [-550.624] (-551.586) * (-555.029) (-550.955) [-550.379] (-553.478) -- 0:00:29
601000 -- (-552.507) [-550.243] (-553.051) (-552.273) * (-552.260) [-550.312] (-552.012) (-551.606) -- 0:00:29
601500 -- (-552.618) (-549.975) (-551.560) [-551.514] * (-549.787) (-551.530) [-550.988] (-550.475) -- 0:00:29
602000 -- [-551.053] (-550.481) (-555.007) (-550.082) * [-550.659] (-549.971) (-552.837) (-551.497) -- 0:00:29
602500 -- (-552.499) (-550.263) (-551.300) [-550.998] * (-550.750) (-550.214) (-549.650) [-553.095] -- 0:00:29
603000 -- (-548.269) (-552.986) [-552.923] (-552.313) * (-550.612) (-552.672) [-550.843] (-551.561) -- 0:00:28
603500 -- (-553.860) [-552.021] (-550.254) (-552.334) * (-558.324) (-552.038) [-551.993] (-552.037) -- 0:00:28
604000 -- [-552.127] (-550.435) (-550.842) (-551.765) * (-552.689) (-551.714) (-550.697) [-553.059] -- 0:00:28
604500 -- (-552.490) [-552.634] (-550.549) (-549.413) * [-549.642] (-552.049) (-551.129) (-550.219) -- 0:00:28
605000 -- (-550.476) (-551.320) (-550.367) [-551.331] * (-549.075) (-551.093) [-555.529] (-552.623) -- 0:00:29
Average standard deviation of split frequencies: 0.010787
605500 -- (-552.141) [-548.211] (-555.795) (-549.191) * (-550.033) [-550.965] (-555.577) (-550.868) -- 0:00:29
606000 -- [-552.494] (-549.915) (-551.266) (-550.965) * (-550.172) [-551.725] (-558.691) (-552.072) -- 0:00:29
606500 -- (-552.169) (-551.373) (-551.022) [-555.127] * [-551.169] (-555.968) (-554.692) (-550.579) -- 0:00:29
607000 -- [-550.348] (-550.502) (-554.954) (-550.399) * [-550.221] (-553.260) (-551.941) (-550.232) -- 0:00:29
607500 -- [-551.212] (-550.277) (-550.535) (-550.485) * (-551.791) (-553.345) (-552.365) [-551.135] -- 0:00:29
608000 -- (-551.181) (-551.536) [-548.426] (-549.732) * (-548.705) (-551.245) [-552.665] (-549.707) -- 0:00:29
608500 -- [-552.944] (-556.209) (-550.379) (-551.216) * [-550.061] (-552.333) (-554.089) (-552.770) -- 0:00:28
609000 -- [-548.738] (-552.379) (-549.114) (-550.002) * [-550.218] (-555.998) (-551.777) (-549.212) -- 0:00:28
609500 -- [-553.007] (-553.331) (-549.926) (-551.503) * (-551.554) (-553.020) [-549.869] (-551.435) -- 0:00:28
610000 -- (-550.870) (-549.584) (-552.436) [-552.110] * (-549.699) (-559.156) (-549.755) [-549.518] -- 0:00:28
Average standard deviation of split frequencies: 0.010807
610500 -- [-550.698] (-550.523) (-551.756) (-552.968) * [-548.220] (-555.402) (-552.663) (-552.659) -- 0:00:28
611000 -- (-550.903) (-549.134) (-550.584) [-549.135] * (-550.925) (-552.775) (-552.682) [-552.828] -- 0:00:28
611500 -- [-551.695] (-549.658) (-554.036) (-549.053) * (-554.298) [-553.138] (-551.746) (-550.742) -- 0:00:28
612000 -- (-551.284) (-551.556) [-551.281] (-549.951) * [-552.035] (-553.253) (-552.949) (-554.505) -- 0:00:28
612500 -- (-553.824) (-551.078) [-551.151] (-550.787) * (-554.562) (-553.444) (-551.728) [-552.598] -- 0:00:28
613000 -- (-555.655) (-554.959) (-552.438) [-551.852] * (-553.763) [-551.469] (-551.681) (-551.762) -- 0:00:28
613500 -- (-553.818) (-552.040) (-551.218) [-551.615] * (-552.485) [-550.579] (-553.955) (-553.971) -- 0:00:28
