--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:06:01 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/lpqH/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -654.27 -657.12
2 -654.21 -658.28
--------------------------------------
TOTAL -654.24 -657.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888514 0.088629 0.375146 1.483672 0.851039 1420.45 1460.73 1.000
r(A<->C){all} 0.153201 0.016744 0.000043 0.405999 0.118647 174.74 225.03 1.002
r(A<->G){all} 0.179335 0.022460 0.000038 0.483450 0.140998 212.16 221.06 1.004
r(A<->T){all} 0.159330 0.017737 0.000060 0.427189 0.123242 159.04 216.62 1.000
r(C<->G){all} 0.161855 0.018476 0.000086 0.430613 0.127731 160.69 281.23 1.001
r(C<->T){all} 0.186836 0.023737 0.000120 0.495206 0.146767 239.01 296.85 1.004
r(G<->T){all} 0.159443 0.019027 0.000012 0.441117 0.122458 197.32 255.42 1.001
pi(A){all} 0.250571 0.000401 0.207994 0.285566 0.250584 1343.69 1344.14 1.000
pi(C){all} 0.325034 0.000461 0.285584 0.369667 0.324685 1107.87 1173.54 1.000
pi(G){all} 0.274715 0.000414 0.234658 0.314731 0.274128 1065.17 1264.05 1.000
pi(T){all} 0.149681 0.000261 0.117448 0.180889 0.149252 1084.50 1188.49 1.000
alpha{1,2} 0.412857 0.217771 0.000166 1.337471 0.247888 1226.43 1344.00 1.001
alpha{3} 0.439860 0.222823 0.000152 1.403974 0.278780 1212.74 1242.61 1.000
pinvar{all} 0.996716 0.000016 0.989474 0.999998 0.997962 1385.37 1438.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -606.00056
Model 2: PositiveSelection -606.000549
Model 0: one-ratio -606.000565
Model 7: beta -606.000562
Model 8: beta&w>1 -606.000551
Model 0 vs 1 1.0000000202126103E-5
Model 2 vs 1 2.199999994445534E-5
Model 8 vs 7 2.199999994445534E-5
>C1
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C2
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C3
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C4
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C5
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C6
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=161
C1 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C2 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C3 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C4 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C5 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C6 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
**************************************************
C1 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C2 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C3 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C4 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C5 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C6 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
**************************************************
C1 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C2 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C3 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C4 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C5 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C6 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
**************************************************
C1 HKSFEIEVTCR
C2 HKSFEIEVTCR
C3 HKSFEIEVTCR
C4 HKSFEIEVTCR
C5 HKSFEIEVTCR
C6 HKSFEIEVTCR
***********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4830]--->[4830]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.470 Mb, Max= 30.697 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C2 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C3 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C4 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C5 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C6 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
**************************************************
C1 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C2 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C3 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C4 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C5 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C6 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
**************************************************
C1 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C2 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C3 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C4 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C5 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C6 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
**************************************************
C1 HKSFEIEVTCR
C2 HKSFEIEVTCR
C3 HKSFEIEVTCR
C4 HKSFEIEVTCR
C5 HKSFEIEVTCR
C6 HKSFEIEVTCR
***********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
C2 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
C3 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
C4 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
C5 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
C6 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
**************************************************
C1 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
C2 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
C3 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
C4 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
C5 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
C6 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
**************************************************
C1 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
C2 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
C3 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
C4 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
C5 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
C6 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
**************************************************
C1 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
C2 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
C3 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
C4 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
C5 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
C6 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
**************************************************
C1 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
C2 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
C3 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
C4 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
C5 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
C6 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
**************************************************
C1 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
C2 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
C3 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
C4 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
C5 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
C6 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
**************************************************
C1 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
C2 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
C3 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
C4 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
C5 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
C6 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
**************************************************
C1 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
C2 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
C3 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
C4 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
C5 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
C6 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
**************************************************
C1 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
C2 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
C3 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
C4 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
C5 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
C6 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
**************************************************
C1 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
C2 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
C3 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
C4 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
C5 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
C6 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
*********************************
>C1
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C2
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C3
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C4
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C5
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C6
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C1
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C2
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C3
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C4
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C5
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C6
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 483 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791876
Setting output file names to "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1084329827
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0043475635
Seed = 1949380451
Swapseed = 1579791876
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1080.977161 -- -24.965149
Chain 2 -- -1080.977161 -- -24.965149
Chain 3 -- -1080.977161 -- -24.965149
Chain 4 -- -1080.976996 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1080.977161 -- -24.965149
Chain 2 -- -1080.977100 -- -24.965149
Chain 3 -- -1080.977161 -- -24.965149
Chain 4 -- -1080.977100 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1080.977] (-1080.977) (-1080.977) (-1080.977) * [-1080.977] (-1080.977) (-1080.977) (-1080.977)
500 -- (-682.147) [-675.538] (-668.616) (-672.662) * (-678.737) (-681.152) [-668.668] (-663.586) -- 0:00:00
1000 -- (-675.466) (-668.836) (-665.153) [-663.050] * (-672.153) (-673.959) [-661.047] (-665.712) -- 0:00:00
1500 -- [-660.433] (-667.156) (-660.911) (-665.666) * (-669.082) (-664.359) [-665.476] (-667.629) -- 0:00:00
2000 -- (-665.110) (-665.986) (-660.187) [-665.318] * (-670.573) (-663.730) (-664.986) [-658.872] -- 0:00:00
2500 -- (-662.089) [-662.627] (-668.798) (-661.091) * (-669.521) (-661.473) [-663.635] (-661.508) -- 0:00:00
3000 -- [-659.598] (-671.726) (-660.195) (-666.066) * [-667.464] (-661.932) (-662.201) (-661.686) -- 0:00:00
3500 -- (-661.955) (-661.174) [-665.005] (-665.004) * (-666.073) [-659.071] (-664.049) (-666.635) -- 0:00:00
4000 -- [-664.281] (-661.168) (-662.629) (-669.364) * [-666.178] (-664.076) (-672.450) (-669.831) -- 0:00:00
4500 -- [-664.117] (-663.339) (-668.517) (-664.868) * (-667.357) (-662.056) [-661.008] (-669.575) -- 0:03:41
5000 -- [-661.824] (-662.550) (-659.684) (-671.059) * (-664.581) (-662.641) (-669.437) [-664.161] -- 0:03:19
Average standard deviation of split frequencies: 0.095647
5500 -- (-670.756) (-663.796) (-662.499) [-667.864] * (-662.806) [-660.934] (-660.981) (-669.081) -- 0:03:00
6000 -- (-662.833) [-665.383] (-669.149) (-665.176) * (-668.290) [-670.572] (-671.003) (-665.792) -- 0:02:45
6500 -- [-665.609] (-666.606) (-662.956) (-668.954) * (-664.139) (-661.225) (-666.147) [-665.160] -- 0:02:32
7000 -- (-665.404) [-660.671] (-670.400) (-661.886) * (-668.463) (-662.187) [-665.472] (-669.082) -- 0:02:21
7500 -- (-659.193) (-664.250) (-661.057) [-662.371] * (-661.260) (-665.295) (-657.289) [-664.618] -- 0:02:12
8000 -- [-666.823] (-659.992) (-668.248) (-662.877) * (-663.033) [-671.445] (-661.026) (-664.222) -- 0:02:04
8500 -- (-662.023) (-662.535) [-665.524] (-658.900) * (-664.963) (-672.534) [-664.303] (-659.943) -- 0:01:56
9000 -- [-673.339] (-670.863) (-665.400) (-663.384) * [-662.682] (-662.945) (-661.281) (-672.974) -- 0:01:50
9500 -- [-668.913] (-663.409) (-670.980) (-664.731) * (-656.125) (-655.994) (-669.688) [-670.446] -- 0:01:44
10000 -- [-666.519] (-661.494) (-671.451) (-661.923) * [-666.747] (-654.061) (-667.335) (-672.166) -- 0:01:39
Average standard deviation of split frequencies: 0.090493
10500 -- (-668.187) [-664.509] (-660.229) (-670.006) * [-663.536] (-654.953) (-661.410) (-665.323) -- 0:01:34
11000 -- (-663.835) [-662.099] (-663.859) (-656.186) * (-665.943) (-657.596) (-664.575) [-660.492] -- 0:01:29
11500 -- [-664.851] (-668.678) (-667.070) (-663.852) * (-656.659) [-655.310] (-664.075) (-664.337) -- 0:01:25
12000 -- (-662.843) [-663.267] (-666.879) (-667.304) * (-668.136) (-653.178) [-663.561] (-664.524) -- 0:01:22
12500 -- (-663.539) (-661.872) (-669.079) [-663.245] * [-665.533] (-655.369) (-679.706) (-672.597) -- 0:01:19
13000 -- [-665.081] (-669.103) (-660.320) (-666.430) * [-662.872] (-656.563) (-675.899) (-661.503) -- 0:01:15
13500 -- (-668.876) (-664.018) [-663.694] (-669.193) * (-661.806) (-656.603) [-655.740] (-666.112) -- 0:01:13
14000 -- (-662.075) [-659.650] (-662.105) (-657.414) * (-667.141) (-657.770) [-654.213] (-661.075) -- 0:01:10
14500 -- (-664.058) (-665.347) [-660.015] (-667.166) * (-667.855) (-655.839) [-652.815] (-666.250) -- 0:01:07
15000 -- (-667.784) (-664.598) (-664.456) [-660.294] * (-667.022) (-655.759) [-654.234] (-668.047) -- 0:01:05
Average standard deviation of split frequencies: 0.063836
15500 -- (-668.894) (-668.361) (-654.474) [-658.601] * (-660.132) (-655.331) [-654.347] (-669.302) -- 0:01:03
16000 -- (-669.211) (-662.996) [-657.144] (-662.359) * (-662.710) (-653.544) [-653.569] (-663.806) -- 0:01:01
16500 -- [-672.326] (-660.903) (-654.138) (-663.512) * (-664.162) (-654.674) [-658.983] (-663.517) -- 0:00:59
17000 -- [-663.936] (-660.827) (-654.938) (-664.915) * (-662.501) (-654.983) [-654.700] (-664.499) -- 0:00:57
17500 -- (-668.531) [-659.695] (-652.941) (-665.260) * (-668.252) (-653.812) [-656.680] (-660.227) -- 0:00:56
18000 -- (-666.621) (-671.640) [-653.820] (-669.822) * (-664.299) (-659.301) [-653.192] (-671.827) -- 0:00:54
18500 -- (-663.195) (-658.941) (-657.287) [-663.209] * (-665.904) (-653.631) (-655.894) [-667.561] -- 0:00:53
19000 -- (-664.637) (-666.000) [-652.975] (-672.686) * (-667.085) [-653.181] (-659.038) (-669.947) -- 0:00:51
19500 -- (-666.029) (-661.735) (-653.789) [-662.178] * (-665.892) [-656.773] (-656.698) (-666.047) -- 0:01:40
20000 -- (-661.522) (-666.953) (-653.346) [-663.161] * (-666.346) (-658.244) [-654.706] (-664.274) -- 0:01:38
Average standard deviation of split frequencies: 0.073499
20500 -- (-664.611) [-664.549] (-655.111) (-672.337) * (-672.817) (-659.095) (-653.891) [-666.956] -- 0:01:35
21000 -- (-671.851) [-659.973] (-654.751) (-664.512) * (-668.430) (-654.016) (-653.845) [-663.143] -- 0:01:33
21500 -- [-662.848] (-661.981) (-654.318) (-667.357) * (-672.160) (-656.508) [-653.440] (-659.880) -- 0:01:31
22000 -- (-659.315) (-665.131) [-654.676] (-663.239) * (-665.941) [-653.265] (-654.017) (-670.352) -- 0:01:28
22500 -- [-664.311] (-668.272) (-655.626) (-661.955) * (-664.454) (-656.421) [-654.962] (-664.072) -- 0:01:26
23000 -- [-657.407] (-667.304) (-655.336) (-666.370) * (-666.180) (-658.574) (-654.181) [-665.714] -- 0:01:24
23500 -- (-663.118) (-668.184) [-655.748] (-664.232) * (-668.404) (-654.670) [-656.521] (-667.381) -- 0:01:23
24000 -- [-663.515] (-673.546) (-653.826) (-661.897) * [-668.077] (-654.287) (-658.006) (-668.476) -- 0:01:21
24500 -- [-663.857] (-661.964) (-657.112) (-662.712) * (-670.793) (-654.260) [-655.337] (-659.869) -- 0:01:19
25000 -- (-670.270) (-664.095) [-654.250] (-664.964) * (-663.268) (-654.231) (-653.101) [-663.774] -- 0:01:18
Average standard deviation of split frequencies: 0.056983
25500 -- [-661.870] (-667.103) (-654.660) (-664.723) * (-666.753) (-655.701) (-653.125) [-658.687] -- 0:01:16
26000 -- (-668.197) (-670.259) [-653.942] (-664.184) * (-671.209) (-653.607) (-653.337) [-661.214] -- 0:01:14
26500 -- (-668.660) [-663.011] (-654.595) (-661.345) * (-663.565) [-654.643] (-654.998) (-659.518) -- 0:01:13
27000 -- (-666.814) (-665.261) (-656.395) [-664.248] * (-663.602) (-653.869) [-659.583] (-661.022) -- 0:01:12
27500 -- [-663.527] (-674.932) (-653.949) (-670.909) * (-669.600) [-656.327] (-656.167) (-663.027) -- 0:01:10
28000 -- (-663.455) [-659.958] (-656.836) (-663.807) * (-665.939) (-654.600) (-657.895) [-659.387] -- 0:01:09
28500 -- (-662.697) [-663.980] (-653.507) (-664.113) * (-666.289) (-653.951) (-655.608) [-659.147] -- 0:01:08
29000 -- (-668.577) (-666.004) (-657.141) [-664.041] * (-670.641) (-654.321) [-654.182] (-671.919) -- 0:01:06
29500 -- [-670.588] (-668.181) (-655.983) (-668.459) * (-666.235) (-655.219) (-654.265) [-662.468] -- 0:01:05
30000 -- [-670.587] (-661.508) (-655.619) (-660.582) * (-663.648) (-653.856) (-653.085) [-662.839] -- 0:01:04
Average standard deviation of split frequencies: 0.048212
30500 -- (-664.295) (-659.971) [-658.119] (-664.645) * (-663.639) [-656.559] (-654.352) (-663.801) -- 0:01:03
31000 -- (-661.716) (-671.189) (-657.254) [-659.018] * (-662.658) (-657.180) [-653.832] (-660.320) -- 0:01:02
31500 -- [-661.055] (-664.938) (-659.348) (-662.532) * (-670.569) (-654.422) (-653.423) [-664.119] -- 0:01:01
32000 -- (-678.322) (-659.014) (-655.694) [-662.046] * (-660.525) (-658.381) (-653.217) [-659.613] -- 0:01:00
32500 -- (-672.836) (-670.193) (-653.884) [-661.928] * (-659.942) [-657.219] (-654.120) (-666.877) -- 0:00:59
33000 -- [-662.633] (-668.974) (-657.530) (-666.396) * (-662.104) (-656.424) [-654.317] (-659.375) -- 0:00:58
33500 -- [-670.368] (-669.482) (-660.774) (-670.856) * (-663.464) (-655.781) (-654.109) [-658.484] -- 0:00:57
34000 -- [-661.844] (-666.071) (-654.781) (-664.621) * (-665.275) (-654.325) (-655.063) [-659.267] -- 0:01:25
34500 -- (-663.648) (-663.424) [-654.533] (-660.742) * (-676.864) [-655.850] (-654.052) (-674.279) -- 0:01:23
35000 -- [-659.840] (-663.138) (-653.475) (-658.167) * (-658.579) (-654.931) [-655.811] (-668.203) -- 0:01:22
Average standard deviation of split frequencies: 0.045236