614000 -- (-559.294) (-550.840) [-556.101] (-551.331) * [-551.681] (-550.579) (-551.251) (-550.314) -- 0:00:28
614500 -- (-551.277) (-551.237) (-555.832) [-550.444] * (-552.513) (-553.401) [-550.619] (-551.038) -- 0:00:28
615000 -- (-551.918) [-550.649] (-551.380) (-552.020) * (-552.159) (-553.365) [-549.588] (-553.675) -- 0:00:28
Average standard deviation of split frequencies: 0.010255
615500 -- (-552.824) [-551.250] (-552.022) (-550.944) * (-551.849) (-551.828) [-549.218] (-553.290) -- 0:00:28
616000 -- (-550.744) (-553.122) (-551.402) [-551.217] * (-552.325) (-550.635) [-549.588] (-558.867) -- 0:00:28
616500 -- (-550.944) (-551.427) [-551.287] (-548.881) * [-550.791] (-552.615) (-550.862) (-550.967) -- 0:00:27
617000 -- (-552.388) (-554.518) [-553.924] (-554.698) * (-552.291) [-553.342] (-549.271) (-549.868) -- 0:00:27
617500 -- (-553.844) (-554.273) (-553.518) [-549.500] * (-551.634) (-551.384) (-551.265) [-549.839] -- 0:00:27
618000 -- (-551.947) (-550.795) (-552.341) [-552.098] * (-552.044) (-552.377) (-550.415) [-551.308] -- 0:00:27
618500 -- (-551.224) [-550.600] (-551.072) (-550.212) * (-551.952) [-549.861] (-549.008) (-551.886) -- 0:00:27
619000 -- (-552.351) [-551.752] (-555.855) (-550.161) * (-550.518) (-551.802) [-550.180] (-552.796) -- 0:00:28
619500 -- [-552.655] (-552.332) (-551.525) (-551.643) * (-550.512) [-551.992] (-549.567) (-551.424) -- 0:00:28
620000 -- (-553.717) [-554.096] (-551.162) (-553.066) * [-552.046] (-549.963) (-549.487) (-549.381) -- 0:00:28
Average standard deviation of split frequencies: 0.009823
620500 -- (-552.789) [-552.167] (-550.317) (-550.893) * [-555.274] (-555.432) (-551.200) (-551.054) -- 0:00:28
621000 -- (-550.541) (-553.117) (-551.394) [-551.279] * [-552.334] (-556.705) (-551.118) (-551.854) -- 0:00:28
621500 -- (-552.103) (-551.371) [-549.375] (-550.701) * (-552.256) (-549.236) [-551.168] (-551.123) -- 0:00:28
622000 -- (-550.941) (-552.841) [-549.243] (-553.798) * (-552.750) [-550.668] (-550.753) (-548.903) -- 0:00:27
622500 -- (-552.148) (-552.799) [-550.134] (-550.975) * (-551.753) [-547.826] (-551.879) (-552.861) -- 0:00:27
623000 -- (-550.910) (-552.069) (-553.053) [-549.694] * (-552.044) (-548.837) [-551.637] (-549.989) -- 0:00:27
623500 -- (-554.527) [-549.958] (-551.448) (-552.427) * (-551.846) (-551.506) [-549.441] (-551.661) -- 0:00:27
624000 -- (-553.130) [-549.421] (-553.128) (-550.859) * (-551.470) (-549.168) (-550.453) [-552.603] -- 0:00:27
624500 -- (-553.504) (-553.423) (-552.966) [-549.602] * (-550.910) (-549.349) [-550.897] (-551.114) -- 0:00:27
625000 -- (-551.524) (-550.756) [-552.632] (-550.668) * (-551.343) (-549.967) (-551.515) [-548.943] -- 0:00:27
Average standard deviation of split frequencies: 0.009225
625500 -- (-554.003) [-550.541] (-554.366) (-551.396) * [-550.617] (-550.148) (-553.362) (-549.549) -- 0:00:27
626000 -- (-551.827) [-549.049] (-559.303) (-554.195) * (-549.377) (-552.009) (-553.555) [-548.946] -- 0:00:27
626500 -- (-551.646) (-551.837) (-553.170) [-553.344] * (-551.740) [-552.150] (-552.707) (-553.053) -- 0:00:27