35500 -- (-665.393) (-666.995) [-654.201] (-657.555) * [-658.064] (-656.307) (-654.552) (-670.924) -- 0:01:21
36000 -- [-667.698] (-664.645) (-653.789) (-653.970) * [-656.250] (-654.767) (-656.385) (-673.727) -- 0:01:20
36500 -- (-660.680) (-663.919) [-656.643] (-654.798) * (-658.971) (-654.613) [-654.925] (-665.039) -- 0:01:19
37000 -- (-663.557) (-667.112) [-656.232] (-654.011) * (-654.018) (-655.033) (-656.154) [-657.701] -- 0:01:18
37500 -- [-658.254] (-671.238) (-654.362) (-654.802) * [-655.740] (-655.421) (-657.032) (-665.909) -- 0:01:17
38000 -- [-657.762] (-662.425) (-653.674) (-654.623) * (-656.152) [-653.230] (-656.487) (-660.908) -- 0:01:15
38500 -- (-669.768) [-659.495] (-654.961) (-655.730) * (-657.064) (-652.994) [-654.382] (-668.196) -- 0:01:14
39000 -- (-662.585) [-659.116] (-654.652) (-657.990) * (-655.086) [-653.401] (-654.639) (-663.509) -- 0:01:13
39500 -- [-666.667] (-659.661) (-655.026) (-656.295) * (-657.526) (-653.771) [-657.407] (-663.450) -- 0:01:12
40000 -- (-661.212) (-667.605) (-655.547) [-654.214] * (-657.555) (-654.749) [-654.665] (-667.664) -- 0:01:12
Average standard deviation of split frequencies: 0.041400
40500 -- (-659.270) (-677.042) (-655.235) [-654.721] * (-659.207) (-656.257) [-653.592] (-660.494) -- 0:01:11
41000 -- (-666.311) (-668.817) (-655.283) [-655.698] * (-654.434) (-652.905) [-652.765] (-670.806) -- 0:01:10
41500 -- (-661.782) (-671.481) [-655.170] (-657.013) * [-653.492] (-653.590) (-657.837) (-662.722) -- 0:01:09
42000 -- (-664.287) [-658.583] (-655.540) (-658.519) * (-658.412) (-655.918) [-655.427] (-660.074) -- 0:01:08
42500 -- (-673.376) (-664.944) [-652.808] (-655.326) * (-656.897) (-660.779) [-656.842] (-663.302) -- 0:01:07
43000 -- (-662.105) [-660.519] (-655.383) (-662.040) * (-655.043) [-656.401] (-657.808) (-664.360) -- 0:01:06
43500 -- (-665.278) (-677.097) (-655.840) [-656.482] * [-656.476] (-657.684) (-655.423) (-664.826) -- 0:01:05
44000 -- (-665.386) [-658.693] (-655.633) (-655.671) * [-653.556] (-659.540) (-657.776) (-662.602) -- 0:01:05
44500 -- (-664.765) (-667.536) (-652.994) [-656.844] * (-655.068) (-654.458) (-653.910) [-662.359] -- 0:01:04
45000 -- [-663.012] (-666.100) (-657.799) (-658.416) * (-654.798) (-655.716) (-654.119) [-663.174] -- 0:01:03
Average standard deviation of split frequencies: 0.039655
45500 -- (-664.494) [-667.128] (-654.213) (-660.373) * (-657.061) (-654.317) (-656.340) [-665.379] -- 0:01:02
46000 -- (-665.945) (-671.414) (-653.873) [-658.866] * (-655.257) (-655.029) [-656.055] (-663.196) -- 0:01:02
46500 -- (-662.794) [-662.690] (-653.986) (-654.578) * (-653.636) [-653.962] (-655.768) (-657.010) -- 0:01:01
47000 -- (-669.133) [-661.245] (-654.586) (-655.321) * [-653.458] (-657.250) (-656.968) (-661.937) -- 0:01:00
47500 -- [-664.134] (-663.348) (-654.547) (-656.720) * (-654.504) (-655.929) (-657.867) [-665.082] -- 0:01:00
48000 -- (-667.716) (-664.595) [-653.184] (-653.680) * (-654.159) (-654.178) [-657.964] (-657.934) -- 0:01:19
48500 -- (-663.346) [-659.043] (-654.211) (-654.261) * (-653.839) (-653.779) (-653.421) [-661.865] -- 0:01:18
49000 -- (-663.924) (-662.876) (-655.077) [-653.628] * (-653.622) (-654.166) (-656.013) [-664.267] -- 0:01:17
49500 -- [-662.703] (-664.600) (-655.718) (-653.714) * (-656.013) (-656.839) (-658.341) [-663.935] -- 0:01:16
50000 -- [-673.669] (-668.980) (-658.283) (-656.411) * (-657.361) (-656.455) [-656.706] (-669.470) -- 0:01:16
Average standard deviation of split frequencies: 0.041204
50500 -- (-660.128) [-658.566] (-655.478) (-659.966) * (-657.823) (-654.223) [-653.961] (-670.612) -- 0:01:15
51000 -- (-664.626) [-675.115] (-656.120) (-656.661) * [-661.701] (-661.047) (-653.137) (-659.970) -- 0:01:14
51500 -- (-671.931) (-663.280) (-661.130) [-654.605] * [-654.388] (-661.162) (-654.428) (-672.640) -- 0:01:13
52000 -- (-668.423) (-668.553) (-661.526) [-657.398] * (-655.560) (-654.804) [-655.678] (-665.839) -- 0:01:12
52500 -- (-665.118) [-659.622] (-657.162) (-654.208) * (-660.266) (-654.879) [-652.983] (-665.174) -- 0:01:12
53000 -- [-665.923] (-657.886) (-655.611) (-653.529) * (-656.680) (-654.127) [-653.711] (-663.387) -- 0:01:11
53500 -- (-666.348) (-663.157) (-653.727) [-655.988] * (-653.007) (-653.778) (-656.359) [-663.171] -- 0:01:10
54000 -- (-668.409) (-664.073) [-653.985] (-655.695) * (-653.168) (-653.563) [-656.384] (-669.127) -- 0:01:10
54500 -- (-669.306) (-662.165) [-654.137] (-654.620) * (-652.725) [-653.893] (-654.767) (-661.735) -- 0:01:09
55000 -- (-669.606) (-662.253) [-653.832] (-653.265) * (-654.422) [-655.921] (-655.587) (-664.925) -- 0:01:08
Average standard deviation of split frequencies: 0.044305
55500 -- (-668.934) (-663.475) (-653.619) [-654.394] * (-653.625) [-654.591] (-655.700) (-663.079) -- 0:01:08
56000 -- (-661.448) [-659.933] (-656.833) (-653.802) * (-654.788) (-653.737) (-655.452) [-673.580] -- 0:01:07
56500 -- (-663.313) [-665.637] (-653.400) (-653.244) * (-655.761) (-656.443) [-652.891] (-663.118) -- 0:01:06
57000 -- [-664.878] (-666.782) (-655.906) (-655.109) * (-655.461) (-655.260) (-656.344) [-663.005] -- 0:01:06
57500 -- [-663.878] (-660.865) (-655.921) (-655.298) * (-653.790) (-653.530) (-655.336) [-661.498] -- 0:01:05
58000 -- (-666.324) (-665.561) (-653.003) [-657.249] * (-655.429) (-654.224) [-654.447] (-663.389) -- 0:01:04
58500 -- (-665.745) (-661.181) (-653.621) [-654.945] * (-656.518) (-653.973) (-655.013) [-662.866] -- 0:01:04
59000 -- (-662.630) [-662.385] (-652.914) (-657.849) * [-654.670] (-653.477) (-654.919) (-673.622) -- 0:01:03
59500 -- (-662.758) (-664.579) (-653.594) [-655.275] * [-654.380] (-652.836) (-653.863) (-660.496) -- 0:01:03
60000 -- (-662.462) (-675.838) (-653.537) [-655.925] * (-653.676) [-652.870] (-653.933) (-666.089) -- 0:01:02
Average standard deviation of split frequencies: 0.042124
60500 -- (-662.149) (-659.133) [-653.625] (-660.045) * [-652.948] (-653.298) (-656.328) (-668.775) -- 0:01:02
61000 -- (-660.244) (-658.718) [-653.615] (-653.395) * (-654.393) (-655.186) [-656.792] (-663.075) -- 0:01:01
61500 -- (-653.363) (-655.936) [-655.357] (-657.694) * [-655.087] (-653.601) (-656.753) (-669.442) -- 0:01:01
62000 -- (-657.076) [-655.933] (-654.370) (-659.888) * (-653.398) [-652.708] (-654.908) (-666.001) -- 0:01:00
62500 -- (-660.367) [-653.107] (-655.964) (-657.135) * (-657.699) (-654.535) [-659.812] (-660.931) -- 0:01:00
63000 -- (-656.003) [-653.308] (-653.014) (-656.567) * (-653.989) (-654.432) (-653.684) [-653.714] -- 0:01:14
63500 -- (-654.034) (-655.797) (-656.802) [-655.369] * (-655.017) [-653.047] (-654.372) (-655.290) -- 0:01:13
64000 -- (-653.638) (-654.369) [-653.920] (-655.150) * (-657.923) (-652.903) (-653.700) [-658.219] -- 0:01:13
64500 -- (-654.405) (-654.717) (-656.543) [-653.913] * [-658.913] (-653.335) (-660.810) (-661.557) -- 0:01:12
65000 -- [-653.955] (-655.447) (-654.365) (-654.073) * (-655.081) (-655.084) [-654.200] (-661.053) -- 0:01:11
Average standard deviation of split frequencies: 0.035063
65500 -- (-656.528) (-657.354) [-655.525] (-660.931) * (-656.734) (-653.869) (-655.591) [-656.533] -- 0:01:11
66000 -- (-655.931) (-656.382) (-653.748) [-654.668] * [-653.382] (-654.264) (-653.939) (-655.114) -- 0:01:10
66500 -- (-658.389) (-654.345) (-653.853) [-655.433] * (-656.529) (-657.083) (-655.977) [-653.300] -- 0:01:10
67000 -- [-653.481] (-653.843) (-653.849) (-655.875) * (-661.221) (-653.304) [-654.452] (-654.432) -- 0:01:09
67500 -- (-659.385) (-659.561) (-652.984) [-657.500] * [-653.196] (-654.964) (-655.196) (-654.699) -- 0:01:09
68000 -- (-659.357) (-657.784) [-653.315] (-655.045) * (-655.061) (-654.457) [-657.501] (-655.359) -- 0:01:08
68500 -- (-656.132) (-654.093) (-658.965) [-655.995] * [-653.725] (-653.763) (-657.681) (-656.046) -- 0:01:07
69000 -- (-654.152) (-659.088) (-657.621) [-656.562] * (-653.620) (-653.961) (-656.179) [-656.891] -- 0:01:07
69500 -- [-656.234] (-657.905) (-653.627) (-653.479) * (-655.579) [-656.241] (-657.845) (-658.515) -- 0:01:06
70000 -- (-654.951) (-656.012) [-654.100] (-654.948) * (-654.739) (-653.758) (-657.143) [-658.416] -- 0:01:06
Average standard deviation of split frequencies: 0.034625
70500 -- (-657.042) [-658.425] (-657.486) (-655.013) * (-655.279) [-653.941] (-654.572) (-652.823) -- 0:01:05
71000 -- [-654.750] (-654.203) (-654.359) (-658.453) * (-654.687) (-655.887) [-657.687] (-655.324) -- 0:01:05
71500 -- (-654.423) (-654.023) (-653.560) [-662.727] * (-660.239) (-654.038) [-654.506] (-653.988) -- 0:01:04
72000 -- (-653.847) (-654.524) [-656.013] (-656.525) * (-658.753) (-653.144) (-654.967) [-654.593] -- 0:01:04
72500 -- (-653.189) (-653.076) [-654.348] (-653.971) * (-662.172) (-653.165) (-653.938) [-653.373] -- 0:01:03
73000 -- (-655.333) (-654.318) [-654.015] (-656.031) * [-655.189] (-652.935) (-653.157) (-656.906) -- 0:01:03
73500 -- (-656.508) [-653.101] (-655.127) (-655.937) * (-653.728) (-656.844) (-653.702) [-655.432] -- 0:01:03
74000 -- (-654.613) [-653.295] (-661.043) (-655.159) * (-653.607) [-654.074] (-655.985) (-656.908) -- 0:01:02
74500 -- [-656.069] (-654.648) (-657.410) (-653.827) * (-654.237) (-655.578) [-656.793] (-654.622) -- 0:01:02
75000 -- (-656.198) (-654.168) [-653.072] (-654.708) * (-654.257) (-655.377) [-654.459] (-655.073) -- 0:01:01
Average standard deviation of split frequencies: 0.033376
75500 -- (-660.431) (-653.581) [-654.965] (-658.500) * (-654.426) (-656.659) [-653.297] (-655.340) -- 0:01:01
76000 -- (-654.079) (-654.471) (-655.529) [-656.913] * (-659.469) (-655.562) [-652.937] (-655.416) -- 0:01:00
76500 -- (-655.995) [-656.459] (-655.537) (-659.482) * (-654.378) (-656.079) [-653.361] (-655.821) -- 0:01:00
77000 -- (-655.566) [-653.354] (-657.750) (-657.325) * [-654.509] (-659.440) (-653.954) (-655.147) -- 0:00:59
77500 -- (-652.691) (-653.502) [-655.563] (-654.871) * (-658.829) (-655.649) [-654.748] (-654.189) -- 0:01:11
78000 -- (-654.368) (-654.672) [-658.964] (-654.926) * [-654.624] (-658.636) (-653.076) (-655.369) -- 0:01:10
78500 -- (-655.661) [-655.273] (-656.449) (-657.743) * (-653.135) (-659.570) (-653.942) [-655.208] -- 0:01:10
79000 -- [-654.722] (-655.100) (-656.212) (-652.648) * (-655.584) (-654.189) (-654.588) [-654.655] -- 0:01:09
79500 -- [-654.917] (-655.895) (-661.128) (-654.202) * (-653.943) (-653.346) [-656.435] (-656.695) -- 0:01:09
80000 -- (-655.600) (-656.914) (-658.895) [-654.824] * (-657.200) (-655.299) (-653.867) [-653.901] -- 0:01:09
Average standard deviation of split frequencies: 0.029804
80500 -- (-653.244) (-654.756) [-657.541] (-656.247) * (-653.683) (-655.151) [-660.482] (-657.357) -- 0:01:08
81000 -- (-652.825) (-659.050) (-657.328) [-655.124] * [-654.626] (-654.786) (-655.336) (-658.860) -- 0:01:08
81500 -- (-654.249) (-654.786) (-656.493) [-655.112] * [-655.541] (-656.067) (-654.616) (-656.969) -- 0:01:07
82000 -- [-653.860] (-656.007) (-653.050) (-653.893) * (-665.671) (-660.333) (-655.022) [-653.635] -- 0:01:07
82500 -- (-654.375) (-654.462) [-654.436] (-654.031) * (-657.616) (-656.501) [-654.453] (-653.673) -- 0:01:06
83000 -- [-654.495] (-662.845) (-653.089) (-656.011) * (-654.163) (-654.022) (-657.587) [-652.976] -- 0:01:06
83500 -- (-655.823) [-654.333] (-655.309) (-653.737) * (-654.238) (-654.732) [-655.395] (-653.979) -- 0:01:05
84000 -- (-654.901) (-654.240) (-654.455) [-654.638] * (-653.780) (-655.836) [-655.677] (-655.598) -- 0:01:05
84500 -- (-655.663) (-655.073) (-654.728) [-653.289] * [-654.283] (-653.936) (-653.889) (-656.321) -- 0:01:05
85000 -- (-654.998) (-655.823) (-655.678) [-654.883] * (-653.468) [-654.796] (-654.852) (-654.393) -- 0:01:04
Average standard deviation of split frequencies: 0.029874
85500 -- (-653.811) (-658.315) (-655.108) [-654.660] * [-655.053] (-655.020) (-653.086) (-654.601) -- 0:01:04
86000 -- (-655.203) [-655.877] (-654.765) (-653.535) * [-655.223] (-654.148) (-654.097) (-655.496) -- 0:01:03
86500 -- (-652.974) [-656.763] (-657.079) (-653.159) * [-654.139] (-653.055) (-654.012) (-654.770) -- 0:01:03
87000 -- (-660.001) [-656.674] (-655.531) (-654.062) * (-655.298) [-653.415] (-656.071) (-654.906) -- 0:01:02
87500 -- (-655.625) [-657.303] (-655.002) (-657.868) * (-654.089) [-654.013] (-653.350) (-656.677) -- 0:01:02
88000 -- (-656.468) (-658.514) (-657.696) [-654.661] * (-652.864) [-656.475] (-653.995) (-655.414) -- 0:01:02
88500 -- (-653.268) [-653.092] (-655.205) (-657.102) * [-654.049] (-658.640) (-657.189) (-653.123) -- 0:01:01
89000 -- (-653.511) (-655.211) [-654.391] (-660.169) * (-655.970) (-657.993) (-656.133) [-653.701] -- 0:01:01
89500 -- [-653.834] (-654.000) (-654.575) (-659.143) * (-655.040) [-654.987] (-654.033) (-655.466) -- 0:01:01
90000 -- (-654.458) (-654.021) [-654.883] (-656.003) * (-654.964) [-659.669] (-658.464) (-656.423) -- 0:01:00
Average standard deviation of split frequencies: 0.028186
90500 -- (-654.878) (-654.410) (-653.670) [-656.894] * (-655.728) (-654.831) [-654.506] (-654.008) -- 0:01:00
91000 -- (-653.433) [-657.235] (-655.840) (-657.704) * (-653.404) [-654.768] (-655.999) (-652.802) -- 0:00:59
91500 -- (-653.134) (-657.341) (-655.158) [-655.473] * (-652.962) (-653.605) [-655.248] (-653.924) -- 0:01:09
92000 -- [-653.759] (-653.965) (-653.751) (-655.273) * [-655.241] (-658.378) (-654.874) (-653.739) -- 0:01:09
92500 -- (-654.063) (-654.331) [-653.845] (-655.733) * (-657.154) (-654.016) (-656.050) [-654.376] -- 0:01:08
93000 -- [-653.554] (-654.827) (-655.609) (-655.335) * (-654.597) [-653.200] (-655.903) (-656.220) -- 0:01:08
93500 -- [-656.081] (-655.822) (-655.355) (-655.233) * (-655.530) [-654.431] (-653.068) (-654.586) -- 0:01:07
94000 -- (-654.362) [-659.504] (-654.453) (-653.917) * (-654.011) [-654.006] (-654.839) (-654.187) -- 0:01:07
94500 -- [-655.365] (-653.707) (-655.531) (-658.049) * (-654.480) (-654.094) [-653.365] (-654.679) -- 0:01:07
95000 -- [-656.291] (-655.570) (-654.561) (-656.854) * (-653.438) [-653.989] (-656.087) (-655.484) -- 0:01:06
Average standard deviation of split frequencies: 0.022743
95500 -- (-653.792) [-657.575] (-655.566) (-654.116) * (-654.707) [-653.922] (-656.187) (-653.067) -- 0:01:06
96000 -- (-654.016) (-658.992) (-654.191) [-657.695] * [-653.661] (-653.515) (-652.819) (-653.010) -- 0:01:05
96500 -- [-655.721] (-663.129) (-653.185) (-655.906) * [-655.531] (-653.704) (-652.698) (-654.006) -- 0:01:05
97000 -- (-653.416) (-660.308) [-652.885] (-659.710) * (-653.478) (-655.813) [-653.158] (-654.463) -- 0:01:05
97500 -- (-653.427) [-658.834] (-654.837) (-659.538) * (-653.972) (-653.315) [-654.203] (-652.920) -- 0:01:04
98000 -- (-656.007) (-656.705) [-653.660] (-658.275) * (-654.303) [-654.200] (-653.221) (-653.615) -- 0:01:04
98500 -- (-655.126) [-654.032] (-654.119) (-655.482) * (-655.077) [-653.334] (-652.877) (-655.061) -- 0:01:04
99000 -- (-654.133) (-653.521) (-653.575) [-653.335] * (-653.960) (-657.680) (-657.912) [-655.798] -- 0:01:03
99500 -- [-654.123] (-655.586) (-653.876) (-654.357) * [-655.260] (-657.574) (-657.064) (-655.441) -- 0:01:03
100000 -- (-655.012) (-658.928) (-653.445) [-653.515] * [-653.422] (-656.058) (-653.849) (-656.702) -- 0:01:02
Average standard deviation of split frequencies: 0.024715
100500 -- [-652.934] (-654.004) (-655.560) (-653.647) * (-653.531) [-655.966] (-653.604) (-655.827) -- 0:01:02
101000 -- (-654.085) [-653.603] (-653.935) (-654.436) * (-654.262) (-654.391) (-655.841) [-655.602] -- 0:01:02
101500 -- [-654.959] (-654.129) (-653.881) (-656.559) * [-659.171] (-653.524) (-656.782) (-653.579) -- 0:01:01
102000 -- (-654.557) [-653.225] (-657.189) (-654.765) * (-658.932) (-653.457) (-655.097) [-653.127] -- 0:01:01
102500 -- (-656.935) (-653.604) [-653.057] (-655.449) * (-657.523) (-658.926) (-656.060) [-654.864] -- 0:01:01
103000 -- (-657.303) [-658.916] (-654.966) (-654.551) * (-656.503) (-653.628) (-658.223) [-653.455] -- 0:01:00
103500 -- (-655.023) [-655.308] (-655.546) (-663.127) * [-654.079] (-656.556) (-656.296) (-653.737) -- 0:01:00
104000 -- (-653.695) [-653.702] (-653.998) (-655.295) * (-653.543) (-654.964) (-654.795) [-654.523] -- 0:01:00
104500 -- [-654.408] (-656.727) (-654.966) (-656.762) * (-655.346) [-653.632] (-653.762) (-655.604) -- 0:00:59
105000 -- (-656.965) (-653.941) (-654.458) [-656.118] * (-654.319) (-657.408) (-654.398) [-656.512] -- 0:00:59
Average standard deviation of split frequencies: 0.025045
105500 -- (-654.254) (-654.381) (-657.498) [-655.306] * (-654.855) (-655.709) [-654.163] (-658.799) -- 0:01:07
106000 -- [-654.165] (-654.978) (-656.373) (-656.028) * (-654.036) (-658.614) (-653.470) [-658.294] -- 0:01:07
106500 -- (-659.313) (-654.896) (-655.289) [-653.012] * (-661.069) (-654.745) (-653.254) [-654.537] -- 0:01:07
107000 -- (-656.250) (-654.978) (-657.296) [-653.573] * [-655.356] (-659.556) (-654.285) (-655.758) -- 0:01:06
107500 -- (-653.872) [-653.353] (-656.605) (-653.689) * (-659.013) (-657.182) [-656.709] (-659.275) -- 0:01:06
108000 -- [-653.714] (-654.823) (-665.844) (-653.459) * (-657.236) (-654.883) [-655.601] (-660.224) -- 0:01:06
108500 -- [-653.948] (-652.861) (-659.442) (-652.741) * (-655.048) [-652.842] (-661.779) (-653.683) -- 0:01:05
109000 -- (-654.186) (-657.128) [-654.857] (-655.220) * (-653.775) (-652.785) [-653.281] (-655.620) -- 0:01:05
109500 -- (-654.824) [-656.187] (-653.887) (-654.740) * [-653.491] (-654.861) (-653.014) (-657.633) -- 0:01:05
110000 -- (-655.056) [-655.710] (-656.447) (-653.567) * (-655.768) [-654.669] (-656.518) (-655.154) -- 0:01:04
Average standard deviation of split frequencies: 0.019808
110500 -- [-655.833] (-654.903) (-654.896) (-659.620) * [-660.066] (-654.662) (-653.437) (-656.615) -- 0:01:04
111000 -- (-653.997) (-655.224) (-656.625) [-654.113] * (-660.753) (-653.786) (-653.632) [-657.175] -- 0:01:04
111500 -- (-655.398) (-658.205) (-655.700) [-654.773] * (-665.737) (-656.427) [-654.036] (-659.735) -- 0:01:03
112000 -- (-655.308) (-656.484) (-652.968) [-654.345] * (-656.225) [-655.681] (-652.873) (-655.048) -- 0:01:03
112500 -- [-653.904] (-654.024) (-656.388) (-657.708) * (-654.091) (-655.245) [-655.439] (-655.754) -- 0:01:03
113000 -- (-657.383) (-657.126) [-653.551] (-655.033) * (-656.931) (-654.774) [-654.191] (-653.917) -- 0:01:02
113500 -- (-655.789) (-659.273) [-652.540] (-655.711) * (-654.844) (-657.806) (-654.123) [-653.678] -- 0:01:02
114000 -- [-653.441] (-655.722) (-655.077) (-656.220) * [-655.836] (-656.552) (-653.987) (-655.555) -- 0:01:02
114500 -- (-654.905) (-657.576) [-654.587] (-658.244) * (-660.628) (-654.479) (-656.839) [-656.276] -- 0:01:01
115000 -- [-654.136] (-654.220) (-654.397) (-653.868) * (-659.766) (-653.421) [-653.936] (-655.690) -- 0:01:01
Average standard deviation of split frequencies: 0.019710
115500 -- (-654.576) [-652.708] (-652.675) (-656.045) * [-660.943] (-655.241) (-654.551) (-661.848) -- 0:01:01
116000 -- (-655.268) [-654.321] (-657.671) (-652.720) * (-653.663) (-655.055) [-653.460] (-659.874) -- 0:01:00
116500 -- (-655.607) (-654.252) (-657.451) [-654.852] * [-657.225] (-653.343) (-657.740) (-658.673) -- 0:01:00
117000 -- [-656.743] (-653.484) (-653.560) (-656.039) * [-653.895] (-654.829) (-654.170) (-657.379) -- 0:01:00
117500 -- (-653.823) [-656.060] (-659.489) (-657.618) * [-653.918] (-656.096) (-656.801) (-656.451) -- 0:01:00
118000 -- (-654.237) (-654.305) [-659.519] (-656.243) * (-654.214) (-653.208) [-653.131] (-653.687) -- 0:00:59
118500 -- (-656.565) (-652.942) [-656.864] (-657.028) * [-655.701] (-657.571) (-656.718) (-657.259) -- 0:00:59
119000 -- (-655.981) (-655.523) [-656.058] (-654.851) * (-656.596) (-654.861) [-657.806] (-654.105) -- 0:00:59
119500 -- (-654.052) (-654.589) [-653.910] (-658.358) * [-657.126] (-655.958) (-657.096) (-653.946) -- 0:00:58
120000 -- (-655.024) (-654.681) (-656.094) [-654.212] * (-656.637) [-654.453] (-654.619) (-656.686) -- 0:00:58
Average standard deviation of split frequencies: 0.018916
120500 -- (-655.114) [-657.883] (-655.238) (-654.161) * (-654.458) (-655.238) (-653.345) [-653.951] -- 0:01:05
121000 -- (-654.391) (-656.712) [-655.677] (-655.144) * (-654.016) [-653.389] (-653.372) (-656.541) -- 0:01:05
121500 -- (-655.967) [-656.266] (-653.158) (-653.528) * (-653.862) (-656.782) (-653.164) [-653.360] -- 0:01:05
122000 -- [-656.122] (-657.167) (-656.050) (-653.489) * [-655.715] (-656.669) (-654.555) (-660.503) -- 0:01:04
122500 -- (-656.029) (-655.479) [-654.457] (-653.665) * (-654.424) (-656.271) [-655.692] (-654.339) -- 0:01:04
123000 -- (-656.597) (-656.824) [-655.731] (-654.711) * (-657.813) (-657.011) [-653.227] (-654.690) -- 0:01:04
123500 -- [-654.899] (-656.957) (-657.843) (-656.902) * (-654.466) (-653.311) (-657.528) [-655.064] -- 0:01:03
124000 -- (-656.555) (-657.760) [-656.636] (-656.833) * (-656.471) (-653.763) (-658.471) [-656.760] -- 0:01:03
124500 -- [-655.021] (-655.640) (-656.864) (-653.738) * (-656.466) (-654.976) [-658.446] (-654.991) -- 0:01:03
125000 -- (-656.336) (-654.406) [-653.693] (-654.488) * (-656.364) (-654.961) [-655.666] (-654.142) -- 0:01:03
Average standard deviation of split frequencies: 0.019455
125500 -- (-659.025) (-655.187) [-655.510] (-656.198) * [-659.310] (-655.077) (-653.428) (-653.614) -- 0:01:02
126000 -- (-654.827) (-657.205) [-654.333] (-657.618) * (-662.372) (-652.840) (-653.997) [-655.334] -- 0:01:02
126500 -- (-655.125) [-653.609] (-657.568) (-656.782) * [-654.600] (-653.203) (-657.102) (-654.297) -- 0:01:02
127000 -- (-654.428) (-655.236) (-658.567) [-654.806] * (-653.090) (-653.745) (-655.543) [-654.970] -- 0:01:01
127500 -- (-653.810) (-653.237) [-654.262] (-654.915) * (-655.977) [-654.868] (-655.516) (-656.159) -- 0:01:01
128000 -- (-653.796) [-655.488] (-653.692) (-654.090) * [-655.457] (-653.000) (-656.842) (-653.941) -- 0:01:01
128500 -- (-656.796) (-654.162) (-657.012) [-655.960] * (-656.725) (-654.465) (-653.877) [-653.421] -- 0:01:01
129000 -- [-654.679] (-654.753) (-655.197) (-654.023) * (-653.095) [-652.686] (-654.716) (-653.815) -- 0:01:00
129500 -- (-658.441) (-653.561) (-656.286) [-653.190] * [-653.780] (-653.836) (-653.586) (-654.141) -- 0:01:00
130000 -- [-658.962] (-661.706) (-657.017) (-652.894) * (-656.178) [-652.922] (-653.752) (-653.328) -- 0:01:00
Average standard deviation of split frequencies: 0.021266
130500 -- (-657.105) [-656.877] (-654.924) (-654.098) * (-656.400) (-653.992) [-655.192] (-653.785) -- 0:00:59
131000 -- (-660.463) (-653.723) [-653.519] (-653.583) * (-654.420) (-653.500) (-654.364) [-654.952] -- 0:00:59
131500 -- (-654.828) (-654.520) (-652.825) [-655.201] * [-654.644] (-653.347) (-655.944) (-656.391) -- 0:00:59
132000 -- [-657.737] (-654.992) (-653.478) (-654.891) * (-655.159) (-655.747) (-656.214) [-653.505] -- 0:00:59
132500 -- (-654.838) (-656.461) [-654.983] (-655.520) * [-659.948] (-653.453) (-657.238) (-653.564) -- 0:00:58
133000 -- (-660.142) [-659.194] (-654.920) (-656.078) * (-655.199) [-653.440] (-657.524) (-654.574) -- 0:00:58
133500 -- (-654.073) (-654.267) [-656.494] (-657.195) * [-657.521] (-654.633) (-657.120) (-656.970) -- 0:00:58
134000 -- [-653.169] (-655.181) (-654.890) (-653.146) * [-654.408] (-655.873) (-656.259) (-656.830) -- 0:00:58
134500 -- [-655.659] (-654.544) (-655.771) (-653.246) * [-655.795] (-654.197) (-655.357) (-659.436) -- 0:00:57
135000 -- (-653.367) (-655.265) (-655.954) [-655.966] * [-656.236] (-654.091) (-654.431) (-656.631) -- 0:00:57
Average standard deviation of split frequencies: 0.020605
135500 -- (-654.803) (-655.248) (-656.310) [-653.637] * (-657.754) (-654.313) [-653.902] (-655.231) -- 0:00:57
136000 -- (-653.936) (-655.268) (-655.196) [-655.743] * (-657.160) [-653.759] (-654.433) (-654.372) -- 0:00:57
136500 -- (-655.027) (-654.872) (-656.192) [-654.319] * (-655.640) (-655.702) [-655.766] (-655.164) -- 0:01:03
137000 -- (-655.020) (-654.068) (-656.202) [-654.629] * [-661.547] (-658.009) (-655.103) (-657.930) -- 0:01:02
137500 -- [-655.548] (-655.552) (-654.932) (-653.022) * (-654.033) (-659.055) (-653.646) [-656.920] -- 0:01:02
138000 -- (-652.857) [-653.621] (-656.719) (-654.412) * [-653.598] (-656.449) (-653.149) (-655.011) -- 0:01:02
138500 -- (-655.614) [-654.500] (-662.189) (-653.523) * [-656.605] (-655.103) (-652.898) (-654.133) -- 0:01:02
139000 -- (-653.202) [-652.712] (-654.268) (-654.434) * (-660.552) (-654.245) [-656.379] (-654.936) -- 0:01:01
139500 -- (-656.600) [-655.650] (-654.210) (-654.214) * (-657.375) (-654.997) [-654.896] (-653.979) -- 0:01:01
140000 -- (-654.728) [-654.272] (-653.329) (-655.872) * (-655.286) (-655.432) [-652.918] (-655.245) -- 0:01:01
Average standard deviation of split frequencies: 0.020502
140500 -- (-654.845) (-656.963) [-653.908] (-656.260) * (-656.795) (-654.963) [-655.230] (-656.849) -- 0:01:01
141000 -- [-654.875] (-653.638) (-655.454) (-657.666) * (-652.907) (-658.299) [-654.273] (-659.752) -- 0:01:00
141500 -- (-657.623) (-653.984) [-654.005] (-653.986) * (-652.864) (-659.465) (-653.100) [-655.509] -- 0:01:00
142000 -- (-655.459) (-654.238) [-652.993] (-654.755) * (-653.074) (-659.399) [-652.890] (-655.387) -- 0:01:00
142500 -- (-658.135) (-654.808) [-654.503] (-658.398) * (-655.542) (-653.655) (-653.451) [-656.154] -- 0:01:00
143000 -- (-654.940) (-653.857) [-653.223] (-654.352) * (-654.306) [-653.323] (-657.141) (-659.356) -- 0:00:59
143500 -- (-654.080) (-655.797) [-653.320] (-653.682) * (-653.978) [-655.284] (-655.122) (-654.501) -- 0:00:59
144000 -- (-656.367) [-654.190] (-653.398) (-656.954) * (-655.255) (-654.035) [-656.942] (-654.024) -- 0:00:59
144500 -- (-654.114) [-654.971] (-654.109) (-654.400) * (-655.678) (-654.410) [-656.697] (-655.419) -- 0:00:59
145000 -- [-656.734] (-655.023) (-655.336) (-653.484) * (-654.441) (-654.423) (-654.441) [-654.597] -- 0:00:58
Average standard deviation of split frequencies: 0.020503
145500 -- (-653.541) [-653.757] (-653.678) (-656.659) * (-656.258) (-654.321) [-653.554] (-658.330) -- 0:00:58
146000 -- (-653.969) [-654.358] (-653.432) (-653.870) * [-653.581] (-658.299) (-654.959) (-657.198) -- 0:00:58
146500 -- (-654.055) (-654.370) (-659.221) [-654.944] * (-655.764) (-654.457) [-657.541] (-657.946) -- 0:00:58
147000 -- (-653.144) (-654.257) [-654.402] (-656.037) * (-657.091) (-655.668) [-655.875] (-655.783) -- 0:00:58
147500 -- (-654.322) (-653.812) [-654.689] (-653.527) * (-654.449) (-659.190) (-655.782) [-653.309] -- 0:00:57
148000 -- (-654.885) (-659.285) [-653.323] (-655.404) * [-654.631] (-662.349) (-654.744) (-656.970) -- 0:00:57
148500 -- [-654.501] (-657.634) (-654.138) (-654.237) * [-652.817] (-661.812) (-653.214) (-655.555) -- 0:00:57
149000 -- (-654.134) (-656.929) [-653.580] (-654.460) * [-653.923] (-655.625) (-655.501) (-654.852) -- 0:00:57
149500 -- [-654.978] (-652.890) (-655.573) (-654.461) * (-655.882) [-657.194] (-654.228) (-656.617) -- 0:00:56
150000 -- (-656.462) [-653.769] (-654.079) (-657.322) * [-654.705] (-655.953) (-654.422) (-660.022) -- 0:00:56
Average standard deviation of split frequencies: 0.020981
150500 -- [-653.208] (-657.144) (-658.280) (-655.507) * (-653.622) (-654.689) (-653.726) [-656.951] -- 0:00:56
151000 -- (-652.959) (-658.676) (-659.653) [-655.988] * (-652.889) (-657.372) (-654.005) [-654.500] -- 0:00:56
151500 -- (-653.045) [-654.659] (-654.949) (-654.027) * (-657.823) (-661.655) (-653.597) [-653.114] -- 0:00:56
152000 -- (-656.490) (-659.329) [-654.854] (-660.028) * (-658.199) (-654.036) (-654.691) [-653.811] -- 0:01:01
152500 -- (-656.663) (-658.564) (-654.533) [-658.574] * [-657.774] (-653.070) (-653.818) (-654.210) -- 0:01:01
153000 -- (-654.849) (-655.095) [-654.289] (-653.765) * (-660.697) [-655.653] (-655.004) (-654.631) -- 0:01:00
153500 -- [-654.687] (-657.221) (-655.232) (-654.028) * (-661.427) [-657.016] (-656.118) (-665.108) -- 0:01:00
154000 -- (-658.282) (-654.249) (-652.911) [-653.547] * (-658.387) [-653.901] (-655.175) (-657.797) -- 0:01:00
154500 -- [-655.349] (-659.562) (-658.293) (-654.145) * (-658.988) (-655.477) (-654.838) [-663.574] -- 0:01:00
155000 -- (-655.237) (-659.448) (-654.186) [-654.050] * [-656.694] (-654.880) (-656.645) (-664.351) -- 0:00:59
Average standard deviation of split frequencies: 0.019978
155500 -- [-657.645] (-659.370) (-654.196) (-654.465) * (-656.139) (-654.284) (-655.431) [-654.952] -- 0:00:59
156000 -- [-655.715] (-656.317) (-654.069) (-654.761) * [-655.459] (-654.762) (-659.925) (-657.725) -- 0:00:59
156500 -- (-657.410) (-654.327) [-654.424] (-653.653) * (-653.363) (-655.134) (-658.649) [-656.563] -- 0:00:59
157000 -- (-655.004) (-655.194) (-658.317) [-653.973] * (-653.135) (-654.287) [-654.816] (-653.441) -- 0:00:59
157500 -- (-655.974) (-654.031) [-655.666] (-655.794) * [-652.898] (-653.862) (-654.501) (-658.595) -- 0:00:58
158000 -- (-658.783) (-654.408) (-654.539) [-656.152] * (-653.896) (-653.198) (-653.992) [-656.317] -- 0:00:58
158500 -- [-656.567] (-654.654) (-656.356) (-654.854) * (-653.985) (-655.802) (-655.112) [-653.719] -- 0:00:58
159000 -- (-654.717) (-656.044) [-655.188] (-654.656) * [-655.900] (-656.681) (-654.430) (-652.903) -- 0:00:58
159500 -- (-655.676) [-654.217] (-655.845) (-657.066) * (-656.269) [-653.974] (-655.060) (-655.342) -- 0:00:57
160000 -- (-658.573) (-657.007) [-653.851] (-653.007) * (-656.384) [-654.381] (-654.793) (-659.148) -- 0:00:57
Average standard deviation of split frequencies: 0.020538
160500 -- [-657.885] (-654.127) (-654.055) (-655.468) * (-655.697) [-655.235] (-652.891) (-657.272) -- 0:00:57
161000 -- [-659.112] (-656.621) (-653.749) (-658.402) * (-653.830) (-653.927) [-653.704] (-653.369) -- 0:00:57
161500 -- (-657.447) (-657.262) (-654.504) [-654.446] * [-654.981] (-653.655) (-654.106) (-654.179) -- 0:00:57
162000 -- (-656.172) [-655.040] (-657.504) (-654.927) * (-654.386) [-654.277] (-655.677) (-653.910) -- 0:00:56
162500 -- [-657.455] (-655.593) (-654.902) (-653.435) * (-655.185) [-652.755] (-657.444) (-653.300) -- 0:00:56
163000 -- (-657.441) (-654.995) (-654.811) [-654.940] * (-654.279) [-652.786] (-657.453) (-652.923) -- 0:00:56
163500 -- (-653.620) (-655.132) [-653.914] (-654.226) * (-659.536) (-657.303) [-654.880] (-655.496) -- 0:00:56
164000 -- (-654.836) [-655.890] (-653.490) (-654.855) * (-654.029) (-657.535) (-653.604) [-655.176] -- 0:00:56
164500 -- [-654.908] (-656.540) (-654.944) (-657.591) * (-654.721) (-656.455) [-656.251] (-656.005) -- 0:00:55
165000 -- (-658.033) (-655.868) [-653.625] (-655.094) * (-656.585) (-656.636) (-656.891) [-656.109] -- 0:00:55
Average standard deviation of split frequencies: 0.016755
165500 -- (-656.054) (-655.672) (-654.287) [-654.799] * (-656.018) (-661.219) (-656.093) [-654.649] -- 0:00:55
166000 -- (-655.688) (-654.391) (-655.232) [-654.902] * (-656.301) (-654.676) [-658.290] (-654.890) -- 0:00:55
166500 -- (-657.704) (-654.158) [-654.946] (-659.633) * (-653.351) (-653.917) [-655.765] (-654.991) -- 0:00:55
167000 -- (-653.160) [-656.588] (-657.875) (-654.788) * (-654.553) (-654.455) (-655.906) [-654.027] -- 0:00:59
167500 -- (-653.567) (-656.166) (-653.712) [-657.330] * [-655.017] (-654.316) (-652.984) (-657.909) -- 0:00:59
168000 -- (-653.054) (-653.441) [-653.960] (-656.208) * (-654.938) [-656.300] (-655.994) (-655.681) -- 0:00:59
168500 -- (-654.137) [-653.887] (-654.026) (-654.660) * (-657.400) [-655.848] (-654.562) (-653.131) -- 0:00:59
169000 -- (-652.995) [-654.482] (-656.541) (-655.998) * (-656.374) (-656.952) (-653.090) [-652.973] -- 0:00:59
169500 -- (-661.196) [-655.234] (-653.424) (-654.219) * (-654.001) (-655.141) (-654.591) [-653.906] -- 0:00:58
170000 -- (-654.290) (-656.264) [-653.275] (-655.550) * (-653.845) (-653.588) (-654.941) [-653.571] -- 0:00:58
Average standard deviation of split frequencies: 0.015410
170500 -- (-658.617) (-654.415) (-656.960) [-653.343] * (-653.431) (-654.783) (-654.464) [-655.527] -- 0:00:58
171000 -- (-658.434) (-657.258) (-654.413) [-653.289] * (-657.424) [-656.791] (-654.024) (-654.838) -- 0:00:58
171500 -- (-657.864) [-655.089] (-653.799) (-654.855) * [-656.946] (-656.113) (-654.039) (-654.607) -- 0:00:57
172000 -- (-655.060) [-654.002] (-658.967) (-656.498) * (-654.319) (-654.588) [-654.716] (-655.742) -- 0:00:57
172500 -- [-657.907] (-654.334) (-659.211) (-656.291) * (-653.950) [-654.121] (-656.089) (-653.478) -- 0:00:57
173000 -- (-657.772) [-653.908] (-655.463) (-655.087) * (-654.601) (-654.912) [-654.873] (-653.746) -- 0:00:57
173500 -- (-656.408) (-654.084) [-653.405] (-653.415) * (-655.236) (-655.074) (-655.875) [-654.489] -- 0:00:57
174000 -- (-655.135) (-655.274) [-654.680] (-654.820) * [-654.260] (-655.598) (-658.598) (-653.030) -- 0:00:56
174500 -- (-654.497) (-655.387) (-655.820) [-656.217] * [-658.068] (-655.734) (-656.775) (-658.326) -- 0:00:56
175000 -- (-655.118) (-654.005) (-652.884) [-655.441] * (-658.489) (-655.319) (-653.629) [-653.682] -- 0:00:56
Average standard deviation of split frequencies: 0.017016
175500 -- (-653.725) (-653.396) [-653.224] (-654.466) * (-656.229) (-653.834) (-653.167) [-654.298] -- 0:00:56
176000 -- (-655.642) (-656.501) (-654.376) [-657.886] * (-653.915) (-655.414) (-653.156) [-655.996] -- 0:00:56
176500 -- (-653.846) (-653.152) (-654.414) [-657.492] * (-657.258) [-655.394] (-656.272) (-654.996) -- 0:00:55
177000 -- [-655.338] (-654.991) (-655.785) (-660.360) * (-654.711) [-654.899] (-657.230) (-657.984) -- 0:00:55
177500 -- [-654.364] (-656.248) (-659.295) (-655.362) * [-654.962] (-653.365) (-655.677) (-654.182) -- 0:00:55
178000 -- (-656.791) (-656.905) (-656.461) [-653.445] * (-655.365) (-653.524) [-654.945] (-657.148) -- 0:00:55
178500 -- [-655.068] (-655.054) (-654.595) (-653.996) * (-653.668) (-653.249) (-662.159) [-658.502] -- 0:00:55
179000 -- (-653.164) [-654.899] (-654.102) (-655.793) * [-653.362] (-655.957) (-656.414) (-653.480) -- 0:00:55
179500 -- [-655.589] (-654.363) (-654.164) (-653.828) * [-655.325] (-653.853) (-656.817) (-654.335) -- 0:00:54
180000 -- (-653.402) (-654.588) [-653.743] (-653.394) * [-661.132] (-658.376) (-653.660) (-654.773) -- 0:00:54
Average standard deviation of split frequencies: 0.018725
180500 -- (-653.723) (-654.506) (-654.156) [-653.501] * (-655.084) (-656.380) (-657.632) [-654.257] -- 0:00:54
181000 -- (-653.357) [-654.397] (-655.506) (-654.201) * (-654.519) (-654.655) [-657.279] (-654.844) -- 0:00:54
181500 -- (-655.812) (-653.599) [-653.506] (-654.465) * (-653.817) (-658.037) (-655.816) [-658.780] -- 0:00:54
182000 -- [-655.504] (-654.596) (-656.719) (-659.133) * (-654.836) [-654.692] (-654.066) (-660.465) -- 0:00:53
182500 -- (-655.721) [-655.214] (-658.304) (-653.733) * (-656.001) (-656.467) (-654.731) [-656.502] -- 0:00:53
183000 -- (-655.737) (-654.664) (-657.397) [-653.794] * (-653.230) [-653.018] (-653.863) (-658.340) -- 0:00:58
183500 -- (-655.322) [-654.142] (-655.079) (-656.267) * (-656.852) (-653.052) [-653.998] (-656.096) -- 0:00:57
184000 -- (-656.148) (-658.335) [-658.169] (-652.951) * (-654.769) [-653.894] (-655.563) (-654.321) -- 0:00:57
184500 -- (-656.579) (-655.080) (-655.911) [-657.189] * (-654.480) (-655.877) (-654.580) [-656.717] -- 0:00:57
185000 -- (-657.452) [-656.419] (-654.111) (-656.331) * (-658.223) (-657.869) (-654.773) [-655.045] -- 0:00:57
Average standard deviation of split frequencies: 0.018586
185500 -- (-658.201) [-657.537] (-657.629) (-655.016) * [-655.126] (-654.648) (-654.471) (-657.254) -- 0:00:57
186000 -- [-654.235] (-655.452) (-657.375) (-653.846) * [-659.222] (-654.298) (-655.451) (-655.358) -- 0:00:56
186500 -- (-655.820) [-654.655] (-654.878) (-655.002) * [-654.151] (-655.706) (-654.993) (-653.515) -- 0:00:56
187000 -- [-658.359] (-655.481) (-656.273) (-654.336) * [-654.408] (-655.698) (-654.464) (-653.084) -- 0:00:56
187500 -- (-659.264) (-657.183) [-654.403] (-657.761) * [-653.710] (-657.653) (-654.612) (-653.622) -- 0:00:56
188000 -- (-659.729) (-654.741) [-656.621] (-658.512) * [-656.853] (-655.251) (-655.619) (-654.884) -- 0:00:56
188500 -- [-654.161] (-653.575) (-653.082) (-657.164) * [-654.226] (-658.447) (-654.390) (-654.106) -- 0:00:55
189000 -- [-654.882] (-654.543) (-652.962) (-658.328) * (-655.430) (-656.760) (-656.946) [-655.345] -- 0:00:55
189500 -- (-660.578) (-653.769) (-658.147) [-655.169] * (-653.662) (-657.795) [-653.777] (-655.892) -- 0:00:55
190000 -- [-656.245] (-655.056) (-658.096) (-657.051) * (-654.047) [-655.776] (-653.116) (-653.478) -- 0:00:55
Average standard deviation of split frequencies: 0.017161
190500 -- [-656.878] (-656.853) (-654.576) (-657.237) * (-658.302) [-655.538] (-654.044) (-655.624) -- 0:00:55
191000 -- (-652.858) (-655.594) [-652.985] (-657.737) * (-656.067) (-655.383) [-654.446] (-655.339) -- 0:00:55
191500 -- [-653.738] (-654.357) (-654.818) (-654.167) * (-655.270) (-654.806) (-653.806) [-653.683] -- 0:00:54