627000 -- (-553.645) (-553.951) (-553.515) [-552.717] * (-550.723) (-553.216) [-553.107] (-551.115) -- 0:00:27
627500 -- (-551.129) (-554.238) (-552.759) [-551.167] * [-551.027] (-548.543) (-553.159) (-549.998) -- 0:00:27
628000 -- (-554.613) (-551.935) [-551.022] (-550.530) * (-553.737) (-549.806) [-554.715] (-550.049) -- 0:00:27
628500 -- (-553.163) [-558.589] (-555.570) (-550.317) * (-552.417) [-548.248] (-551.936) (-549.995) -- 0:00:27
629000 -- [-552.577] (-558.735) (-554.878) (-550.716) * [-549.912] (-551.383) (-551.193) (-550.243) -- 0:00:27
629500 -- (-549.591) (-551.974) [-551.170] (-552.088) * (-549.457) (-553.443) [-551.449] (-550.540) -- 0:00:27
630000 -- (-550.731) [-552.776] (-550.444) (-553.024) * [-550.014] (-548.180) (-558.498) (-551.103) -- 0:00:27
Average standard deviation of split frequencies: 0.009717
630500 -- (-553.207) (-553.677) (-549.554) [-552.768] * [-553.149] (-554.223) (-552.463) (-551.706) -- 0:00:26
631000 -- (-550.031) [-549.250] (-551.884) (-551.668) * (-552.310) [-552.099] (-550.480) (-553.062) -- 0:00:26
631500 -- (-553.218) [-555.049] (-552.725) (-554.094) * [-550.408] (-551.506) (-549.589) (-551.068) -- 0:00:26
632000 -- (-551.338) (-553.339) [-550.328] (-556.295) * [-551.410] (-551.208) (-549.907) (-552.178) -- 0:00:26
632500 -- [-550.688] (-553.702) (-552.056) (-549.830) * [-551.505] (-550.310) (-552.313) (-550.120) -- 0:00:26
633000 -- [-549.285] (-553.246) (-555.712) (-551.608) * (-552.030) (-555.180) (-549.626) [-549.207] -- 0:00:27
633500 -- (-551.048) [-551.467] (-553.253) (-551.139) * (-549.955) (-552.538) (-551.413) [-550.463] -- 0:00:27
634000 -- [-551.953] (-549.567) (-551.610) (-551.657) * (-552.467) (-551.220) [-553.451] (-552.722) -- 0:00:27
634500 -- (-551.745) [-551.500] (-550.327) (-553.478) * (-551.217) (-552.355) [-551.816] (-555.956) -- 0:00:27
635000 -- [-549.291] (-554.251) (-552.296) (-553.974) * (-552.899) (-551.488) (-551.219) [-551.711] -- 0:00:27
Average standard deviation of split frequencies: 0.010072
635500 -- (-552.083) [-551.473] (-553.207) (-550.812) * (-555.262) (-548.685) [-550.939] (-550.017) -- 0:00:26
636000 -- [-552.113] (-550.307) (-553.035) (-554.582) * (-556.054) (-550.289) [-552.053] (-554.588) -- 0:00:26
636500 -- (-551.137) [-551.425] (-549.859) (-554.339) * (-551.103) (-553.539) (-549.958) [-549.846] -- 0:00:26
637000 -- [-550.478] (-552.872) (-552.535) (-553.434) * (-555.466) (-550.673) (-552.818) [-549.446] -- 0:00:26
637500 -- [-551.122] (-551.137) (-556.475) (-554.660) * (-558.281) [-555.806] (-552.620) (-551.107) -- 0:00:26
638000 -- (-551.628) (-550.814) [-553.277] (-551.950) * [-549.640] (-552.160) (-548.328) (-551.389) -- 0:00:26
638500 -- (-554.010) (-550.608) [-551.155] (-554.360) * [-548.355] (-555.313) (-550.180) (-550.962) -- 0:00:26
639000 -- (-552.016) [-550.472] (-551.966) (-554.045) * (-551.360) [-552.960] (-551.874) (-550.160) -- 0:00:26
639500 -- (-552.617) [-550.791] (-552.282) (-551.479) * (-549.236) (-551.496) (-554.357) [-550.640] -- 0:00:26