192000 -- [-653.689] (-654.141) (-653.954) (-653.475) * [-652.897] (-656.949) (-653.922) (-653.651) -- 0:00:54
192500 -- (-658.967) (-652.849) [-654.439] (-654.695) * (-654.519) [-657.607] (-653.223) (-653.120) -- 0:00:54
193000 -- [-656.366] (-653.675) (-654.653) (-655.280) * (-655.353) (-656.089) (-654.671) [-655.284] -- 0:00:54
193500 -- [-657.957] (-654.140) (-653.602) (-654.925) * [-654.267] (-653.207) (-652.951) (-654.057) -- 0:00:54
194000 -- [-654.260] (-660.278) (-655.062) (-653.441) * (-654.717) (-654.161) (-654.325) [-653.797] -- 0:00:54
194500 -- (-655.338) (-658.839) [-652.547] (-655.491) * (-653.586) [-653.321] (-654.156) (-655.578) -- 0:00:53
195000 -- (-653.796) [-653.295] (-653.603) (-654.248) * [-654.934] (-655.448) (-654.376) (-656.017) -- 0:00:53
Average standard deviation of split frequencies: 0.016836
195500 -- (-653.796) (-656.531) [-654.158] (-654.114) * (-658.274) (-657.137) (-655.964) [-656.539] -- 0:00:53
196000 -- (-652.964) [-653.633] (-652.795) (-653.376) * (-655.934) (-655.318) [-654.944] (-655.165) -- 0:00:53
196500 -- (-659.045) (-658.507) [-655.517] (-654.125) * (-654.720) [-654.001] (-654.525) (-654.534) -- 0:00:53
197000 -- (-653.044) (-658.192) [-655.615] (-656.830) * [-654.546] (-654.119) (-661.201) (-654.699) -- 0:00:52
197500 -- (-659.818) (-655.247) (-654.785) [-657.229] * (-656.320) (-655.818) (-659.405) [-653.667] -- 0:00:52
198000 -- [-655.413] (-653.867) (-653.052) (-655.522) * (-659.631) (-653.655) [-653.928] (-654.608) -- 0:00:52
198500 -- (-657.983) [-653.641] (-655.194) (-653.421) * (-657.039) (-653.840) [-653.559] (-654.957) -- 0:00:52
199000 -- (-652.735) (-654.276) [-654.005] (-660.040) * (-656.277) (-654.063) (-654.498) [-653.882] -- 0:00:52
199500 -- (-653.421) (-657.047) [-652.644] (-655.192) * (-655.156) (-655.413) (-654.622) [-652.992] -- 0:00:52
200000 -- (-655.045) (-657.216) [-654.364] (-655.542) * (-655.972) (-655.445) (-656.287) [-655.444] -- 0:00:55
Average standard deviation of split frequencies: 0.017749
200500 -- [-655.220] (-658.000) (-656.859) (-655.216) * (-653.022) (-655.581) [-655.874] (-653.684) -- 0:00:55
201000 -- (-654.812) (-653.210) [-654.001] (-655.943) * [-653.512] (-655.143) (-653.931) (-652.838) -- 0:00:55
201500 -- (-653.848) [-654.683] (-655.533) (-656.204) * (-654.266) (-654.210) (-655.693) [-655.414] -- 0:00:55
202000 -- (-656.010) (-654.650) [-653.379] (-655.144) * (-654.798) (-655.564) [-654.996] (-655.665) -- 0:00:55
202500 -- [-657.354] (-655.401) (-655.586) (-653.752) * (-655.661) (-654.995) [-655.690] (-653.621) -- 0:00:55
203000 -- (-657.250) (-653.547) [-657.462] (-654.605) * (-655.820) (-653.950) [-653.520] (-653.839) -- 0:00:54
203500 -- (-654.928) (-655.105) [-653.351] (-654.302) * (-655.132) (-653.841) [-652.869] (-654.163) -- 0:00:54
204000 -- [-658.637] (-656.995) (-657.144) (-654.818) * (-657.292) (-654.606) (-655.895) [-656.883] -- 0:00:54
204500 -- [-654.673] (-662.037) (-655.194) (-658.803) * (-656.083) (-654.126) [-654.837] (-656.780) -- 0:00:54
205000 -- (-656.085) [-654.437] (-655.215) (-657.052) * (-655.947) [-655.182] (-658.229) (-654.919) -- 0:00:54
Average standard deviation of split frequencies: 0.018066
205500 -- [-654.557] (-655.042) (-655.368) (-656.452) * [-655.430] (-655.241) (-654.413) (-654.282) -- 0:00:54
206000 -- (-657.949) (-654.233) [-654.979] (-658.409) * (-656.901) (-658.703) [-653.960] (-654.144) -- 0:00:53
206500 -- [-656.278] (-658.460) (-653.535) (-658.007) * [-656.206] (-653.442) (-656.291) (-656.747) -- 0:00:53
207000 -- (-655.913) (-654.071) [-653.851] (-653.722) * (-652.932) [-653.860] (-655.528) (-653.362) -- 0:00:53
207500 -- (-653.468) (-654.233) [-655.005] (-657.403) * [-655.443] (-652.587) (-655.087) (-654.936) -- 0:00:53
208000 -- (-654.697) [-653.154] (-655.898) (-654.210) * [-653.797] (-652.885) (-654.289) (-655.447) -- 0:00:53
208500 -- (-655.023) (-654.652) (-655.078) [-654.951] * (-655.627) (-655.319) (-655.035) [-654.877] -- 0:00:53
209000 -- (-655.925) (-655.783) [-653.381] (-656.918) * (-654.841) (-654.666) [-653.596] (-654.358) -- 0:00:52
209500 -- (-658.754) [-653.474] (-655.761) (-654.994) * (-653.318) (-657.714) (-656.373) [-653.057] -- 0:00:52
210000 -- (-654.240) (-653.583) (-655.864) [-654.804] * [-653.016] (-658.200) (-655.678) (-652.877) -- 0:00:52
Average standard deviation of split frequencies: 0.016907
210500 -- (-653.956) (-657.072) [-654.131] (-654.944) * (-657.083) [-654.772] (-655.288) (-654.938) -- 0:00:52
211000 -- (-657.236) (-655.185) (-655.026) [-657.287] * (-655.755) (-654.049) (-654.649) [-653.469] -- 0:00:52
211500 -- (-654.924) [-653.427] (-657.110) (-661.024) * (-656.689) (-655.441) [-655.836] (-654.537) -- 0:00:52
212000 -- (-656.105) [-653.245] (-655.268) (-654.548) * (-654.973) [-653.551] (-658.501) (-657.834) -- 0:00:52
212500 -- (-655.356) (-653.693) (-660.357) [-653.928] * (-653.871) (-654.048) [-659.260] (-653.466) -- 0:00:51
213000 -- [-657.798] (-653.832) (-660.479) (-654.570) * [-654.244] (-658.086) (-653.362) (-653.390) -- 0:00:51
213500 -- (-653.233) (-654.939) (-658.038) [-656.874] * (-653.689) (-654.752) [-653.706] (-653.483) -- 0:00:51
214000 -- (-653.365) [-658.240] (-657.425) (-653.371) * (-654.309) (-656.022) [-653.939] (-653.459) -- 0:00:51
214500 -- (-654.970) [-656.909] (-654.153) (-652.956) * (-653.390) (-653.626) (-653.966) [-655.626] -- 0:00:51
215000 -- [-652.920] (-656.728) (-655.080) (-654.344) * [-653.602] (-654.599) (-654.122) (-653.380) -- 0:00:51
Average standard deviation of split frequencies: 0.017581
215500 -- (-654.364) [-654.901] (-654.543) (-658.559) * (-654.657) [-654.796] (-653.742) (-653.809) -- 0:00:50
216000 -- [-654.168] (-654.442) (-656.053) (-656.803) * (-654.064) (-654.224) (-654.971) [-653.161] -- 0:00:50
216500 -- (-654.468) (-653.325) (-657.145) [-654.023] * (-656.733) (-655.355) [-653.499] (-653.781) -- 0:00:50
217000 -- (-655.845) (-654.577) [-654.566] (-653.755) * (-655.700) (-655.799) [-653.881] (-653.496) -- 0:00:54
217500 -- (-655.853) (-655.417) [-656.228] (-652.896) * (-653.452) (-656.279) (-653.444) [-654.458] -- 0:00:53
218000 -- (-657.440) (-652.987) [-654.160] (-654.837) * (-655.996) [-653.395] (-655.031) (-653.823) -- 0:00:53
218500 -- (-664.590) (-658.926) [-661.208] (-656.373) * [-653.813] (-654.180) (-655.852) (-653.392) -- 0:00:53
219000 -- (-659.111) (-656.718) [-660.523] (-658.821) * (-653.280) (-653.660) (-654.468) [-652.679] -- 0:00:53
219500 -- (-658.220) (-658.450) [-654.287] (-656.602) * [-654.381] (-653.504) (-657.413) (-653.809) -- 0:00:53
220000 -- [-655.454] (-655.901) (-656.731) (-653.698) * (-655.694) (-654.078) [-655.458] (-657.392) -- 0:00:53
Average standard deviation of split frequencies: 0.016734
220500 -- (-655.019) [-655.095] (-654.048) (-655.667) * (-655.179) (-654.205) (-653.539) [-655.072] -- 0:00:53
221000 -- (-654.703) [-655.969] (-654.675) (-655.562) * (-656.207) [-653.661] (-654.683) (-653.876) -- 0:00:52
221500 -- (-654.640) [-654.372] (-654.471) (-660.391) * (-654.353) (-655.032) [-653.150] (-653.995) -- 0:00:52
222000 -- (-658.297) (-657.001) (-660.772) [-655.166] * (-654.710) (-658.495) (-660.663) [-655.046] -- 0:00:52
222500 -- (-656.888) (-653.539) [-654.670] (-654.418) * (-657.004) [-654.326] (-654.321) (-653.775) -- 0:00:52
223000 -- (-654.168) [-654.575] (-656.324) (-653.191) * (-654.130) [-653.762] (-657.081) (-655.886) -- 0:00:52
223500 -- [-655.269] (-653.270) (-659.874) (-656.851) * (-655.390) (-654.526) (-656.297) [-652.974] -- 0:00:52
224000 -- [-654.945] (-653.447) (-653.903) (-654.739) * (-656.404) (-655.386) [-659.987] (-654.522) -- 0:00:51
224500 -- [-653.975] (-655.270) (-655.838) (-658.873) * [-657.971] (-655.840) (-655.938) (-654.617) -- 0:00:51
225000 -- (-653.841) (-655.780) (-654.996) [-654.533] * [-653.579] (-655.192) (-653.571) (-654.537) -- 0:00:51
Average standard deviation of split frequencies: 0.015180
225500 -- (-655.817) (-656.716) [-654.409] (-658.456) * [-653.881] (-657.305) (-656.107) (-658.530) -- 0:00:51
226000 -- (-656.033) (-655.300) (-658.200) [-653.785] * (-654.729) [-654.987] (-655.317) (-656.403) -- 0:00:51
226500 -- (-656.300) (-655.083) [-655.273] (-654.332) * [-656.118] (-656.000) (-656.477) (-654.307) -- 0:00:51
227000 -- [-656.299] (-653.942) (-652.688) (-656.465) * [-653.986] (-655.604) (-659.461) (-654.061) -- 0:00:51
227500 -- (-655.711) (-655.396) [-656.831] (-654.409) * (-653.867) [-653.381] (-655.941) (-655.491) -- 0:00:50
228000 -- (-654.866) (-653.279) [-656.617] (-653.934) * (-653.885) (-653.561) (-661.352) [-654.889] -- 0:00:50
228500 -- [-654.026] (-653.885) (-653.935) (-655.340) * (-653.051) [-653.665] (-654.607) (-654.478) -- 0:00:50
229000 -- (-653.446) (-653.823) [-656.179] (-654.833) * (-653.886) [-653.424] (-655.189) (-652.961) -- 0:00:50
229500 -- [-656.436] (-653.274) (-652.896) (-658.006) * (-653.110) [-653.398] (-655.945) (-655.067) -- 0:00:50
230000 -- (-653.446) [-654.339] (-657.111) (-655.797) * (-654.461) [-653.416] (-656.602) (-656.259) -- 0:00:50
Average standard deviation of split frequencies: 0.016242
230500 -- (-657.076) (-653.642) (-655.726) [-654.786] * (-654.142) (-653.644) (-654.479) [-654.102] -- 0:00:50
231000 -- [-654.903] (-653.209) (-659.678) (-656.225) * (-654.177) (-653.369) (-655.115) [-653.653] -- 0:00:49
231500 -- [-653.493] (-654.127) (-652.940) (-658.903) * (-653.774) (-654.195) [-654.570] (-654.046) -- 0:00:49
232000 -- (-661.043) (-654.684) [-652.829] (-657.830) * (-658.108) [-653.830] (-654.155) (-654.473) -- 0:00:49
232500 -- (-653.886) (-660.798) (-653.796) [-656.454] * (-655.839) [-653.180] (-653.609) (-652.878) -- 0:00:49
233000 -- (-653.781) (-655.912) (-657.772) [-655.917] * (-654.734) [-655.827] (-654.352) (-656.422) -- 0:00:49
233500 -- (-655.461) [-657.220] (-660.104) (-657.345) * (-655.184) [-656.744] (-653.872) (-657.102) -- 0:00:49
234000 -- (-653.089) (-654.635) [-653.617] (-654.347) * (-655.220) (-655.437) (-655.352) [-656.177] -- 0:00:52
234500 -- (-655.042) (-654.130) [-652.999] (-654.379) * (-656.838) (-656.513) [-656.140] (-653.185) -- 0:00:52
235000 -- (-654.861) (-657.315) (-654.015) [-653.638] * (-654.511) (-658.265) [-654.533] (-656.983) -- 0:00:52
Average standard deviation of split frequencies: 0.016085
235500 -- (-654.669) (-659.958) (-655.456) [-660.332] * (-655.672) (-662.784) [-654.735] (-656.767) -- 0:00:51
236000 -- (-655.936) (-658.958) (-655.809) [-654.450] * [-657.075] (-655.811) (-657.819) (-653.617) -- 0:00:51
236500 -- (-659.722) (-653.536) [-657.110] (-657.388) * (-658.113) (-653.811) (-662.374) [-653.919] -- 0:00:51
237000 -- [-655.028] (-655.467) (-654.324) (-660.355) * (-655.255) (-654.813) (-656.919) [-655.174] -- 0:00:51
237500 -- (-654.025) (-655.200) [-654.624] (-655.974) * (-654.760) [-653.070] (-654.952) (-654.815) -- 0:00:51
238000 -- [-654.913] (-654.204) (-655.908) (-654.001) * [-656.085] (-654.676) (-654.814) (-656.709) -- 0:00:51
238500 -- (-653.884) [-658.292] (-657.451) (-657.599) * [-654.055] (-653.646) (-653.896) (-654.455) -- 0:00:51
239000 -- (-655.112) (-655.910) (-653.364) [-656.001] * [-653.603] (-653.945) (-653.874) (-653.418) -- 0:00:50
239500 -- (-654.031) (-654.070) [-657.533] (-656.015) * [-658.090] (-653.629) (-653.780) (-657.550) -- 0:00:50
240000 -- (-655.793) (-655.641) [-655.276] (-655.075) * (-657.458) [-656.946] (-654.014) (-656.971) -- 0:00:50
Average standard deviation of split frequencies: 0.016289
240500 -- (-654.605) (-659.144) [-655.912] (-654.999) * (-655.057) [-656.266] (-657.105) (-653.808) -- 0:00:50
241000 -- [-654.023] (-659.065) (-655.636) (-656.630) * (-655.769) (-655.842) (-658.759) [-653.301] -- 0:00:50
241500 -- [-653.391] (-656.706) (-654.367) (-656.855) * (-655.960) [-656.840] (-654.614) (-654.336) -- 0:00:50
242000 -- (-652.912) (-662.188) [-655.614] (-656.300) * [-660.155] (-655.674) (-655.576) (-655.342) -- 0:00:50
242500 -- (-653.678) (-660.338) (-655.529) [-656.414] * (-653.149) [-653.873] (-658.572) (-653.636) -- 0:00:49
243000 -- (-656.133) (-654.883) (-657.938) [-654.891] * (-653.642) (-657.771) [-658.355] (-659.567) -- 0:00:49
243500 -- (-658.497) [-653.841] (-660.194) (-656.629) * (-653.361) (-658.775) (-655.171) [-656.678] -- 0:00:49
244000 -- (-655.183) (-653.379) (-657.398) [-654.020] * (-654.168) (-661.085) (-654.257) [-656.173] -- 0:00:49
244500 -- (-653.684) (-653.467) [-654.312] (-653.016) * (-657.401) (-655.983) (-654.273) [-657.382] -- 0:00:49
245000 -- (-654.532) (-654.326) (-654.011) [-653.104] * (-655.520) [-653.031] (-654.515) (-654.139) -- 0:00:49
Average standard deviation of split frequencies: 0.016137
245500 -- [-655.514] (-654.764) (-652.843) (-654.653) * (-657.096) (-654.193) [-655.024] (-653.456) -- 0:00:49
246000 -- (-655.676) (-653.868) (-655.388) [-656.023] * (-657.081) (-655.134) [-655.235] (-655.413) -- 0:00:49
246500 -- [-657.313] (-654.102) (-653.702) (-659.830) * [-653.102] (-653.740) (-654.040) (-653.497) -- 0:00:48
247000 -- (-654.301) [-653.567] (-653.431) (-655.971) * (-654.130) [-654.660] (-654.321) (-653.406) -- 0:00:48
247500 -- (-657.105) (-654.320) (-655.170) [-654.311] * (-653.982) [-653.740] (-653.149) (-655.887) -- 0:00:48
248000 -- (-656.103) (-656.310) (-656.267) [-656.011] * [-659.070] (-657.197) (-653.123) (-656.978) -- 0:00:48
248500 -- (-657.049) (-653.602) (-656.573) [-656.081] * (-656.721) (-656.302) (-653.262) [-653.006] -- 0:00:48
249000 -- [-653.899] (-654.628) (-653.489) (-655.355) * (-657.155) (-656.012) [-655.535] (-654.967) -- 0:00:48
249500 -- (-655.334) (-656.000) [-654.633] (-657.548) * [-654.271] (-654.676) (-654.774) (-654.802) -- 0:00:48
250000 -- (-659.249) [-655.476] (-655.930) (-656.873) * (-659.470) (-652.961) (-658.152) [-656.023] -- 0:00:48
Average standard deviation of split frequencies: 0.017222
250500 -- (-662.578) (-656.522) (-656.428) [-655.764] * (-653.617) (-654.052) (-653.603) [-656.606] -- 0:00:50
251000 -- [-652.726] (-654.561) (-654.495) (-652.982) * (-655.983) [-654.857] (-654.661) (-657.088) -- 0:00:50
251500 -- (-653.935) (-655.611) [-653.717] (-652.998) * (-654.673) (-657.133) [-654.296] (-656.748) -- 0:00:50
252000 -- (-654.831) (-661.785) [-652.901] (-654.362) * (-654.392) (-656.284) [-653.375] (-656.659) -- 0:00:50
252500 -- (-655.544) (-654.896) (-652.954) [-653.859] * (-653.400) (-660.227) [-653.196] (-655.417) -- 0:00:50
253000 -- (-656.861) (-654.782) (-653.414) [-653.948] * [-654.502] (-654.906) (-654.529) (-653.474) -- 0:00:50
253500 -- (-654.463) [-654.452] (-655.931) (-654.357) * [-654.566] (-654.890) (-656.554) (-654.289) -- 0:00:50
254000 -- (-653.064) (-656.660) (-658.760) [-653.459] * [-658.388] (-654.694) (-657.385) (-654.007) -- 0:00:49
254500 -- [-657.068] (-652.932) (-658.354) (-653.114) * (-656.944) (-653.992) (-655.394) [-653.599] -- 0:00:49
255000 -- (-652.741) (-654.206) [-657.532] (-653.320) * (-654.438) [-657.288] (-656.273) (-653.753) -- 0:00:49
Average standard deviation of split frequencies: 0.017309
255500 -- (-654.056) (-656.326) (-654.369) [-654.882] * (-654.678) (-656.397) (-661.116) [-657.191] -- 0:00:49
256000 -- (-653.787) (-657.034) (-655.323) [-654.300] * (-653.940) (-657.148) (-657.288) [-655.045] -- 0:00:49
256500 -- (-659.299) (-660.991) (-653.233) [-655.473] * (-654.381) [-654.092] (-653.529) (-653.774) -- 0:00:49
257000 -- (-653.836) (-655.545) (-654.959) [-655.912] * [-653.602] (-662.776) (-654.478) (-655.421) -- 0:00:49
257500 -- (-654.384) (-654.815) (-654.641) [-655.478] * (-654.831) (-662.056) (-658.238) [-653.588] -- 0:00:49
258000 -- (-657.239) (-655.253) (-654.618) [-658.142] * [-656.241] (-654.959) (-655.181) (-653.360) -- 0:00:48
258500 -- (-656.196) (-654.145) [-654.621] (-655.016) * (-657.490) (-655.734) (-656.590) [-653.256] -- 0:00:48
259000 -- [-656.426] (-654.636) (-654.464) (-655.973) * (-655.010) (-654.255) (-655.755) [-656.129] -- 0:00:48
259500 -- (-654.075) (-655.165) [-654.819] (-656.302) * [-653.207] (-657.970) (-655.042) (-654.554) -- 0:00:48
260000 -- [-653.516] (-654.984) (-653.618) (-654.206) * (-653.290) (-658.609) (-655.167) [-653.236] -- 0:00:48
Average standard deviation of split frequencies: 0.017090
260500 -- (-654.216) [-653.720] (-658.341) (-653.890) * (-654.324) (-655.973) [-658.173] (-656.453) -- 0:00:48
261000 -- (-656.132) (-657.476) (-656.406) [-659.077] * (-653.982) [-656.246] (-655.929) (-654.670) -- 0:00:48
261500 -- [-657.686] (-655.214) (-653.287) (-655.866) * (-655.258) (-657.324) (-657.128) [-656.311] -- 0:00:48
262000 -- (-660.055) [-653.730] (-655.264) (-656.088) * [-652.863] (-653.140) (-657.957) (-653.915) -- 0:00:47
262500 -- (-655.811) [-655.552] (-653.774) (-656.235) * (-655.732) [-654.044] (-657.733) (-655.989) -- 0:00:47
263000 -- [-654.308] (-656.478) (-654.667) (-653.688) * (-653.812) [-655.745] (-653.761) (-657.440) -- 0:00:47
263500 -- (-654.383) (-654.965) [-653.465] (-654.981) * [-655.908] (-655.666) (-658.896) (-654.947) -- 0:00:47
264000 -- (-656.966) (-653.065) (-653.717) [-654.105] * (-654.097) (-655.413) [-652.689] (-653.611) -- 0:00:47
264500 -- (-654.590) [-652.844] (-653.096) (-654.415) * (-654.001) (-654.090) (-654.589) [-653.422] -- 0:00:47
265000 -- (-653.525) (-658.404) (-655.161) [-653.168] * (-657.613) (-653.397) (-655.024) [-653.143] -- 0:00:47
Average standard deviation of split frequencies: 0.016924
265500 -- (-656.024) (-653.821) [-656.651] (-655.073) * [-656.871] (-655.239) (-656.392) (-657.487) -- 0:00:47
266000 -- (-654.981) [-655.446] (-658.692) (-656.401) * [-656.248] (-657.718) (-655.701) (-658.402) -- 0:00:46
266500 -- (-660.126) [-655.507] (-655.035) (-655.200) * (-655.659) (-657.066) (-653.440) [-653.331] -- 0:00:46
267000 -- (-660.680) (-653.436) (-654.554) [-654.862] * (-652.973) (-658.839) [-653.240] (-656.175) -- 0:00:46
267500 -- (-658.418) (-660.286) [-655.240] (-653.589) * (-655.596) (-654.829) [-654.522] (-654.054) -- 0:00:49
268000 -- [-655.910] (-660.449) (-657.937) (-653.203) * [-655.178] (-656.899) (-655.426) (-654.038) -- 0:00:49
268500 -- (-654.959) [-654.225] (-655.028) (-653.703) * (-654.252) (-656.247) (-654.774) [-654.046] -- 0:00:49
269000 -- (-659.969) [-657.149] (-655.333) (-655.360) * [-655.350] (-656.500) (-657.651) (-654.549) -- 0:00:48
269500 -- (-655.889) (-658.259) (-660.900) [-654.411] * (-653.530) [-660.176] (-660.785) (-656.527) -- 0:00:48
270000 -- (-657.522) [-654.713] (-655.425) (-653.658) * (-657.696) (-654.363) (-655.008) [-654.623] -- 0:00:48
Average standard deviation of split frequencies: 0.015936
270500 -- (-653.382) (-654.212) (-656.179) [-652.953] * (-654.050) [-653.227] (-658.253) (-654.494) -- 0:00:48
271000 -- (-653.275) [-654.259] (-655.381) (-654.754) * (-657.096) (-656.747) [-652.920] (-654.416) -- 0:00:48
271500 -- (-655.053) (-656.862) (-655.559) [-652.831] * (-653.740) (-656.232) [-652.883] (-655.794) -- 0:00:48
272000 -- (-660.836) (-654.178) [-654.914] (-656.522) * (-654.094) (-653.669) [-652.629] (-656.008) -- 0:00:48
272500 -- [-656.558] (-656.091) (-653.388) (-656.446) * (-654.094) [-654.837] (-654.848) (-658.962) -- 0:00:48
273000 -- (-654.818) [-653.767] (-654.491) (-659.760) * (-655.515) (-655.818) [-655.503] (-655.120) -- 0:00:47
273500 -- [-654.026] (-655.280) (-653.559) (-656.493) * (-656.708) (-653.694) (-653.928) [-656.755] -- 0:00:47
274000 -- [-653.105] (-657.501) (-655.972) (-656.716) * [-653.076] (-653.214) (-654.983) (-656.249) -- 0:00:47
274500 -- (-660.276) [-657.970] (-656.863) (-655.775) * (-653.799) (-653.191) [-654.057] (-658.133) -- 0:00:47
275000 -- [-658.099] (-654.101) (-656.222) (-655.785) * (-661.409) [-652.878] (-653.681) (-659.618) -- 0:00:47
Average standard deviation of split frequencies: 0.015970
275500 -- (-653.020) [-655.353] (-659.137) (-658.522) * [-657.300] (-655.674) (-655.837) (-659.019) -- 0:00:47
276000 -- (-653.971) [-657.886] (-657.215) (-654.957) * (-657.996) (-655.492) [-654.954] (-658.960) -- 0:00:47
276500 -- (-657.436) [-655.200] (-653.087) (-653.498) * (-657.694) (-653.654) [-654.601] (-658.913) -- 0:00:47
277000 -- [-654.216] (-654.365) (-655.804) (-657.578) * (-654.946) (-654.313) (-654.073) [-656.212] -- 0:00:46
277500 -- [-654.212] (-656.792) (-655.297) (-654.885) * (-654.744) (-657.600) [-653.087] (-658.789) -- 0:00:46
278000 -- (-654.476) [-655.381] (-655.109) (-654.928) * (-656.529) (-654.060) (-655.278) [-656.391] -- 0:00:46
278500 -- [-654.455] (-654.844) (-656.023) (-654.371) * [-653.984] (-661.423) (-654.318) (-656.796) -- 0:00:46
279000 -- (-656.407) (-654.612) (-656.561) [-655.279] * [-653.836] (-655.092) (-653.525) (-657.232) -- 0:00:46
279500 -- [-654.167] (-653.095) (-654.799) (-654.428) * (-654.205) [-655.163] (-653.720) (-657.159) -- 0:00:46
280000 -- [-654.240] (-657.610) (-654.263) (-659.923) * (-656.704) [-654.598] (-655.298) (-653.993) -- 0:00:46
Average standard deviation of split frequencies: 0.016460
280500 -- (-654.239) (-655.566) [-656.056] (-654.241) * [-653.932] (-655.301) (-654.767) (-654.084) -- 0:00:46
281000 -- [-655.653] (-656.067) (-653.753) (-655.476) * [-655.267] (-656.868) (-654.157) (-654.503) -- 0:00:46
281500 -- (-659.630) (-655.895) (-654.867) [-653.549] * [-655.435] (-655.603) (-654.061) (-654.626) -- 0:00:48
282000 -- [-659.035] (-654.832) (-655.506) (-652.988) * (-653.991) (-656.340) [-657.058] (-653.016) -- 0:00:48
282500 -- (-656.122) [-657.153] (-655.397) (-653.104) * (-656.428) [-655.399] (-655.078) (-659.523) -- 0:00:48
283000 -- (-655.044) (-657.278) [-654.876] (-657.002) * (-655.412) (-654.336) [-657.553] (-655.122) -- 0:00:48
283500 -- (-654.071) (-659.211) (-654.092) [-655.720] * (-661.274) (-658.044) (-659.892) [-656.150] -- 0:00:48
284000 -- [-655.815] (-658.108) (-655.037) (-656.416) * (-653.682) (-658.124) [-656.340] (-655.966) -- 0:00:47
284500 -- (-655.301) (-660.259) [-654.826] (-656.309) * [-654.923] (-657.773) (-655.480) (-653.722) -- 0:00:47
285000 -- [-653.614] (-656.435) (-654.180) (-656.810) * (-652.907) [-656.452] (-665.085) (-663.410) -- 0:00:47
Average standard deviation of split frequencies: 0.016875
285500 -- (-653.899) (-654.282) [-655.217] (-654.283) * [-654.889] (-655.288) (-658.530) (-656.762) -- 0:00:47
286000 -- (-654.903) [-653.421] (-657.452) (-654.837) * (-656.039) (-656.609) (-654.372) [-654.008] -- 0:00:47
286500 -- (-656.980) [-655.830] (-655.321) (-653.689) * [-656.005] (-655.586) (-657.376) (-652.921) -- 0:00:47
287000 -- (-653.682) (-657.806) (-653.372) [-656.245] * (-655.744) [-653.928] (-654.403) (-654.234) -- 0:00:47
287500 -- [-656.178] (-655.310) (-656.027) (-653.752) * [-656.651] (-656.854) (-657.817) (-655.570) -- 0:00:47
288000 -- (-654.710) [-655.300] (-655.251) (-653.707) * (-654.029) (-653.283) (-655.867) [-655.126] -- 0:00:46
288500 -- (-654.322) (-653.752) (-653.743) [-653.503] * (-654.449) (-653.447) (-658.982) [-653.777] -- 0:00:46
289000 -- (-654.580) (-653.600) [-654.748] (-654.454) * [-652.932] (-654.576) (-656.637) (-654.088) -- 0:00:46
289500 -- (-654.181) [-654.564] (-659.810) (-653.884) * (-656.225) (-655.572) [-655.603] (-653.433) -- 0:00:46
290000 -- (-659.647) [-654.494] (-654.111) (-654.992) * (-656.422) (-655.489) (-658.854) [-654.101] -- 0:00:46
Average standard deviation of split frequencies: 0.016527
290500 -- (-653.840) (-653.231) [-654.775] (-653.892) * (-655.884) [-654.352] (-656.989) (-654.005) -- 0:00:46
291000 -- (-654.054) (-654.200) (-654.675) [-654.005] * (-654.399) [-653.256] (-656.464) (-654.126) -- 0:00:46
291500 -- (-654.768) [-654.129] (-655.146) (-653.667) * (-654.984) (-655.913) (-657.551) [-654.136] -- 0:00:46
292000 -- (-654.118) [-657.243] (-653.000) (-654.121) * (-652.955) (-659.038) [-658.408] (-654.730) -- 0:00:46
292500 -- (-654.058) (-653.362) (-654.198) [-653.813] * [-652.954] (-658.416) (-652.718) (-655.470) -- 0:00:45
293000 -- (-653.927) [-655.306] (-655.833) (-655.644) * [-654.121] (-659.204) (-653.722) (-655.608) -- 0:00:45
293500 -- [-652.838] (-656.669) (-655.684) (-654.706) * [-652.991] (-657.411) (-654.083) (-654.749) -- 0:00:45
294000 -- (-655.193) (-656.838) (-655.358) [-657.897] * (-652.838) [-656.291] (-654.595) (-653.553) -- 0:00:45
294500 -- (-654.029) (-653.093) [-653.685] (-655.968) * (-653.849) (-655.709) [-653.923] (-657.137) -- 0:00:45
295000 -- (-654.950) (-654.517) (-653.311) [-654.685] * [-653.929] (-657.359) (-654.506) (-654.929) -- 0:00:45
Average standard deviation of split frequencies: 0.017367
295500 -- (-655.175) (-655.608) [-656.114] (-653.175) * (-653.936) (-660.111) (-654.048) [-654.556] -- 0:00:45
296000 -- (-654.020) [-654.402] (-657.203) (-654.036) * [-655.307] (-654.066) (-653.791) (-653.394) -- 0:00:45
296500 -- (-654.215) (-654.749) [-653.950] (-654.332) * (-655.404) [-656.937] (-652.892) (-657.560) -- 0:00:45
297000 -- (-653.372) (-653.714) (-661.258) [-655.809] * (-654.239) (-654.399) [-653.528] (-657.549) -- 0:00:44
297500 -- (-653.540) (-656.175) (-653.571) [-657.335] * (-653.531) (-653.479) (-655.909) [-658.393] -- 0:00:44
298000 -- (-655.022) (-653.767) [-655.837] (-656.359) * [-654.474] (-656.217) (-656.257) (-654.416) -- 0:00:44
298500 -- (-654.734) [-653.697] (-656.367) (-654.654) * (-654.643) [-654.007] (-655.219) (-655.367) -- 0:00:47
299000 -- (-653.730) (-660.604) (-656.017) [-654.158] * (-657.829) (-655.191) (-655.895) [-653.566] -- 0:00:46
299500 -- (-654.164) (-655.708) (-658.723) [-653.650] * (-653.079) (-657.733) [-659.786] (-659.411) -- 0:00:46
300000 -- [-653.196] (-655.739) (-659.169) (-652.781) * (-654.230) [-654.437] (-654.097) (-654.439) -- 0:00:46
Average standard deviation of split frequencies: 0.017694
300500 -- (-654.379) [-653.649] (-654.347) (-652.778) * [-654.688] (-654.726) (-653.283) (-659.304) -- 0:00:46
301000 -- (-653.212) [-659.169] (-656.971) (-654.953) * [-653.901] (-655.264) (-654.301) (-655.772) -- 0:00:46
301500 -- (-653.748) (-658.069) [-657.288] (-654.541) * (-660.353) (-655.772) [-654.783] (-659.095) -- 0:00:46
302000 -- [-653.164] (-654.987) (-654.274) (-655.176) * [-653.782] (-655.532) (-657.056) (-653.771) -- 0:00:46
302500 -- (-653.562) [-653.418] (-664.169) (-657.387) * (-654.003) [-653.877] (-659.556) (-653.527) -- 0:00:46
303000 -- (-653.799) (-653.341) [-653.569] (-657.039) * (-657.458) [-654.466] (-654.620) (-654.321) -- 0:00:46
303500 -- [-653.309] (-654.931) (-653.464) (-655.801) * (-659.031) (-655.028) [-655.381] (-655.458) -- 0:00:45
304000 -- [-653.383] (-655.715) (-654.932) (-653.713) * [-653.283] (-658.349) (-653.929) (-659.202) -- 0:00:45
304500 -- [-653.472] (-654.456) (-653.873) (-654.619) * (-655.435) (-659.556) [-654.777] (-653.978) -- 0:00:45
305000 -- (-654.136) [-653.969] (-653.713) (-655.366) * (-654.425) (-655.486) (-656.107) [-656.397] -- 0:00:45
Average standard deviation of split frequencies: 0.017386
305500 -- [-653.464] (-655.067) (-656.770) (-655.857) * (-655.251) (-655.490) [-653.250] (-654.608) -- 0:00:45
306000 -- (-652.936) (-658.021) [-655.518] (-656.497) * (-658.616) (-653.972) [-655.160] (-653.720) -- 0:00:45
306500 -- (-655.084) [-655.288] (-654.430) (-655.606) * (-654.831) (-654.924) (-655.431) [-652.697] -- 0:00:45
307000 -- [-655.233] (-654.981) (-654.812) (-655.997) * (-656.739) [-654.887] (-653.122) (-656.502) -- 0:00:45
307500 -- (-655.659) (-656.688) [-653.410] (-660.465) * (-657.615) [-653.468] (-653.415) (-656.795) -- 0:00:45
308000 -- [-657.919] (-655.004) (-653.376) (-653.012) * (-657.096) (-652.936) [-653.305] (-655.372) -- 0:00:44
308500 -- (-655.355) [-652.914] (-653.448) (-653.337) * (-655.805) (-655.521) [-655.393] (-657.039) -- 0:00:44
309000 -- (-654.184) (-653.010) [-653.170] (-654.303) * (-657.594) [-653.887] (-655.442) (-656.862) -- 0:00:44
309500 -- (-654.137) [-654.370] (-655.151) (-654.444) * (-654.718) (-658.118) (-655.429) [-654.246] -- 0:00:44
310000 -- (-654.105) (-658.381) (-656.497) [-652.700] * [-653.362] (-657.227) (-656.988) (-659.656) -- 0:00:44
Average standard deviation of split frequencies: 0.017981
310500 -- (-653.551) (-655.098) [-654.590] (-657.450) * (-654.309) (-654.134) (-654.857) [-653.578] -- 0:00:44
311000 -- (-657.422) [-654.339] (-657.462) (-654.695) * (-652.803) (-653.920) [-659.771] (-653.510) -- 0:00:44
311500 -- (-654.783) [-654.525] (-655.608) (-656.473) * [-654.075] (-653.863) (-668.545) (-654.387) -- 0:00:44
312000 -- [-656.849] (-653.284) (-654.311) (-655.933) * [-653.494] (-654.030) (-661.832) (-653.442) -- 0:00:44
312500 -- [-656.237] (-654.285) (-654.594) (-658.201) * (-654.791) (-655.954) [-654.010] (-660.017) -- 0:00:44
313000 -- [-657.614] (-653.426) (-656.991) (-654.399) * (-653.909) (-654.625) (-654.065) [-653.955] -- 0:00:43
313500 -- (-656.356) (-653.988) (-656.143) [-655.809] * [-653.471] (-654.840) (-654.816) (-654.786) -- 0:00:43
314000 -- (-656.800) [-654.224] (-654.242) (-656.645) * (-655.575) (-655.425) [-656.563] (-655.591) -- 0:00:43
314500 -- (-654.156) (-653.587) (-652.629) [-653.409] * [-654.556] (-656.792) (-655.756) (-654.077) -- 0:00:43
315000 -- (-655.743) (-664.046) (-654.192) [-654.015] * (-653.475) [-656.100] (-654.601) (-654.861) -- 0:00:43
Average standard deviation of split frequencies: 0.017305
315500 -- (-656.299) (-655.255) [-653.934] (-653.920) * (-655.061) (-654.802) (-656.163) [-657.566] -- 0:00:45
316000 -- (-655.218) (-656.754) [-660.238] (-655.388) * (-658.351) [-654.816] (-654.204) (-657.727) -- 0:00:45
316500 -- (-655.453) (-656.200) (-654.367) [-654.277] * (-655.654) (-655.841) [-658.165] (-658.164) -- 0:00:45
317000 -- (-657.265) (-654.640) [-657.118] (-653.390) * (-658.866) [-656.769] (-654.972) (-654.974) -- 0:00:45
317500 -- (-656.658) (-653.994) [-653.759] (-652.785) * (-659.278) [-654.377] (-656.211) (-655.924) -- 0:00:45
318000 -- (-661.538) (-655.108) [-655.044] (-654.545) * (-655.533) (-655.503) [-655.829] (-655.757) -- 0:00:45
318500 -- [-658.436] (-656.115) (-655.233) (-655.339) * [-654.013] (-653.267) (-652.948) (-666.869) -- 0:00:44
319000 -- (-655.633) [-655.642] (-654.524) (-655.423) * (-654.052) (-654.168) [-655.910] (-662.957) -- 0:00:44
319500 -- [-654.684] (-657.830) (-654.500) (-654.726) * (-655.334) (-653.836) [-656.393] (-666.036) -- 0:00:44
320000 -- (-654.847) [-653.746] (-653.919) (-654.139) * (-653.904) (-654.070) [-657.319] (-658.520) -- 0:00:44
Average standard deviation of split frequencies: 0.017396
320500 -- (-654.339) (-653.446) (-653.757) [-655.075] * (-655.614) (-656.330) [-655.846] (-656.408) -- 0:00:44
321000 -- (-653.367) (-653.942) (-653.000) [-655.085] * (-657.553) (-655.300) (-655.133) [-654.885] -- 0:00:44
321500 -- [-655.053] (-656.960) (-655.193) (-655.293) * (-654.181) (-655.419) (-655.745) [-655.237] -- 0:00:44
322000 -- [-652.847] (-655.431) (-655.193) (-654.249) * (-655.610) (-653.433) (-655.353) [-653.181] -- 0:00:44
322500 -- (-654.042) (-654.599) [-658.651] (-654.553) * [-654.190] (-655.354) (-655.459) (-654.530) -- 0:00:44
323000 -- (-654.025) (-655.700) [-654.319] (-655.611) * [-657.559] (-654.803) (-654.425) (-656.509) -- 0:00:44
323500 -- (-653.573) (-654.111) (-654.867) [-653.904] * (-655.288) (-657.289) (-654.042) [-653.292] -- 0:00:43
324000 -- (-654.800) (-655.233) [-653.093] (-653.981) * [-654.322] (-653.414) (-656.429) (-656.518) -- 0:00:43
324500 -- [-653.226] (-655.437) (-658.813) (-657.373) * (-653.112) (-655.196) (-654.007) [-654.587] -- 0:00:43
325000 -- (-653.013) (-660.170) [-654.920] (-659.035) * (-656.734) (-655.393) (-654.893) [-655.149] -- 0:00:43
Average standard deviation of split frequencies: 0.016067
325500 -- (-653.461) (-654.389) (-654.724) [-654.349] * (-656.737) (-655.248) [-655.901] (-653.979) -- 0:00:43
326000 -- [-654.718] (-654.342) (-654.061) (-655.890) * (-654.914) (-657.198) [-655.830] (-657.018) -- 0:00:43
326500 -- (-653.634) [-654.298] (-657.458) (-656.195) * [-656.069] (-656.203) (-653.555) (-655.159) -- 0:00:43
327000 -- (-658.227) (-653.297) (-657.714) [-653.828] * (-654.772) [-657.764] (-655.535) (-653.766) -- 0:00:43
327500 -- (-658.215) (-656.896) (-660.285) [-655.075] * (-656.901) [-654.330] (-655.382) (-655.827) -- 0:00:43
328000 -- (-657.431) (-658.652) (-653.739) [-653.085] * [-653.686] (-659.965) (-656.682) (-655.006) -- 0:00:43
328500 -- (-654.504) [-652.858] (-658.081) (-658.454) * [-653.930] (-654.155) (-656.775) (-656.463) -- 0:00:42
329000 -- (-655.793) [-655.982] (-657.818) (-658.996) * (-653.838) (-654.279) (-658.358) [-653.955] -- 0:00:42
329500 -- (-655.436) [-655.703] (-655.726) (-655.488) * (-656.881) [-654.616] (-656.555) (-655.499) -- 0:00:42
330000 -- (-657.516) (-655.288) [-654.705] (-656.232) * (-657.114) [-654.363] (-654.112) (-653.659) -- 0:00:42
Average standard deviation of split frequencies: 0.015907
330500 -- (-654.850) [-655.578] (-657.595) (-654.545) * (-654.215) (-653.418) [-656.465] (-653.725) -- 0:00:42
331000 -- (-654.531) (-655.389) (-653.831) [-654.843] * (-653.297) (-656.847) [-655.925] (-654.671) -- 0:00:42
331500 -- (-653.307) (-653.895) [-655.284] (-655.477) * (-653.136) [-653.231] (-654.881) (-654.681) -- 0:00:42
332000 -- (-654.232) [-655.540] (-655.449) (-653.363) * (-655.114) (-654.799) [-654.135] (-655.809) -- 0:00:44
332500 -- (-655.532) [-656.064] (-653.506) (-654.398) * [-658.923] (-657.235) (-653.676) (-656.757) -- 0:00:44
333000 -- [-654.352] (-655.858) (-662.092) (-653.771) * (-657.322) (-653.387) [-654.251] (-655.003) -- 0:00:44
333500 -- [-655.515] (-659.831) (-654.003) (-653.544) * (-657.107) (-653.368) (-653.713) [-654.179] -- 0:00:43
334000 -- (-655.334) (-654.013) [-654.502] (-654.838) * (-655.499) (-655.140) (-656.525) [-653.317] -- 0:00:43
334500 -- (-659.035) (-654.387) [-656.004] (-654.587) * [-654.104] (-654.088) (-655.631) (-653.447) -- 0:00:43
335000 -- (-654.177) (-653.452) [-653.416] (-656.593) * (-655.316) (-657.538) (-654.252) [-653.381] -- 0:00:43
Average standard deviation of split frequencies: 0.015064
335500 -- (-656.917) (-656.250) (-653.910) [-655.038] * (-654.053) (-654.508) [-653.736] (-653.962) -- 0:00:43
336000 -- [-654.256] (-655.225) (-654.845) (-654.885) * (-654.393) (-655.776) [-656.499] (-653.296) -- 0:00:43
336500 -- (-658.789) (-655.747) (-654.689) [-656.884] * (-655.172) [-655.372] (-659.652) (-654.499) -- 0:00:43
337000 -- (-653.317) [-656.266] (-654.056) (-658.569) * (-655.720) (-653.775) [-656.233] (-655.089) -- 0:00:43
337500 -- (-653.920) (-655.295) [-653.908] (-656.018) * [-656.991] (-653.689) (-656.347) (-656.525) -- 0:00:43
338000 -- (-655.949) (-656.426) [-652.969] (-653.983) * [-654.402] (-652.632) (-654.728) (-655.539) -- 0:00:43
338500 -- (-654.606) (-653.495) [-653.525] (-657.930) * [-652.660] (-654.261) (-653.454) (-653.841) -- 0:00:42
339000 -- [-653.800] (-654.734) (-655.076) (-654.077) * (-654.696) [-656.878] (-656.621) (-653.276) -- 0:00:42
339500 -- [-658.846] (-652.986) (-653.853) (-653.778) * [-656.245] (-655.955) (-654.318) (-654.097) -- 0:00:42
340000 -- (-656.556) (-653.590) [-654.313] (-654.177) * (-652.808) (-658.433) [-655.001] (-656.680) -- 0:00:42
Average standard deviation of split frequencies: 0.014202
340500 -- (-653.820) (-657.307) (-653.941) [-653.751] * [-652.710] (-654.765) (-657.264) (-656.535) -- 0:00:42
341000 -- (-653.176) (-654.471) (-653.640) [-655.334] * [-653.694] (-654.105) (-658.091) (-660.834) -- 0:00:42
341500 -- (-653.580) (-657.416) [-654.929] (-655.964) * (-653.864) (-654.696) [-654.129] (-655.940) -- 0:00:42
342000 -- (-658.088) (-656.007) (-656.785) [-654.950] * [-653.079] (-656.268) (-659.871) (-654.939) -- 0:00:42
342500 -- (-654.663) [-653.663] (-656.450) (-656.813) * [-652.883] (-654.489) (-655.188) (-653.516) -- 0:00:42
343000 -- (-654.651) [-653.663] (-655.183) (-660.854) * (-654.990) (-656.199) [-654.742] (-653.618) -- 0:00:42
343500 -- (-654.536) (-653.986) (-654.924) [-657.905] * (-654.520) (-654.060) [-655.005] (-657.835) -- 0:00:42
344000 -- (-656.966) [-653.887] (-653.752) (-653.649) * (-655.178) (-660.664) [-656.594] (-654.585) -- 0:00:41
344500 -- (-653.544) (-655.397) [-656.744] (-653.355) * [-656.057] (-662.375) (-655.989) (-653.394) -- 0:00:41
345000 -- [-653.508] (-653.480) (-653.764) (-657.457) * (-654.795) (-657.314) [-654.841] (-655.755) -- 0:00:41
Average standard deviation of split frequencies: 0.013553
345500 -- (-654.652) (-654.966) [-658.276] (-656.352) * [-653.393] (-656.966) (-656.617) (-659.882) -- 0:00:41
346000 -- (-653.340) (-654.574) (-659.485) [-653.813] * [-656.802] (-653.508) (-655.672) (-653.923) -- 0:00:41
346500 -- (-653.384) (-655.553) [-656.179] (-654.473) * (-658.577) (-654.086) [-654.774] (-658.219) -- 0:00:41
347000 -- (-653.813) [-657.240] (-653.596) (-654.780) * (-656.272) [-654.033] (-658.263) (-659.377) -- 0:00:41