640000 -- (-549.016) (-550.290) (-551.716) [-550.640] * (-549.817) [-553.263] (-552.607) (-550.780) -- 0:00:26
Average standard deviation of split frequencies: 0.009825
640500 -- (-552.487) (-552.321) [-554.176] (-552.297) * [-549.586] (-551.019) (-554.083) (-551.831) -- 0:00:26
641000 -- (-550.431) [-553.599] (-553.657) (-551.089) * [-550.130] (-551.635) (-551.736) (-558.386) -- 0:00:26
641500 -- (-550.833) [-552.009] (-551.211) (-552.406) * (-552.216) [-549.374] (-554.380) (-551.485) -- 0:00:26
642000 -- (-550.378) (-552.466) (-550.561) [-549.545] * (-550.466) (-552.985) [-549.398] (-555.274) -- 0:00:26
642500 -- (-551.916) (-552.542) (-552.066) [-549.306] * [-548.267] (-553.970) (-550.853) (-550.639) -- 0:00:26
643000 -- (-551.826) (-551.870) [-551.577] (-550.206) * (-554.326) (-552.560) [-549.886] (-549.241) -- 0:00:26
643500 -- (-550.659) [-550.281] (-552.363) (-555.687) * (-549.761) [-552.509] (-550.315) (-553.327) -- 0:00:26
644000 -- (-550.495) (-549.750) [-553.453] (-550.305) * (-549.668) (-555.300) (-553.819) [-554.161] -- 0:00:25
644500 -- (-550.540) (-552.701) (-549.742) [-550.916] * (-552.195) [-552.781] (-553.603) (-554.655) -- 0:00:25
645000 -- (-550.226) (-551.437) (-551.833) [-550.473] * (-559.563) (-554.812) (-554.834) [-550.642] -- 0:00:25
Average standard deviation of split frequencies: 0.009744
645500 -- (-550.114) (-549.481) (-551.154) [-550.562] * [-549.630] (-554.933) (-553.170) (-551.798) -- 0:00:25
646000 -- (-552.527) (-549.613) (-556.947) [-549.265] * [-548.593] (-552.929) (-551.221) (-551.522) -- 0:00:25
646500 -- (-552.098) (-551.406) [-551.145] (-552.894) * (-548.565) (-553.001) (-550.178) [-552.942] -- 0:00:25
647000 -- (-549.719) (-552.221) [-551.322] (-552.718) * [-548.397] (-550.692) (-550.470) (-553.924) -- 0:00:26
647500 -- (-551.288) (-556.011) (-549.275) [-550.735] * (-548.608) (-553.771) [-552.883] (-551.624) -- 0:00:26
648000 -- [-550.048] (-551.948) (-549.583) (-552.187) * (-550.750) (-551.310) (-552.164) [-552.517] -- 0:00:26
648500 -- (-552.229) (-553.371) (-548.054) [-548.874] * (-553.520) (-550.406) (-551.387) [-550.941] -- 0:00:26
649000 -- [-558.235] (-553.139) (-552.091) (-553.961) * (-555.161) (-551.261) (-553.512) [-550.084] -- 0:00:25
649500 -- (-554.415) (-551.764) [-549.216] (-553.279) * (-552.474) [-551.200] (-555.868) (-555.849) -- 0:00:25
650000 -- (-553.254) (-552.124) [-549.770] (-554.909) * (-555.954) (-549.487) (-555.106) [-551.205] -- 0:00:25
Average standard deviation of split frequencies: 0.009376
650500 -- [-550.397] (-550.626) (-550.993) (-551.829) * (-553.772) (-550.723) (-549.347) [-553.231] -- 0:00:25
651000 -- [-548.709] (-550.590) (-551.793) (-550.588) * (-552.750) (-550.354) [-549.492] (-553.879) -- 0:00:25
651500 -- (-550.831) (-550.638) [-551.458] (-552.952) * [-551.441] (-551.620) (-549.476) (-554.232) -- 0:00:25
652000 -- (-549.225) (-554.996) (-555.562) [-551.599] * (-554.337) [-557.348] (-549.492) (-550.681) -- 0:00:25
652500 -- [-551.269] (-551.806) (-552.429) (-552.256) * (-551.973) (-552.677) [-550.974] (-550.994) -- 0:00:25