347500 -- (-653.598) [-654.134] (-657.169) (-652.858) * (-655.117) (-656.342) (-656.976) [-660.040] -- 0:00:41
348000 -- (-653.696) [-652.758] (-654.668) (-653.512) * [-656.523] (-656.393) (-655.701) (-654.857) -- 0:00:41
348500 -- (-657.583) (-654.688) [-655.830] (-656.388) * [-653.737] (-654.393) (-656.288) (-658.974) -- 0:00:41
349000 -- (-656.383) [-658.206] (-653.934) (-655.431) * (-653.582) (-655.050) [-655.830] (-660.424) -- 0:00:42
349500 -- (-655.713) (-652.793) (-654.748) [-655.129] * (-654.089) (-655.903) (-654.737) [-654.519] -- 0:00:42
350000 -- (-655.962) [-654.895] (-654.390) (-653.926) * (-654.149) (-655.377) [-654.930] (-656.373) -- 0:00:42
Average standard deviation of split frequencies: 0.013726
350500 -- (-659.502) (-655.964) (-655.968) [-653.080] * (-654.300) (-654.464) [-654.200] (-655.783) -- 0:00:42
351000 -- (-659.649) [-655.649] (-653.576) (-655.380) * (-655.084) [-654.834] (-654.265) (-657.041) -- 0:00:42
351500 -- (-662.225) (-655.896) (-653.763) [-653.058] * (-661.664) [-659.312] (-654.816) (-659.964) -- 0:00:42
352000 -- (-655.470) (-653.949) [-653.610] (-657.288) * [-656.306] (-660.674) (-655.512) (-661.124) -- 0:00:42
352500 -- (-655.560) (-653.870) (-655.954) [-655.231] * (-654.816) [-654.251] (-655.219) (-656.559) -- 0:00:42
353000 -- (-653.876) [-653.837] (-661.910) (-654.772) * (-656.738) (-653.753) (-654.235) [-654.534] -- 0:00:42
353500 -- (-654.516) (-654.156) (-659.014) [-654.520] * (-654.470) [-653.692] (-659.684) (-660.125) -- 0:00:42
354000 -- [-655.417] (-655.902) (-655.947) (-654.824) * (-656.312) (-654.108) [-661.972] (-653.498) -- 0:00:41
354500 -- [-654.903] (-656.222) (-655.580) (-654.556) * (-656.006) (-654.816) [-658.221] (-657.816) -- 0:00:41
355000 -- (-656.291) [-656.702] (-655.025) (-653.144) * (-655.720) (-654.867) [-654.636] (-656.329) -- 0:00:41
Average standard deviation of split frequencies: 0.012800
355500 -- (-654.546) (-656.580) [-654.479] (-655.041) * (-653.228) (-653.887) (-655.081) [-654.537] -- 0:00:41
356000 -- (-655.993) (-656.209) [-653.881] (-656.250) * (-654.262) [-653.473] (-654.296) (-654.411) -- 0:00:41
356500 -- [-654.337] (-655.220) (-658.408) (-656.323) * [-654.810] (-652.879) (-653.889) (-653.769) -- 0:00:41
357000 -- (-655.438) (-654.950) (-655.547) [-656.819] * (-655.659) (-655.160) [-654.254] (-653.523) -- 0:00:41
357500 -- (-653.063) (-654.120) [-653.559] (-656.664) * (-657.906) (-655.273) [-654.987] (-657.433) -- 0:00:41
358000 -- [-653.530] (-654.333) (-660.869) (-655.727) * (-655.931) (-654.153) (-656.325) [-654.451] -- 0:00:41
358500 -- [-654.870] (-661.910) (-654.323) (-655.812) * (-657.664) (-653.474) (-654.267) [-656.024] -- 0:00:41
359000 -- [-653.557] (-660.544) (-654.659) (-656.414) * [-655.488] (-653.244) (-654.936) (-654.034) -- 0:00:41
359500 -- (-653.656) (-659.876) (-658.935) [-659.125] * [-652.737] (-654.822) (-655.070) (-654.704) -- 0:00:40
360000 -- (-655.485) (-657.906) [-655.022] (-655.875) * (-654.265) (-654.117) (-655.338) [-655.041] -- 0:00:40
Average standard deviation of split frequencies: 0.012302
360500 -- (-655.581) (-655.482) [-654.402] (-655.097) * (-655.763) (-655.024) [-653.886] (-655.153) -- 0:00:40
361000 -- (-657.870) (-654.220) (-654.206) [-654.821] * [-655.811] (-655.020) (-654.293) (-654.683) -- 0:00:40
361500 -- (-652.824) (-654.073) (-653.705) [-653.304] * (-657.350) (-656.607) (-654.992) [-653.585] -- 0:00:40
362000 -- [-655.152] (-654.155) (-654.591) (-656.616) * [-658.455] (-653.769) (-654.300) (-654.269) -- 0:00:40
362500 -- (-654.161) (-654.300) (-654.956) [-653.770] * [-663.951] (-657.972) (-654.207) (-658.970) -- 0:00:40
363000 -- (-655.663) (-654.607) (-656.648) [-653.530] * [-653.872] (-655.487) (-655.639) (-654.773) -- 0:00:40
363500 -- (-658.122) (-654.600) [-654.199] (-655.687) * (-655.616) (-663.259) [-655.075] (-655.289) -- 0:00:40
364000 -- (-660.171) (-655.998) [-655.321] (-653.548) * (-655.074) [-655.489] (-654.390) (-656.844) -- 0:00:40
364500 -- (-655.495) (-653.638) (-656.450) [-654.618] * (-654.549) (-654.181) [-658.322] (-653.199) -- 0:00:40
365000 -- [-659.345] (-653.932) (-657.439) (-654.171) * (-655.085) [-659.126] (-655.124) (-653.293) -- 0:00:40
Average standard deviation of split frequencies: 0.012880
365500 -- (-656.553) [-654.307] (-660.462) (-654.785) * (-657.284) (-656.771) (-654.567) [-660.000] -- 0:00:39
366000 -- (-654.009) (-654.117) (-659.802) [-654.485] * (-653.652) (-654.801) (-656.566) [-659.408] -- 0:00:41
366500 -- (-655.122) [-656.383] (-658.541) (-659.361) * (-653.877) (-654.535) (-655.790) [-654.110] -- 0:00:41
367000 -- (-654.012) (-653.121) (-654.210) [-654.807] * (-656.807) [-654.482] (-655.997) (-654.622) -- 0:00:41
367500 -- (-652.906) (-655.932) (-653.976) [-653.836] * (-660.568) (-655.372) (-654.425) [-653.079] -- 0:00:41
368000 -- (-654.357) (-656.838) [-653.483] (-653.781) * (-658.307) [-657.927] (-655.987) (-653.856) -- 0:00:41
368500 -- [-657.520] (-654.659) (-653.228) (-654.971) * (-654.113) [-654.549] (-653.472) (-653.823) -- 0:00:41
369000 -- (-653.657) [-656.641] (-654.059) (-656.830) * (-654.226) (-654.287) (-652.706) [-655.115] -- 0:00:41
369500 -- (-654.767) [-657.313] (-653.978) (-653.298) * (-663.452) (-653.301) (-652.994) [-657.354] -- 0:00:40
370000 -- [-655.317] (-660.445) (-653.919) (-652.789) * (-658.282) (-653.042) [-653.569] (-657.170) -- 0:00:40
Average standard deviation of split frequencies: 0.012506
370500 -- (-653.118) (-656.319) (-653.295) [-655.314] * (-654.833) (-655.606) [-655.065] (-656.392) -- 0:00:40
371000 -- (-654.159) (-655.609) (-654.519) [-653.554] * [-654.460] (-654.529) (-654.458) (-654.835) -- 0:00:40
371500 -- (-655.202) [-654.577] (-657.098) (-655.019) * (-654.184) (-654.463) [-654.237] (-656.407) -- 0:00:40
372000 -- [-655.795] (-660.304) (-655.257) (-655.488) * (-656.515) (-653.881) [-654.129] (-655.037) -- 0:00:40
372500 -- [-656.975] (-654.359) (-653.518) (-653.960) * (-653.696) (-653.185) [-654.361] (-654.967) -- 0:00:40
373000 -- (-653.675) (-657.583) [-655.290] (-654.886) * (-655.942) (-655.670) (-655.873) [-652.802] -- 0:00:40
373500 -- (-653.277) (-655.105) (-654.877) [-654.907] * (-654.588) (-655.783) (-653.740) [-656.103] -- 0:00:40
374000 -- (-653.890) (-653.525) [-656.044] (-656.089) * (-658.371) [-657.090] (-653.742) (-658.084) -- 0:00:40
374500 -- (-654.265) (-653.933) (-654.728) [-653.477] * (-656.626) (-658.586) (-654.237) [-658.660] -- 0:00:40
375000 -- [-655.741] (-656.265) (-653.170) (-654.510) * (-655.598) (-654.386) [-656.998] (-661.981) -- 0:00:40
Average standard deviation of split frequencies: 0.011874
375500 -- (-655.649) (-654.517) [-654.828] (-655.778) * (-653.842) [-661.654] (-658.952) (-653.511) -- 0:00:39
376000 -- (-654.717) [-653.735] (-655.087) (-653.702) * (-655.812) (-659.236) (-663.584) [-654.024] -- 0:00:39
376500 -- [-654.679] (-654.876) (-654.862) (-653.888) * (-653.043) (-656.756) (-655.963) [-654.207] -- 0:00:39
377000 -- (-654.936) (-653.952) (-654.130) [-655.380] * (-654.908) [-655.069] (-656.025) (-656.130) -- 0:00:39
377500 -- [-654.122] (-656.750) (-655.211) (-655.040) * (-660.740) (-655.648) (-653.572) [-653.569] -- 0:00:39
378000 -- [-653.614] (-656.112) (-655.063) (-652.965) * (-658.641) (-655.701) (-654.477) [-653.418] -- 0:00:39
378500 -- (-655.871) (-655.554) (-655.326) [-654.057] * (-656.007) (-655.745) (-653.438) [-653.465] -- 0:00:39
379000 -- [-653.313] (-654.870) (-656.565) (-653.882) * (-656.092) (-654.872) [-654.018] (-654.148) -- 0:00:39
379500 -- (-654.646) (-656.453) [-653.642] (-655.150) * (-656.237) (-653.631) (-656.516) [-654.823] -- 0:00:39
380000 -- (-656.374) [-655.855] (-654.032) (-653.591) * (-653.497) (-656.431) [-657.058] (-653.226) -- 0:00:39
Average standard deviation of split frequencies: 0.011801
380500 -- (-658.397) [-654.903] (-655.864) (-655.230) * (-654.667) (-655.752) [-655.443] (-653.732) -- 0:00:39
381000 -- [-653.825] (-655.668) (-656.783) (-657.728) * [-655.259] (-658.521) (-657.981) (-654.311) -- 0:00:38
381500 -- (-653.779) (-655.481) [-654.545] (-654.735) * (-656.098) [-657.489] (-657.981) (-654.568) -- 0:00:38
382000 -- (-654.115) (-653.140) (-656.215) [-655.327] * (-654.304) (-654.425) (-657.665) [-656.815] -- 0:00:38
382500 -- [-655.698] (-653.175) (-654.957) (-655.845) * (-653.846) (-655.200) (-659.486) [-653.563] -- 0:00:40
383000 -- (-654.032) (-657.292) [-656.222] (-654.024) * (-653.012) (-654.394) [-654.935] (-654.437) -- 0:00:40
383500 -- (-654.581) [-655.995] (-656.926) (-654.177) * [-653.305] (-658.564) (-652.950) (-655.813) -- 0:00:40
384000 -- (-657.652) (-656.905) [-653.357] (-653.003) * (-654.912) (-653.944) [-654.026] (-655.771) -- 0:00:40
384500 -- (-655.837) [-654.591] (-654.976) (-654.680) * (-653.040) [-654.726] (-653.922) (-655.228) -- 0:00:40
385000 -- (-654.388) (-653.190) (-653.757) [-654.118] * (-658.276) (-654.759) (-653.954) [-654.328] -- 0:00:39
Average standard deviation of split frequencies: 0.010991
385500 -- (-658.136) (-653.981) [-656.835] (-657.775) * (-653.773) (-654.182) (-654.117) [-654.615] -- 0:00:39
386000 -- (-655.590) [-654.178] (-656.436) (-652.789) * (-654.678) (-655.021) (-655.604) [-653.971] -- 0:00:39
386500 -- (-657.392) (-653.799) (-655.633) [-657.955] * (-656.648) (-653.433) (-657.596) [-657.000] -- 0:00:39
387000 -- (-656.941) [-654.694] (-653.616) (-656.208) * [-655.886] (-655.211) (-655.513) (-653.217) -- 0:00:39
387500 -- (-659.170) [-654.840] (-658.683) (-656.670) * (-654.323) [-657.582] (-653.962) (-653.415) -- 0:00:39
388000 -- (-655.652) [-655.523] (-653.224) (-658.454) * (-654.012) [-657.739] (-652.632) (-654.628) -- 0:00:39
388500 -- [-654.686] (-654.435) (-658.212) (-661.637) * [-656.863] (-654.587) (-654.234) (-656.321) -- 0:00:39
389000 -- (-655.777) [-655.065] (-655.334) (-659.583) * [-656.114] (-652.757) (-655.031) (-653.852) -- 0:00:39
389500 -- (-656.107) (-656.098) [-655.330] (-653.478) * (-657.547) (-654.031) (-657.971) [-653.862] -- 0:00:39
390000 -- (-654.034) (-655.595) [-653.861] (-654.754) * (-655.102) (-657.842) [-653.783] (-656.206) -- 0:00:39
Average standard deviation of split frequencies: 0.011530
390500 -- (-657.184) [-653.610] (-654.876) (-660.639) * (-655.117) (-654.172) (-653.817) [-655.066] -- 0:00:39
391000 -- (-653.207) [-654.855] (-655.417) (-660.738) * (-653.980) [-656.391] (-652.646) (-654.193) -- 0:00:38
391500 -- (-656.320) (-653.819) [-654.186] (-657.183) * (-654.466) (-656.689) (-654.282) [-656.309] -- 0:00:38
392000 -- (-654.339) (-657.554) (-657.548) [-653.032] * (-654.697) (-655.660) (-657.092) [-654.193] -- 0:00:38
392500 -- (-656.298) [-655.208] (-658.694) (-653.256) * (-655.481) [-654.807] (-653.820) (-653.209) -- 0:00:38
393000 -- (-655.777) (-658.659) (-652.936) [-653.954] * (-662.214) (-657.104) [-654.307] (-654.038) -- 0:00:38
393500 -- (-654.669) (-655.306) (-653.303) [-653.233] * (-652.988) (-658.449) (-658.862) [-656.010] -- 0:00:38
394000 -- [-653.798] (-655.231) (-653.291) (-653.406) * (-656.496) (-656.328) [-657.452] (-654.928) -- 0:00:38
394500 -- (-653.567) (-653.165) [-657.142] (-654.915) * [-660.557] (-657.429) (-656.091) (-662.363) -- 0:00:38
395000 -- (-655.503) [-655.252] (-657.936) (-655.187) * (-657.830) (-657.091) (-652.689) [-653.645] -- 0:00:38
Average standard deviation of split frequencies: 0.010978
395500 -- [-654.024] (-652.669) (-656.324) (-653.900) * [-656.041] (-656.651) (-653.530) (-658.549) -- 0:00:38
396000 -- (-655.443) (-654.707) (-653.569) [-659.354] * (-658.086) [-656.034] (-654.813) (-654.492) -- 0:00:38
396500 -- (-652.980) (-656.459) [-656.594] (-654.149) * [-655.263] (-657.538) (-656.431) (-653.738) -- 0:00:38
397000 -- (-658.100) (-658.554) (-655.723) [-655.845] * (-654.023) (-655.904) (-654.989) [-653.571] -- 0:00:37
397500 -- (-653.571) [-656.588] (-653.508) (-652.927) * (-654.540) [-655.528] (-656.797) (-653.743) -- 0:00:37
398000 -- (-654.844) (-654.490) [-653.558] (-657.021) * (-656.961) [-654.074] (-658.695) (-654.316) -- 0:00:37
398500 -- [-656.037] (-656.632) (-653.627) (-654.249) * (-653.436) (-654.537) [-653.016] (-659.559) -- 0:00:37
399000 -- [-654.775] (-655.989) (-654.567) (-655.421) * (-653.886) (-657.818) (-652.983) [-653.387] -- 0:00:37
399500 -- (-653.926) (-652.676) (-653.671) [-655.178] * (-653.112) (-655.370) (-653.621) [-654.602] -- 0:00:39
400000 -- (-654.580) (-654.317) [-653.646] (-656.861) * (-653.627) (-653.437) [-653.854] (-653.706) -- 0:00:39
Average standard deviation of split frequencies: 0.010458
400500 -- (-656.839) [-656.370] (-653.546) (-654.191) * (-662.520) [-653.715] (-654.447) (-653.174) -- 0:00:38
401000 -- (-661.117) (-655.926) [-654.392] (-654.055) * (-653.943) (-653.893) [-654.881] (-655.146) -- 0:00:38
401500 -- (-660.059) [-655.786] (-654.992) (-654.055) * (-656.733) [-655.413] (-658.032) (-656.259) -- 0:00:38
402000 -- [-655.870] (-654.884) (-655.390) (-653.999) * [-655.372] (-654.816) (-659.752) (-655.976) -- 0:00:38
402500 -- (-656.043) (-653.290) (-656.555) [-653.394] * (-655.595) (-655.859) [-658.615] (-656.494) -- 0:00:38
403000 -- (-655.823) (-653.552) [-654.761] (-653.293) * (-655.329) (-656.889) [-656.292] (-655.822) -- 0:00:38
403500 -- (-652.816) [-657.109] (-653.740) (-652.622) * [-656.188] (-654.835) (-656.172) (-658.002) -- 0:00:38
404000 -- (-655.509) [-655.041] (-655.585) (-653.950) * (-657.032) (-653.632) (-654.798) [-656.369] -- 0:00:38
404500 -- [-657.200] (-653.831) (-655.718) (-655.386) * [-653.263] (-653.171) (-653.816) (-652.627) -- 0:00:38
405000 -- (-653.816) (-656.001) [-655.067] (-656.757) * (-653.290) [-654.557] (-654.367) (-655.156) -- 0:00:38
Average standard deviation of split frequencies: 0.011147
405500 -- (-653.715) (-654.301) [-654.947] (-654.346) * (-656.716) (-660.909) (-657.543) [-653.263] -- 0:00:38
406000 -- (-655.039) [-654.125] (-654.543) (-656.092) * (-653.720) (-653.422) (-658.651) [-655.525] -- 0:00:38
406500 -- [-657.207] (-658.541) (-655.913) (-654.211) * (-654.927) [-653.405] (-658.759) (-657.778) -- 0:00:37
407000 -- [-654.525] (-655.024) (-659.284) (-654.286) * [-653.457] (-655.189) (-653.961) (-655.086) -- 0:00:37
407500 -- [-654.913] (-657.007) (-654.224) (-653.721) * (-654.010) (-653.680) [-653.022] (-655.485) -- 0:00:37
408000 -- [-655.931] (-658.193) (-653.812) (-654.393) * (-654.988) (-657.941) [-654.348] (-654.789) -- 0:00:37
408500 -- [-653.377] (-655.396) (-653.511) (-660.763) * [-653.861] (-655.008) (-655.847) (-653.796) -- 0:00:37
409000 -- (-653.377) [-653.676] (-653.963) (-654.120) * [-653.587] (-654.834) (-654.270) (-653.923) -- 0:00:37
409500 -- (-653.365) [-655.882] (-653.294) (-655.985) * (-654.161) [-652.792] (-657.554) (-655.263) -- 0:00:37
410000 -- (-654.031) (-654.659) (-653.089) [-655.671] * (-654.593) [-652.636] (-653.051) (-657.124) -- 0:00:37
Average standard deviation of split frequencies: 0.011177
410500 -- (-660.843) [-656.414] (-653.664) (-656.406) * (-655.223) (-655.510) (-659.269) [-656.104] -- 0:00:37
411000 -- (-658.800) (-654.602) (-655.391) [-654.836] * (-654.697) (-656.755) (-657.521) [-653.341] -- 0:00:37
411500 -- (-655.136) [-654.835] (-654.875) (-656.114) * (-655.228) (-655.659) [-656.236] (-655.686) -- 0:00:37
412000 -- (-653.464) [-653.267] (-657.849) (-655.194) * (-654.825) [-655.028] (-653.289) (-655.030) -- 0:00:37
412500 -- [-654.419] (-652.962) (-653.902) (-653.305) * (-653.521) [-655.123] (-653.161) (-656.616) -- 0:00:37
413000 -- [-654.934] (-655.338) (-656.073) (-656.386) * [-654.577] (-654.163) (-655.253) (-656.688) -- 0:00:36
413500 -- (-656.165) [-654.349] (-653.804) (-656.911) * (-654.551) [-655.467] (-656.989) (-655.661) -- 0:00:36
414000 -- (-657.911) (-654.410) [-653.150] (-655.510) * (-656.178) (-655.033) (-658.045) [-654.769] -- 0:00:36
414500 -- (-654.025) [-654.129] (-655.714) (-654.632) * [-656.418] (-653.283) (-656.360) (-657.964) -- 0:00:36
415000 -- (-654.350) (-655.455) (-660.020) [-654.279] * (-656.991) [-654.800] (-655.362) (-655.450) -- 0:00:36
Average standard deviation of split frequencies: 0.011898
415500 -- (-656.818) (-657.252) [-657.568] (-653.506) * (-656.933) [-654.397] (-658.169) (-654.384) -- 0:00:36
416000 -- (-653.094) (-655.800) [-654.141] (-652.823) * (-654.677) (-653.906) (-655.885) [-653.705] -- 0:00:37
416500 -- (-653.872) (-654.262) [-657.326] (-653.832) * (-657.346) [-654.999] (-654.711) (-654.547) -- 0:00:37
417000 -- (-660.056) (-656.175) (-653.022) [-655.061] * (-658.385) [-653.830] (-658.339) (-655.773) -- 0:00:37
417500 -- [-655.435] (-655.921) (-655.258) (-655.372) * (-656.912) (-655.324) (-654.880) [-655.212] -- 0:00:37
418000 -- (-658.900) (-654.747) (-653.890) [-653.955] * (-654.894) (-656.114) [-653.338] (-657.964) -- 0:00:37
418500 -- (-658.308) (-653.929) [-654.814] (-654.560) * (-656.224) [-658.673] (-653.919) (-652.944) -- 0:00:37
419000 -- (-655.479) (-655.082) (-654.523) [-657.065] * (-654.187) (-656.985) (-655.399) [-652.962] -- 0:00:37
419500 -- [-655.584] (-660.000) (-656.917) (-655.362) * (-654.242) (-656.555) (-655.360) [-657.538] -- 0:00:37
420000 -- (-655.456) [-653.128] (-653.935) (-657.671) * (-654.693) (-655.721) [-654.114] (-658.210) -- 0:00:37
Average standard deviation of split frequencies: 0.011147
420500 -- [-656.767] (-657.215) (-656.230) (-654.952) * (-654.002) [-653.378] (-653.152) (-657.206) -- 0:00:37
421000 -- (-656.143) [-653.444] (-653.590) (-660.934) * (-656.089) (-656.399) [-655.892] (-654.490) -- 0:00:37
421500 -- (-653.318) [-656.924] (-660.619) (-656.132) * [-653.720] (-653.702) (-656.495) (-654.658) -- 0:00:37
422000 -- (-653.883) [-655.110] (-655.929) (-656.477) * (-654.650) [-654.778] (-653.832) (-653.988) -- 0:00:36
422500 -- (-654.983) [-656.712] (-658.832) (-653.302) * [-653.809] (-656.301) (-653.985) (-653.233) -- 0:00:36
423000 -- [-653.662] (-655.387) (-660.923) (-654.208) * (-656.805) (-655.601) (-654.624) [-655.629] -- 0:00:36
423500 -- (-654.255) (-656.638) (-656.965) [-658.180] * (-655.455) (-656.118) (-653.821) [-656.229] -- 0:00:36
424000 -- (-653.418) [-656.351] (-656.012) (-655.308) * [-653.590] (-654.724) (-655.731) (-655.236) -- 0:00:36
424500 -- [-652.844] (-656.551) (-658.367) (-655.395) * (-653.863) (-657.401) [-653.608] (-656.795) -- 0:00:36
425000 -- (-653.953) [-657.428] (-656.685) (-658.832) * (-656.846) (-660.881) [-653.909] (-654.319) -- 0:00:36
Average standard deviation of split frequencies: 0.011066
425500 -- (-656.397) (-653.370) [-655.901] (-652.873) * (-654.884) (-653.321) (-654.461) [-655.102] -- 0:00:36
426000 -- (-655.347) (-652.852) (-654.268) [-652.873] * (-655.735) [-654.344] (-653.596) (-655.948) -- 0:00:36
426500 -- (-655.347) (-653.803) (-655.154) [-653.940] * (-653.039) (-655.062) [-653.184] (-659.894) -- 0:00:36
427000 -- (-656.974) (-655.589) [-653.557] (-655.534) * [-654.381] (-654.585) (-653.344) (-654.661) -- 0:00:36
427500 -- (-657.581) [-655.298] (-654.699) (-653.868) * (-659.685) [-653.874] (-654.002) (-658.128) -- 0:00:36
428000 -- [-653.089] (-653.976) (-654.627) (-654.468) * [-653.413] (-655.681) (-655.221) (-655.248) -- 0:00:36
428500 -- (-654.123) [-654.317] (-654.398) (-654.434) * (-655.284) (-654.154) (-655.739) [-656.142] -- 0:00:36
429000 -- (-655.770) (-655.532) (-655.159) [-655.111] * (-656.678) (-656.585) (-655.025) [-661.990] -- 0:00:35
429500 -- (-654.867) (-655.544) (-656.815) [-654.542] * (-654.472) (-656.223) [-653.738] (-656.508) -- 0:00:35
430000 -- (-654.805) (-656.923) [-655.669] (-658.836) * (-655.947) (-653.601) (-655.039) [-656.567] -- 0:00:35
Average standard deviation of split frequencies: 0.011810
430500 -- (-653.174) (-663.998) (-655.593) [-659.031] * [-654.872] (-655.560) (-655.037) (-655.304) -- 0:00:35
431000 -- (-656.328) [-654.936] (-653.783) (-657.681) * (-655.499) (-655.277) (-655.697) [-656.893] -- 0:00:35
431500 -- (-656.938) (-654.083) [-653.844] (-655.989) * (-654.002) (-656.404) (-656.354) [-657.639] -- 0:00:35
432000 -- (-657.942) (-653.826) [-654.839] (-654.377) * (-655.182) (-655.647) (-654.428) [-654.503] -- 0:00:35
432500 -- (-656.512) (-654.978) (-656.907) [-655.080] * [-652.964] (-657.574) (-653.721) (-653.976) -- 0:00:36
433000 -- [-653.190] (-656.350) (-658.870) (-657.338) * (-654.280) (-654.854) (-656.017) [-654.683] -- 0:00:36
433500 -- (-654.497) (-654.234) (-655.065) [-654.085] * [-656.531] (-655.326) (-653.661) (-657.029) -- 0:00:36
434000 -- (-658.848) (-653.320) (-655.462) [-652.652] * (-653.950) (-657.265) [-654.603] (-655.178) -- 0:00:36
434500 -- (-653.695) [-653.500] (-655.696) (-660.849) * (-653.753) (-654.953) (-655.380) [-653.741] -- 0:00:36
435000 -- (-654.199) (-653.378) (-663.914) [-657.195] * (-660.905) (-655.398) [-655.046] (-655.659) -- 0:00:36
Average standard deviation of split frequencies: 0.011723
435500 -- (-653.494) [-658.840] (-654.247) (-655.321) * (-658.982) (-654.708) (-654.479) [-655.684] -- 0:00:36
436000 -- [-653.700] (-655.044) (-656.709) (-655.071) * (-657.219) (-654.309) [-653.833] (-654.627) -- 0:00:36
436500 -- [-655.199] (-655.697) (-655.598) (-655.916) * [-656.354] (-655.265) (-655.263) (-656.089) -- 0:00:36
437000 -- (-653.603) (-657.005) (-653.681) [-653.293] * (-653.914) (-655.910) (-658.886) [-654.953] -- 0:00:36
437500 -- [-653.579] (-652.754) (-654.646) (-656.115) * (-654.839) (-654.372) (-657.262) [-655.539] -- 0:00:36
438000 -- [-652.881] (-655.120) (-654.446) (-658.559) * (-657.177) [-657.553] (-655.094) (-653.968) -- 0:00:35
438500 -- [-653.003] (-654.107) (-654.601) (-653.995) * (-654.117) [-653.863] (-653.972) (-659.876) -- 0:00:35
439000 -- (-653.853) (-654.771) (-653.644) [-655.487] * (-656.244) (-653.055) [-656.443] (-663.780) -- 0:00:35
439500 -- (-654.207) [-654.118] (-653.610) (-654.288) * (-655.987) (-654.342) (-656.194) [-658.367] -- 0:00:35
440000 -- (-657.430) (-653.706) (-654.439) [-653.436] * (-655.345) [-652.698] (-655.183) (-655.504) -- 0:00:35
Average standard deviation of split frequencies: 0.011148
440500 -- (-658.494) [-653.606] (-656.823) (-653.127) * (-656.181) (-655.886) (-654.933) [-653.712] -- 0:00:35
441000 -- (-653.156) (-653.741) (-654.728) [-655.744] * (-655.483) [-654.437] (-655.182) (-654.116) -- 0:00:35
441500 -- (-655.429) (-657.494) (-652.977) [-655.664] * (-655.135) (-653.228) (-655.643) [-653.687] -- 0:00:35
442000 -- (-653.886) (-656.871) (-655.392) [-654.958] * (-654.308) (-654.609) (-655.191) [-655.171] -- 0:00:35
442500 -- [-653.296] (-659.158) (-657.941) (-652.712) * (-656.904) [-653.887] (-654.998) (-655.577) -- 0:00:35
443000 -- (-654.609) [-654.249] (-656.403) (-655.408) * (-652.934) [-655.106] (-656.694) (-655.420) -- 0:00:35
443500 -- (-654.274) [-654.425] (-653.576) (-655.506) * (-654.326) (-657.193) (-657.753) [-658.255] -- 0:00:35
444000 -- (-660.341) (-652.947) [-654.490] (-654.021) * (-658.105) [-653.547] (-655.641) (-656.804) -- 0:00:35
444500 -- [-656.955] (-656.240) (-654.052) (-653.801) * [-658.869] (-656.013) (-655.603) (-656.590) -- 0:00:34
445000 -- (-657.054) (-656.719) [-657.748] (-658.650) * (-655.879) [-655.038] (-655.393) (-654.460) -- 0:00:34
Average standard deviation of split frequencies: 0.011015
445500 -- (-654.108) (-655.361) [-653.853] (-652.883) * (-653.209) (-654.978) [-654.696] (-657.707) -- 0:00:34
446000 -- (-653.041) [-654.723] (-652.936) (-655.592) * (-652.915) (-655.694) [-653.347] (-656.081) -- 0:00:34
446500 -- [-656.311] (-654.993) (-655.207) (-654.081) * (-655.844) (-653.080) (-658.641) [-653.842] -- 0:00:34
447000 -- [-661.310] (-654.629) (-655.985) (-653.321) * (-654.807) (-654.226) [-659.273] (-655.530) -- 0:00:34
447500 -- (-664.757) (-653.385) [-655.461] (-652.943) * (-654.046) (-653.539) [-657.172] (-655.282) -- 0:00:34
448000 -- (-653.767) [-653.189] (-657.036) (-656.584) * (-653.669) (-654.159) [-655.058] (-655.168) -- 0:00:34
448500 -- (-655.380) (-653.802) [-653.001] (-654.125) * [-654.153] (-653.606) (-653.254) (-654.683) -- 0:00:34
449000 -- (-655.455) [-654.575] (-656.217) (-658.531) * (-653.104) (-653.512) [-655.690] (-654.545) -- 0:00:34
449500 -- (-655.514) (-653.893) (-654.918) [-658.526] * (-654.816) [-653.273] (-655.558) (-657.177) -- 0:00:35
450000 -- (-656.191) (-657.337) (-656.256) [-657.747] * (-656.334) [-654.034] (-656.383) (-656.758) -- 0:00:35
Average standard deviation of split frequencies: 0.010170
450500 -- (-653.497) (-659.424) (-654.051) [-659.884] * (-656.199) (-656.678) (-658.170) [-654.629] -- 0:00:35
451000 -- [-654.158] (-654.068) (-655.446) (-655.543) * (-655.663) [-658.063] (-657.185) (-656.318) -- 0:00:35
451500 -- [-658.715] (-654.514) (-658.680) (-655.352) * [-653.262] (-654.888) (-655.966) (-653.495) -- 0:00:35
452000 -- (-661.851) (-654.606) [-655.596] (-656.369) * (-653.367) (-653.120) [-653.713] (-656.246) -- 0:00:35
452500 -- (-656.900) [-653.460] (-657.481) (-654.284) * (-657.620) [-653.644] (-654.240) (-660.446) -- 0:00:35
453000 -- (-656.136) (-653.370) [-653.432] (-658.611) * (-660.020) (-654.864) [-655.311] (-659.682) -- 0:00:35
453500 -- (-656.874) (-653.516) (-656.169) [-654.549] * (-655.013) (-657.180) [-657.983] (-660.767) -- 0:00:34
454000 -- (-654.238) (-654.133) [-654.092] (-660.763) * (-654.383) (-656.682) [-659.423] (-653.655) -- 0:00:34
454500 -- (-655.819) (-655.426) [-657.018] (-660.062) * (-656.585) (-654.283) [-656.022] (-653.300) -- 0:00:34
455000 -- (-654.543) [-654.382] (-655.903) (-658.322) * (-654.615) (-655.089) [-656.899] (-655.348) -- 0:00:34
Average standard deviation of split frequencies: 0.010568
455500 -- (-655.895) (-657.082) [-655.102] (-654.201) * (-661.208) (-656.758) (-654.522) [-653.191] -- 0:00:34
456000 -- (-656.301) (-652.756) (-654.299) [-654.153] * (-659.302) (-657.232) (-655.906) [-654.437] -- 0:00:34
456500 -- (-657.061) (-654.323) (-654.634) [-654.418] * (-658.126) (-655.257) [-653.650] (-654.748) -- 0:00:34
457000 -- (-655.404) (-656.153) [-656.869] (-655.611) * (-654.458) (-658.150) (-655.504) [-656.229] -- 0:00:34
457500 -- (-658.469) (-654.945) [-656.620] (-655.524) * (-655.847) (-657.196) [-656.863] (-652.894) -- 0:00:34
458000 -- (-653.246) (-656.740) (-656.278) [-655.829] * (-654.266) (-654.800) [-653.940] (-656.061) -- 0:00:34
458500 -- (-653.844) [-653.930] (-656.357) (-655.164) * (-655.270) (-654.339) (-655.808) [-656.887] -- 0:00:34
459000 -- (-655.103) (-655.915) (-658.580) [-653.861] * (-655.331) (-656.575) (-654.678) [-654.358] -- 0:00:34
459500 -- (-655.483) (-654.739) [-655.835] (-655.761) * (-658.213) [-655.401] (-654.838) (-654.310) -- 0:00:34
460000 -- (-653.715) [-654.760] (-654.312) (-656.579) * (-661.782) [-658.954] (-653.196) (-653.747) -- 0:00:34
Average standard deviation of split frequencies: 0.011370
460500 -- [-653.212] (-655.429) (-656.247) (-657.971) * (-654.953) (-655.601) [-654.917] (-654.295) -- 0:00:33
461000 -- (-653.932) (-660.504) [-656.745] (-657.720) * (-653.833) (-654.720) [-653.084] (-655.042) -- 0:00:33
461500 -- (-655.447) [-656.675] (-659.087) (-655.388) * (-656.341) (-655.693) (-653.718) [-656.119] -- 0:00:33
462000 -- (-659.211) (-653.668) (-655.917) [-658.404] * [-656.826] (-654.442) (-654.395) (-653.605) -- 0:00:33
462500 -- [-654.939] (-657.033) (-653.563) (-659.684) * [-653.051] (-656.511) (-655.097) (-658.515) -- 0:00:33
463000 -- (-659.621) (-656.336) [-653.651] (-654.001) * (-659.006) (-658.312) [-654.546] (-655.816) -- 0:00:33
463500 -- (-655.348) [-654.276] (-654.333) (-654.076) * (-655.275) (-656.272) [-654.212] (-653.901) -- 0:00:33
464000 -- (-654.596) (-655.664) [-656.444] (-654.562) * (-653.322) (-655.868) (-655.753) [-655.942] -- 0:00:34
464500 -- [-657.393] (-655.802) (-654.568) (-654.159) * (-653.300) (-655.961) [-661.158] (-655.159) -- 0:00:34
465000 -- (-652.884) (-656.061) (-658.086) [-653.194] * (-653.254) (-654.531) [-655.164] (-653.659) -- 0:00:34
Average standard deviation of split frequencies: 0.011015
465500 -- (-656.063) (-655.324) [-655.513] (-656.014) * (-653.823) (-654.502) [-655.082] (-655.764) -- 0:00:34
466000 -- (-655.853) (-656.276) [-652.599] (-657.313) * [-653.376] (-654.843) (-656.334) (-655.008) -- 0:00:34
466500 -- (-654.176) [-655.088] (-654.018) (-655.708) * (-653.038) (-656.418) (-658.501) [-654.742] -- 0:00:34
467000 -- (-655.034) (-656.023) (-654.899) [-653.882] * (-653.814) (-655.234) (-656.178) [-653.617] -- 0:00:34
467500 -- [-655.631] (-656.944) (-656.142) (-654.423) * (-656.435) (-655.005) [-654.500] (-655.972) -- 0:00:34
468000 -- [-655.618] (-656.814) (-654.528) (-655.049) * (-656.640) [-655.386] (-655.555) (-653.524) -- 0:00:34
468500 -- [-653.700] (-655.599) (-655.529) (-655.295) * (-654.728) (-659.129) [-653.183] (-654.584) -- 0:00:34
469000 -- [-654.876] (-658.193) (-656.025) (-653.460) * (-656.175) (-656.051) (-653.750) [-654.531] -- 0:00:33
469500 -- (-655.614) [-657.518] (-655.404) (-652.655) * (-657.134) [-653.301] (-654.259) (-654.944) -- 0:00:33
470000 -- (-658.284) (-655.487) (-652.774) [-653.156] * (-653.767) (-654.093) (-653.982) [-653.694] -- 0:00:33
Average standard deviation of split frequencies: 0.011295
470500 -- (-657.486) (-655.068) [-654.269] (-653.065) * (-653.089) (-657.157) (-653.294) [-655.233] -- 0:00:33
471000 -- (-659.310) (-655.781) (-654.529) [-653.155] * (-655.622) (-655.747) [-654.261] (-657.422) -- 0:00:33
471500 -- [-655.210] (-662.321) (-654.134) (-653.832) * (-654.524) (-653.652) [-654.298] (-658.426) -- 0:00:33
472000 -- [-658.404] (-658.279) (-653.391) (-654.018) * [-655.092] (-654.319) (-654.396) (-655.938) -- 0:00:33
472500 -- (-655.830) (-656.308) (-655.004) [-653.345] * [-653.626] (-655.503) (-654.728) (-654.056) -- 0:00:33
473000 -- (-655.969) (-659.585) [-653.318] (-656.734) * (-658.365) [-654.258] (-654.870) (-653.748) -- 0:00:33
473500 -- (-654.752) (-655.948) [-658.017] (-653.379) * (-654.470) [-652.987] (-654.659) (-653.294) -- 0:00:33
474000 -- [-654.632] (-655.327) (-654.548) (-654.459) * (-653.819) [-655.638] (-654.843) (-656.684) -- 0:00:33
474500 -- (-653.370) (-653.446) (-653.254) [-655.558] * (-656.088) (-655.240) (-654.106) [-653.611] -- 0:00:33
475000 -- (-653.395) (-656.054) [-653.320] (-655.206) * [-654.182] (-656.392) (-655.177) (-657.638) -- 0:00:33
Average standard deviation of split frequencies: 0.010839
475500 -- [-655.518] (-657.627) (-654.827) (-655.364) * [-655.482] (-654.882) (-655.903) (-657.786) -- 0:00:33
476000 -- (-655.635) (-654.386) [-657.019] (-653.409) * [-656.590] (-655.257) (-656.651) (-655.070) -- 0:00:33
476500 -- (-656.869) (-653.335) [-656.769] (-656.808) * (-660.269) (-653.567) (-656.638) [-653.197] -- 0:00:32
477000 -- (-659.467) [-652.813] (-658.687) (-655.309) * (-654.250) (-655.453) [-655.526] (-654.212) -- 0:00:32
477500 -- (-653.236) (-657.239) [-654.599] (-657.065) * (-656.875) (-659.144) [-654.266] (-654.125) -- 0:00:32
478000 -- (-654.551) [-654.245] (-657.281) (-653.433) * (-655.418) [-659.170] (-656.318) (-655.606) -- 0:00:32
478500 -- (-655.435) [-654.852] (-656.370) (-655.983) * [-654.049] (-655.578) (-655.020) (-653.646) -- 0:00:32
479000 -- [-656.936] (-655.877) (-656.828) (-655.495) * (-653.190) (-656.218) (-656.575) [-653.147] -- 0:00:33
479500 -- (-655.500) [-655.259] (-653.015) (-654.422) * (-654.482) (-656.806) [-654.056] (-656.002) -- 0:00:33
480000 -- (-656.495) (-659.675) (-653.705) [-653.734] * (-656.787) (-654.122) [-659.644] (-653.948) -- 0:00:33
Average standard deviation of split frequencies: 0.010352
480500 -- (-654.706) (-654.641) (-653.570) [-655.547] * (-655.648) (-655.138) [-656.753] (-661.705) -- 0:00:33
481000 -- (-654.384) [-653.396] (-653.238) (-653.705) * (-654.072) (-653.238) [-655.167] (-655.851) -- 0:00:33
481500 -- (-653.391) [-654.015] (-654.310) (-652.966) * (-654.655) [-653.874] (-654.172) (-654.288) -- 0:00:33
482000 -- (-653.775) [-654.975] (-654.542) (-654.730) * (-655.733) [-653.171] (-653.761) (-653.517) -- 0:00:33
482500 -- (-653.064) [-653.069] (-657.656) (-655.625) * (-655.733) (-655.712) [-653.238] (-656.083) -- 0:00:33
483000 -- (-653.477) [-653.212] (-654.604) (-656.142) * (-653.703) [-655.456] (-654.007) (-653.587) -- 0:00:33
483500 -- (-654.181) (-656.060) [-653.663] (-654.094) * (-653.415) (-655.094) (-653.691) [-655.317] -- 0:00:33
484000 -- (-655.012) (-654.555) (-655.080) [-653.943] * (-654.215) [-652.935] (-653.102) (-655.246) -- 0:00:33
484500 -- (-654.416) (-654.445) (-655.112) [-653.845] * (-655.014) (-652.782) (-655.646) [-657.554] -- 0:00:32
485000 -- [-653.902] (-655.633) (-652.551) (-654.705) * (-656.645) (-654.106) [-655.091] (-658.163) -- 0:00:32
Average standard deviation of split frequencies: 0.010400
485500 -- (-655.064) (-653.812) [-655.175] (-655.426) * (-655.551) (-654.272) [-656.385] (-655.572) -- 0:00:32
486000 -- (-653.720) [-655.457] (-653.999) (-654.236) * (-655.990) (-654.302) (-654.985) [-655.404] -- 0:00:32
486500 -- (-653.500) [-654.710] (-655.201) (-654.483) * (-656.885) (-653.455) [-654.040] (-654.978) -- 0:00:32
487000 -- [-652.799] (-654.754) (-655.956) (-656.238) * (-655.160) (-655.783) [-654.241] (-653.753) -- 0:00:32
487500 -- (-655.782) [-655.207] (-655.476) (-653.612) * (-654.376) (-655.813) (-653.173) [-656.578] -- 0:00:32
488000 -- (-653.681) [-654.922] (-655.675) (-655.014) * (-657.592) (-656.942) [-654.376] (-653.450) -- 0:00:32
488500 -- [-655.583] (-658.153) (-655.794) (-653.715) * (-654.869) [-653.756] (-656.819) (-652.735) -- 0:00:32
489000 -- (-654.546) (-654.201) (-655.545) [-658.065] * (-653.792) [-653.977] (-661.771) (-654.537) -- 0:00:32
489500 -- [-654.316] (-656.384) (-654.420) (-655.169) * (-653.855) (-655.352) [-656.602] (-654.358) -- 0:00:32
490000 -- (-655.561) [-653.819] (-655.867) (-653.159) * (-653.195) [-658.343] (-654.844) (-653.280) -- 0:00:32
Average standard deviation of split frequencies: 0.010301
490500 -- (-655.589) [-655.169] (-657.002) (-654.488) * (-655.023) (-655.141) [-655.049] (-653.423) -- 0:00:32
491000 -- (-653.580) (-657.417) (-653.478) [-653.787] * (-657.505) [-655.590] (-655.772) (-660.514) -- 0:00:32
491500 -- (-653.319) (-653.830) [-656.130] (-655.307) * (-655.936) (-656.417) [-653.881] (-654.532) -- 0:00:32
492000 -- (-653.527) [-653.444] (-657.768) (-653.566) * (-655.570) (-659.783) (-655.819) [-655.035] -- 0:00:32
492500 -- (-653.433) (-656.815) (-654.466) [-654.740] * (-654.440) (-653.872) [-655.619] (-655.884) -- 0:00:31
493000 -- (-655.603) (-656.457) (-653.917) [-659.199] * (-653.670) (-656.449) [-655.747] (-652.730) -- 0:00:31
493500 -- [-658.941] (-654.269) (-653.747) (-657.319) * [-653.927] (-654.462) (-659.271) (-653.657) -- 0:00:31
494000 -- (-657.382) (-656.316) (-657.549) [-654.471] * (-661.732) (-654.529) [-659.485] (-654.916) -- 0:00:31
494500 -- (-656.057) [-656.483] (-656.072) (-654.774) * [-656.281] (-653.224) (-654.193) (-656.632) -- 0:00:32
495000 -- (-655.446) (-654.146) (-662.793) [-654.622] * (-657.576) [-653.609] (-654.289) (-656.104) -- 0:00:32
Average standard deviation of split frequencies: 0.009927
495500 -- (-657.268) (-653.091) (-657.233) [-654.268] * (-655.372) (-653.922) (-659.803) [-654.712] -- 0:00:32
496000 -- (-654.228) (-653.751) (-654.276) [-654.684] * (-654.937) (-653.075) (-656.910) [-654.850] -- 0:00:32
496500 -- (-656.097) [-654.690] (-654.787) (-653.637) * (-656.009) (-655.943) (-653.272) [-654.196] -- 0:00:32
497000 -- (-653.916) (-654.270) [-653.248] (-653.309) * (-653.553) (-655.259) [-653.125] (-654.303) -- 0:00:32
497500 -- [-653.416] (-653.474) (-654.221) (-653.385) * (-660.195) (-656.562) (-654.508) [-653.784] -- 0:00:32
498000 -- (-657.951) (-657.629) (-653.406) [-653.349] * (-655.430) (-653.883) (-653.100) [-654.425] -- 0:00:32
498500 -- [-653.166] (-656.127) (-654.460) (-653.870) * [-654.452] (-656.626) (-657.153) (-655.103) -- 0:00:32
499000 -- (-653.007) [-656.362] (-654.154) (-653.729) * (-656.213) (-658.092) (-654.466) [-653.485] -- 0:00:32
499500 -- (-653.327) [-655.021] (-654.615) (-653.946) * (-659.959) (-657.811) [-657.529] (-654.250) -- 0:00:32
500000 -- [-655.852] (-653.206) (-655.409) (-653.453) * (-654.955) [-655.060] (-655.400) (-656.126) -- 0:00:32
Average standard deviation of split frequencies: 0.010409
500500 -- [-657.451] (-655.998) (-654.027) (-654.895) * (-654.368) [-654.413] (-653.945) (-653.860) -- 0:00:31
501000 -- (-659.387) (-655.523) [-656.394] (-656.989) * (-654.748) (-655.375) [-654.554] (-653.797) -- 0:00:31
501500 -- (-653.671) (-655.406) [-655.817] (-654.994) * [-653.724] (-655.079) (-655.130) (-653.497) -- 0:00:31
502000 -- (-653.285) (-653.148) (-655.259) [-653.447] * [-657.362] (-654.168) (-656.787) (-653.987) -- 0:00:31
502500 -- [-652.916] (-654.639) (-653.543) (-655.227) * (-654.380) [-652.959] (-656.812) (-652.942) -- 0:00:31