653000 -- (-550.351) (-552.827) [-550.410] (-557.046) * (-552.495) (-554.187) [-551.210] (-551.711) -- 0:00:25
653500 -- (-550.227) (-552.110) [-548.350] (-551.995) * (-551.743) [-551.248] (-549.948) (-551.915) -- 0:00:25
654000 -- [-549.506] (-549.831) (-552.056) (-551.850) * (-552.398) [-551.796] (-550.341) (-550.871) -- 0:00:25
654500 -- (-551.705) (-555.732) (-553.671) [-552.856] * [-550.513] (-550.325) (-554.592) (-551.825) -- 0:00:25
655000 -- (-562.600) (-553.836) [-551.213] (-553.849) * (-550.255) [-551.010] (-551.517) (-553.652) -- 0:00:25
Average standard deviation of split frequencies: 0.009004
655500 -- [-550.775] (-553.558) (-553.258) (-552.757) * (-549.443) (-550.049) (-550.268) [-550.511] -- 0:00:25
656000 -- (-554.224) [-551.172] (-550.392) (-555.386) * [-550.603] (-555.054) (-549.981) (-550.761) -- 0:00:25
656500 -- (-550.893) (-551.680) (-548.698) [-555.529] * [-554.135] (-553.116) (-552.292) (-551.357) -- 0:00:25
657000 -- (-548.623) [-548.717] (-551.903) (-554.671) * (-556.907) (-551.924) [-549.294] (-550.951) -- 0:00:25
657500 -- (-552.327) (-552.860) [-549.756] (-557.986) * (-551.190) (-552.173) (-550.136) [-550.543] -- 0:00:25
658000 -- (-550.823) [-548.020] (-550.958) (-550.977) * (-551.080) (-551.434) (-554.318) [-550.110] -- 0:00:24
658500 -- [-552.693] (-552.374) (-553.578) (-551.113) * (-550.806) (-552.049) (-549.630) [-549.752] -- 0:00:24
659000 -- (-552.742) (-549.271) (-554.169) [-550.704] * (-551.740) [-551.472] (-550.227) (-548.214) -- 0:00:24
659500 -- (-551.784) (-549.459) (-550.393) [-550.717] * (-553.132) [-550.538] (-548.542) (-550.352) -- 0:00:24
660000 -- (-554.987) [-550.346] (-551.812) (-552.609) * (-552.627) (-551.633) [-549.491] (-549.914) -- 0:00:25
Average standard deviation of split frequencies: 0.009142
660500 -- (-553.993) (-549.889) [-552.711] (-551.397) * (-552.550) (-550.055) (-550.571) [-548.561] -- 0:00:25
661000 -- (-555.733) (-550.614) [-549.004] (-551.219) * (-553.064) [-549.713] (-552.384) (-552.585) -- 0:00:25
661500 -- (-553.489) (-550.880) (-552.919) [-548.948] * (-551.728) [-549.606] (-553.488) (-550.853) -- 0:00:25
662000 -- [-550.869] (-550.778) (-554.998) (-557.651) * (-551.617) (-555.299) [-552.951] (-550.090) -- 0:00:25
662500 -- (-553.147) (-554.693) (-553.348) [-550.909] * (-554.539) (-551.203) (-548.240) [-553.379] -- 0:00:24
663000 -- (-552.565) (-550.899) (-550.385) [-547.926] * (-555.018) (-551.836) [-549.106] (-551.953) -- 0:00:24
663500 -- (-553.197) [-552.070] (-549.628) (-548.074) * [-552.739] (-552.440) (-552.812) (-552.295) -- 0:00:24
664000 -- (-552.609) [-549.487] (-549.738) (-548.637) * [-550.783] (-551.537) (-553.047) (-555.041) -- 0:00:24
664500 -- (-552.605) (-550.459) (-551.531) [-551.158] * (-552.289) [-549.859] (-552.289) (-556.108) -- 0:00:24
665000 -- (-550.418) (-550.906) [-550.675] (-550.961) * (-552.930) (-549.875) (-552.364) [-552.457] -- 0:00:24
Average standard deviation of split frequencies: 0.009326
665500 -- [-549.877] (-550.422) (-551.935) (-550.928) * (-551.516) (-550.894) (-553.642) [-554.221] -- 0:00:24
666000 -- (-550.498) [-552.345] (-552.64 