503000 -- (-655.508) (-660.218) [-654.878] (-654.249) * (-654.904) (-654.393) [-658.859] (-653.893) -- 0:00:31
503500 -- [-655.537] (-653.676) (-654.056) (-654.263) * [-653.427] (-655.956) (-658.647) (-653.694) -- 0:00:31
504000 -- (-656.791) (-655.745) [-656.070] (-653.159) * [-654.727] (-655.700) (-654.283) (-656.036) -- 0:00:31
504500 -- (-655.530) (-656.037) (-653.918) [-657.253] * (-655.836) (-655.149) [-654.774] (-655.771) -- 0:00:31
505000 -- (-656.623) (-660.441) [-654.886] (-661.466) * (-656.565) (-655.644) [-654.075] (-654.719) -- 0:00:31
Average standard deviation of split frequencies: 0.010144
505500 -- (-654.083) (-655.497) [-655.556] (-657.724) * (-653.889) (-657.246) (-656.720) [-656.706] -- 0:00:31
506000 -- (-654.876) (-664.314) (-656.886) [-655.337] * (-655.167) (-659.859) (-657.458) [-654.092] -- 0:00:31
506500 -- [-655.412] (-655.403) (-656.500) (-654.478) * (-653.284) (-660.164) [-656.039] (-654.371) -- 0:00:31
507000 -- [-657.182] (-655.049) (-659.154) (-653.032) * (-652.750) (-656.898) [-657.266] (-655.832) -- 0:00:31
507500 -- [-654.927] (-653.241) (-654.176) (-652.902) * [-653.262] (-656.131) (-659.992) (-655.987) -- 0:00:31
508000 -- (-652.936) (-658.545) (-658.283) [-654.505] * [-655.289] (-654.127) (-657.202) (-653.985) -- 0:00:30
508500 -- (-652.796) [-654.883] (-653.916) (-663.797) * (-655.007) [-654.208] (-653.318) (-657.997) -- 0:00:30
509000 -- [-656.154] (-655.447) (-655.452) (-654.458) * [-654.060] (-661.542) (-653.550) (-654.459) -- 0:00:30
509500 -- (-655.940) [-655.335] (-655.713) (-654.873) * [-655.276] (-657.593) (-653.971) (-655.011) -- 0:00:31
510000 -- [-653.734] (-655.120) (-656.388) (-653.187) * (-654.779) (-653.403) [-654.135] (-659.315) -- 0:00:31
Average standard deviation of split frequencies: 0.009394
510500 -- [-656.050] (-653.104) (-654.816) (-658.699) * (-653.923) [-654.585] (-655.754) (-655.364) -- 0:00:31
511000 -- (-655.253) [-655.421] (-654.816) (-656.006) * (-655.418) (-656.287) (-658.837) [-655.623] -- 0:00:31
511500 -- (-654.632) (-652.742) (-656.359) [-654.376] * [-656.941] (-656.142) (-653.536) (-655.705) -- 0:00:31
512000 -- (-654.165) (-653.231) [-654.221] (-654.929) * (-655.160) (-655.010) (-656.238) [-654.533] -- 0:00:31
512500 -- [-655.271] (-655.809) (-654.123) (-653.411) * [-654.075] (-654.995) (-652.759) (-653.271) -- 0:00:31
513000 -- [-653.171] (-654.197) (-654.245) (-653.350) * [-654.363] (-653.985) (-653.814) (-654.349) -- 0:00:31
513500 -- (-658.244) [-654.196] (-654.355) (-655.409) * (-653.592) (-654.504) [-654.294] (-654.603) -- 0:00:31
514000 -- (-657.091) [-655.858] (-653.112) (-656.453) * (-655.906) [-657.178] (-656.441) (-657.329) -- 0:00:31
514500 -- [-656.882] (-656.028) (-655.091) (-653.775) * (-656.152) (-658.138) (-653.421) [-656.674] -- 0:00:31
515000 -- (-653.030) (-656.337) (-655.216) [-653.660] * (-653.457) [-653.738] (-653.691) (-658.522) -- 0:00:31
Average standard deviation of split frequencies: 0.009512
515500 -- (-654.726) [-656.433] (-653.796) (-656.183) * (-655.321) [-658.587] (-654.381) (-654.026) -- 0:00:31
516000 -- (-655.364) (-656.275) (-654.693) [-656.767] * (-655.000) (-658.948) [-656.461] (-654.846) -- 0:00:30
516500 -- (-654.029) [-652.838] (-654.807) (-653.761) * [-653.678] (-655.084) (-654.877) (-653.440) -- 0:00:30
517000 -- [-654.916] (-652.837) (-658.185) (-654.136) * (-655.626) [-655.920] (-660.250) (-653.614) -- 0:00:30
517500 -- (-653.351) [-655.451] (-656.095) (-653.658) * (-654.512) (-654.502) [-654.756] (-662.557) -- 0:00:30
518000 -- (-654.322) (-655.005) [-653.570] (-653.094) * (-653.382) [-660.484] (-655.337) (-653.682) -- 0:00:30
518500 -- (-660.918) [-654.097] (-656.272) (-654.940) * (-653.841) (-654.244) (-655.522) [-653.946] -- 0:00:30
519000 -- (-657.402) (-653.487) [-654.017] (-658.615) * (-655.189) (-655.093) [-656.695] (-653.174) -- 0:00:30
519500 -- (-659.061) [-654.817] (-653.062) (-656.527) * [-659.116] (-653.480) (-656.555) (-654.366) -- 0:00:30
520000 -- (-656.854) (-653.781) [-653.449] (-653.938) * (-653.990) (-655.059) [-653.844] (-654.972) -- 0:00:30
Average standard deviation of split frequencies: 0.009903
520500 -- (-656.078) (-658.465) [-653.671] (-652.592) * [-653.463] (-656.515) (-660.322) (-655.616) -- 0:00:30
521000 -- (-656.315) [-654.661] (-653.515) (-656.670) * (-655.960) (-653.191) [-654.705] (-655.609) -- 0:00:30
521500 -- [-655.234] (-654.350) (-653.849) (-655.726) * (-658.620) (-653.047) [-654.507] (-655.073) -- 0:00:30
522000 -- (-654.706) (-655.723) [-655.028] (-654.936) * (-654.365) (-658.694) (-653.621) [-653.386] -- 0:00:30
522500 -- (-653.758) (-655.957) (-653.603) [-654.759] * (-658.428) [-657.395] (-653.994) (-655.425) -- 0:00:30
523000 -- (-654.160) (-657.540) (-654.166) [-660.157] * (-660.798) [-655.747] (-656.054) (-655.242) -- 0:00:30
523500 -- (-657.214) (-654.292) (-656.741) [-659.415] * (-661.626) (-654.865) [-653.727] (-654.317) -- 0:00:30
524000 -- (-653.863) (-655.282) [-653.587] (-655.981) * (-657.598) (-654.009) [-655.430] (-654.389) -- 0:00:30
524500 -- (-653.351) (-654.984) [-654.821] (-654.704) * [-658.171] (-657.364) (-653.719) (-653.571) -- 0:00:30
525000 -- (-653.771) [-654.941] (-659.450) (-653.710) * (-653.714) [-653.838] (-655.964) (-654.842) -- 0:00:30
Average standard deviation of split frequencies: 0.009595
525500 -- (-656.822) (-655.910) [-656.791] (-653.634) * (-655.710) [-653.889] (-655.505) (-656.680) -- 0:00:30
526000 -- [-654.283] (-656.039) (-656.211) (-659.369) * (-653.554) (-658.522) [-652.655] (-658.033) -- 0:00:30
526500 -- (-655.818) [-655.063] (-654.085) (-658.211) * (-656.363) (-654.555) (-657.423) [-654.431] -- 0:00:30
527000 -- (-656.955) (-655.718) [-655.256] (-656.239) * (-662.202) (-656.290) [-653.861] (-653.949) -- 0:00:30
527500 -- (-656.431) [-654.550] (-656.755) (-653.323) * (-654.015) (-655.129) (-655.528) [-652.843] -- 0:00:30
528000 -- (-652.644) (-657.476) [-656.030] (-656.949) * (-656.310) [-655.181] (-654.088) (-655.075) -- 0:00:30
528500 -- (-654.094) [-654.753] (-653.406) (-655.924) * (-658.200) [-655.997] (-654.738) (-653.616) -- 0:00:30
529000 -- (-656.380) (-656.245) (-659.475) [-653.976] * (-656.591) (-657.009) (-657.287) [-653.909] -- 0:00:30
529500 -- [-655.283] (-655.626) (-655.361) (-653.881) * (-657.110) [-657.764] (-657.361) (-660.611) -- 0:00:30
530000 -- [-655.848] (-654.772) (-660.112) (-657.139) * (-655.010) [-656.617] (-653.259) (-656.952) -- 0:00:30
Average standard deviation of split frequencies: 0.009667
530500 -- [-654.771] (-654.478) (-660.342) (-654.556) * (-653.362) (-656.196) [-657.743] (-656.966) -- 0:00:30
531000 -- (-653.209) (-653.556) (-657.778) [-657.214] * (-656.004) [-654.462] (-656.040) (-655.219) -- 0:00:30
531500 -- [-656.578] (-655.816) (-656.349) (-654.897) * (-658.664) (-654.578) [-653.259] (-653.396) -- 0:00:29
532000 -- (-655.458) (-658.858) (-655.458) [-653.873] * (-656.953) (-655.341) [-654.240] (-654.600) -- 0:00:29
532500 -- (-655.924) (-655.859) [-657.175] (-658.369) * [-654.748] (-662.751) (-655.268) (-657.715) -- 0:00:29
533000 -- (-655.112) (-655.854) [-654.670] (-657.056) * [-654.859] (-655.371) (-654.318) (-657.314) -- 0:00:29
533500 -- (-655.611) (-654.052) (-653.559) [-655.137] * (-655.310) (-653.645) (-656.128) [-656.646] -- 0:00:29
534000 -- (-661.760) [-653.599] (-655.803) (-655.303) * [-653.541] (-655.898) (-658.641) (-653.355) -- 0:00:29
534500 -- [-656.912] (-653.175) (-657.294) (-656.465) * (-655.127) [-656.373] (-654.048) (-653.512) -- 0:00:29
535000 -- (-653.869) (-654.069) [-656.022] (-654.995) * (-656.715) (-656.174) (-654.156) [-655.201] -- 0:00:29
Average standard deviation of split frequencies: 0.009881
535500 -- (-654.493) (-658.597) (-654.732) [-659.608] * (-655.491) (-654.959) (-654.202) [-655.048] -- 0:00:29
536000 -- (-655.735) (-656.172) [-654.264] (-656.126) * (-653.108) (-653.795) (-656.063) [-653.715] -- 0:00:29
536500 -- [-654.932] (-656.301) (-653.796) (-654.984) * [-655.404] (-660.340) (-656.463) (-655.196) -- 0:00:29
537000 -- [-653.879] (-653.882) (-655.144) (-655.006) * [-654.438] (-652.932) (-658.270) (-654.555) -- 0:00:29
537500 -- (-661.923) (-659.325) [-653.496] (-653.727) * [-653.935] (-655.655) (-653.554) (-655.424) -- 0:00:29
538000 -- [-657.437] (-657.275) (-655.738) (-654.546) * [-653.660] (-655.193) (-652.976) (-653.887) -- 0:00:29
538500 -- (-656.442) [-657.405] (-654.487) (-655.517) * (-657.100) [-655.167] (-655.908) (-652.964) -- 0:00:29
539000 -- (-658.306) (-654.794) (-653.913) [-655.563] * (-656.011) (-654.167) (-655.405) [-655.156] -- 0:00:29
539500 -- [-655.572] (-654.142) (-656.867) (-654.674) * (-655.466) (-653.873) (-655.480) [-656.331] -- 0:00:29
540000 -- (-655.312) (-653.328) (-657.282) [-654.429] * (-655.789) (-656.882) (-655.008) [-655.569] -- 0:00:29
Average standard deviation of split frequencies: 0.010309
540500 -- (-653.488) (-657.763) [-656.821] (-653.178) * (-653.678) [-655.497] (-654.197) (-657.917) -- 0:00:29
541000 -- (-653.766) (-653.434) (-656.097) [-652.647] * (-653.998) (-655.539) (-654.881) [-655.129] -- 0:00:29
541500 -- (-657.496) (-656.143) (-659.687) [-655.119] * (-655.054) (-655.252) (-654.391) [-653.089] -- 0:00:29
542000 -- (-655.120) [-654.303] (-657.452) (-653.760) * (-659.160) (-655.028) [-656.535] (-653.605) -- 0:00:29
542500 -- (-653.231) (-655.778) (-657.246) [-654.453] * (-656.707) (-654.504) (-653.697) [-656.148] -- 0:00:29
543000 -- (-653.231) (-654.596) (-654.658) [-654.346] * (-655.206) (-654.525) [-654.011] (-656.164) -- 0:00:29
543500 -- [-652.977] (-655.664) (-654.372) (-653.994) * (-654.767) (-655.068) (-654.088) [-654.657] -- 0:00:29
544000 -- (-653.207) (-660.293) [-653.251] (-654.120) * [-658.026] (-656.695) (-653.573) (-655.340) -- 0:00:29
544500 -- (-655.249) [-654.126] (-656.537) (-654.674) * (-655.797) [-654.945] (-655.394) (-654.247) -- 0:00:29
545000 -- (-657.135) (-657.121) [-653.377] (-655.161) * (-656.441) (-656.507) [-655.395] (-653.990) -- 0:00:29
Average standard deviation of split frequencies: 0.010310
545500 -- [-655.923] (-654.628) (-653.946) (-653.948) * [-663.256] (-655.429) (-654.404) (-655.835) -- 0:00:29
546000 -- (-653.646) [-654.041] (-653.596) (-655.616) * (-652.911) (-653.748) (-653.588) [-656.505] -- 0:00:29
546500 -- (-654.573) (-653.797) (-654.512) [-654.041] * (-654.256) (-654.063) [-654.187] (-654.057) -- 0:00:29
547000 -- (-653.720) (-654.678) (-652.804) [-655.353] * (-653.556) (-655.497) [-656.575] (-658.759) -- 0:00:28
547500 -- (-656.602) [-653.868] (-653.024) (-655.800) * (-653.005) (-654.979) [-653.507] (-656.867) -- 0:00:28
548000 -- (-655.129) (-654.446) [-653.618] (-655.024) * (-655.728) (-656.029) [-654.180] (-656.132) -- 0:00:28
548500 -- [-653.642] (-654.866) (-653.379) (-654.723) * (-655.742) (-655.138) (-658.194) [-656.107] -- 0:00:28
549000 -- (-653.337) (-655.269) [-654.226] (-654.540) * (-655.895) (-654.344) (-656.058) [-654.332] -- 0:00:28
549500 -- (-653.400) [-653.571] (-656.759) (-657.522) * (-656.127) (-660.470) [-657.791] (-653.914) -- 0:00:28
550000 -- [-654.535] (-655.296) (-653.185) (-654.790) * (-655.782) [-658.404] (-654.954) (-657.064) -- 0:00:28
Average standard deviation of split frequencies: 0.010525
550500 -- [-652.690] (-653.979) (-661.418) (-653.842) * (-654.284) (-654.175) (-656.026) [-656.322] -- 0:00:28
551000 -- (-654.094) [-653.577] (-654.432) (-654.925) * (-656.075) [-653.820] (-654.773) (-657.089) -- 0:00:28
551500 -- (-652.792) [-656.600] (-654.980) (-656.375) * (-655.336) (-653.032) (-656.830) [-652.976] -- 0:00:28
552000 -- (-656.773) (-654.446) [-653.572] (-653.382) * [-654.268] (-653.578) (-655.805) (-653.121) -- 0:00:28
552500 -- (-656.395) [-654.189] (-654.033) (-659.749) * (-653.316) (-656.083) [-655.461] (-655.270) -- 0:00:28
553000 -- (-656.810) (-655.081) [-654.592] (-654.654) * (-653.909) (-655.558) (-654.137) [-654.109] -- 0:00:28
553500 -- (-655.913) (-655.779) (-656.284) [-653.245] * (-656.081) (-654.831) [-653.917] (-655.100) -- 0:00:28
554000 -- [-655.524] (-652.598) (-657.873) (-654.419) * [-654.343] (-654.914) (-653.326) (-653.768) -- 0:00:28
554500 -- (-656.332) (-654.277) [-653.179] (-653.701) * (-656.935) [-659.527] (-654.809) (-654.442) -- 0:00:28
555000 -- (-655.969) (-654.711) (-655.853) [-653.212] * (-653.972) (-654.430) (-654.830) [-655.659] -- 0:00:28
Average standard deviation of split frequencies: 0.010374
555500 -- (-656.917) [-653.264] (-653.210) (-655.679) * (-658.551) [-658.388] (-657.060) (-658.993) -- 0:00:28
556000 -- (-654.363) (-654.974) [-656.727] (-658.296) * (-658.461) (-654.408) [-654.503] (-654.486) -- 0:00:28
556500 -- (-657.551) [-653.018] (-653.943) (-653.689) * [-655.059] (-659.003) (-655.222) (-657.526) -- 0:00:28
557000 -- (-654.246) (-654.432) [-657.030] (-654.871) * (-655.244) [-653.602] (-655.541) (-655.585) -- 0:00:28
557500 -- (-655.680) (-655.332) (-659.028) [-655.193] * (-655.002) (-653.335) [-654.405] (-655.382) -- 0:00:28
558000 -- (-657.560) (-654.903) [-659.181] (-656.626) * (-657.519) (-653.200) [-653.865] (-655.529) -- 0:00:28
558500 -- [-657.753] (-655.376) (-662.642) (-656.241) * (-654.793) [-654.084] (-657.757) (-655.128) -- 0:00:28
559000 -- (-655.521) (-654.855) (-659.442) [-652.821] * (-653.833) [-654.139] (-655.274) (-656.996) -- 0:00:28
559500 -- (-657.197) (-654.786) [-654.651] (-655.767) * [-652.847] (-654.396) (-655.496) (-655.543) -- 0:00:28
560000 -- (-658.103) [-654.699] (-654.526) (-657.257) * [-654.523] (-653.145) (-653.734) (-655.750) -- 0:00:28
Average standard deviation of split frequencies: 0.009743
560500 -- (-656.640) (-654.621) (-656.211) [-656.717] * (-654.528) [-652.736] (-653.264) (-658.820) -- 0:00:28
561000 -- (-657.304) (-652.679) (-654.677) [-655.153] * [-655.900] (-654.083) (-656.575) (-654.332) -- 0:00:28
561500 -- (-657.134) (-653.331) (-656.145) [-656.363] * (-655.504) (-656.307) [-654.930] (-655.310) -- 0:00:28
562000 -- (-655.034) [-653.907] (-655.997) (-659.951) * (-653.509) (-655.170) [-655.527] (-655.363) -- 0:00:28
562500 -- (-656.130) [-655.936] (-654.316) (-654.701) * (-654.968) (-656.424) [-653.655] (-653.869) -- 0:00:28
563000 -- [-654.814] (-657.006) (-653.567) (-653.480) * (-653.517) [-653.359] (-654.166) (-653.198) -- 0:00:27
563500 -- (-656.788) [-655.358] (-652.716) (-653.391) * (-654.286) (-656.947) [-654.839] (-653.022) -- 0:00:27
564000 -- (-659.936) [-655.927] (-656.603) (-658.260) * (-653.693) (-656.300) (-652.748) [-657.154] -- 0:00:27
564500 -- (-653.751) (-656.283) [-655.818] (-655.063) * (-653.561) (-661.032) (-653.230) [-656.248] -- 0:00:27
565000 -- (-653.158) (-654.654) [-655.608] (-654.181) * (-655.218) (-656.271) [-652.890] (-655.166) -- 0:00:27
Average standard deviation of split frequencies: 0.009994
565500 -- (-653.007) (-655.433) [-654.872] (-653.748) * (-653.610) (-653.529) [-653.229] (-653.117) -- 0:00:27
566000 -- (-653.338) (-656.461) [-654.431] (-657.624) * (-655.546) (-652.845) [-654.080] (-653.436) -- 0:00:27
566500 -- [-654.147] (-656.188) (-654.852) (-654.553) * (-661.565) (-653.999) [-652.991] (-654.517) -- 0:00:27
567000 -- (-654.350) [-659.637] (-657.156) (-655.416) * (-656.182) (-656.838) [-653.019] (-654.123) -- 0:00:27
567500 -- (-656.720) [-656.604] (-657.930) (-653.609) * (-654.554) (-653.212) [-656.206] (-655.750) -- 0:00:27
568000 -- (-657.813) [-655.470] (-657.389) (-658.349) * (-655.421) (-656.760) [-654.679] (-656.639) -- 0:00:27
568500 -- (-653.842) [-656.577] (-655.011) (-654.222) * (-656.394) [-656.315] (-656.372) (-659.541) -- 0:00:27
569000 -- [-655.710] (-658.397) (-656.406) (-654.405) * [-654.771] (-654.919) (-657.741) (-654.084) -- 0:00:27
569500 -- (-657.710) [-662.326] (-654.328) (-656.132) * (-655.114) (-657.960) [-653.932] (-653.492) -- 0:00:27
570000 -- [-654.297] (-654.426) (-656.896) (-656.353) * (-656.293) (-658.413) [-653.785] (-653.296) -- 0:00:27
Average standard deviation of split frequencies: 0.010156
570500 -- (-653.991) (-654.696) (-655.000) [-656.278] * (-657.093) (-659.386) [-655.209] (-656.136) -- 0:00:27
571000 -- (-653.869) (-654.138) (-655.873) [-654.952] * (-659.901) [-658.869] (-654.861) (-656.152) -- 0:00:27
571500 -- (-655.861) [-654.523] (-652.823) (-654.656) * (-654.470) (-665.172) [-655.273] (-654.026) -- 0:00:27
572000 -- (-655.838) (-653.560) (-657.407) [-656.131] * (-655.488) (-655.219) (-654.620) [-654.365] -- 0:00:27
572500 -- (-655.251) (-654.442) [-653.489] (-655.358) * [-654.382] (-657.291) (-654.550) (-654.523) -- 0:00:27
573000 -- (-655.496) (-654.553) (-653.443) [-654.384] * (-653.077) (-657.453) [-656.664] (-652.767) -- 0:00:27
573500 -- (-655.797) [-654.869] (-655.424) (-653.571) * (-654.111) (-655.663) (-655.354) [-653.575] -- 0:00:27
574000 -- (-656.867) (-653.833) [-656.436] (-653.063) * (-656.579) (-654.688) [-654.378] (-654.455) -- 0:00:27
574500 -- (-653.475) (-655.042) [-654.011] (-653.148) * (-655.252) (-653.972) (-654.602) [-653.936] -- 0:00:27
575000 -- (-655.011) (-655.211) [-653.409] (-653.325) * (-655.546) [-654.769] (-656.261) (-653.723) -- 0:00:27
Average standard deviation of split frequencies: 0.009917
575500 -- (-655.965) (-653.646) [-657.528] (-656.236) * (-653.382) [-654.080] (-654.787) (-654.931) -- 0:00:27
576000 -- (-654.240) [-653.417] (-656.927) (-655.032) * [-652.930] (-655.302) (-654.689) (-654.271) -- 0:00:27
576500 -- (-660.434) [-655.550] (-654.341) (-655.453) * [-653.780] (-654.752) (-657.311) (-654.605) -- 0:00:27
577000 -- (-658.182) (-653.991) [-655.304] (-657.680) * (-655.761) (-656.921) (-656.384) [-654.791] -- 0:00:27
577500 -- (-654.113) [-657.970] (-654.177) (-655.579) * (-656.563) (-654.777) (-653.210) [-653.669] -- 0:00:27
578000 -- (-653.397) [-657.823] (-653.075) (-654.398) * (-653.630) (-656.845) [-653.899] (-655.373) -- 0:00:27
578500 -- (-657.258) (-655.403) (-653.477) [-653.129] * (-656.085) (-655.801) [-656.589] (-654.472) -- 0:00:26
579000 -- [-653.604] (-654.572) (-657.788) (-657.646) * (-656.113) [-654.510] (-653.814) (-657.522) -- 0:00:26
579500 -- (-653.761) (-653.262) (-657.187) [-655.917] * (-654.526) [-653.671] (-654.754) (-656.138) -- 0:00:26
580000 -- (-654.591) (-654.454) (-658.926) [-652.942] * (-655.390) (-654.482) [-653.099] (-653.920) -- 0:00:26
Average standard deviation of split frequencies: 0.009885
580500 -- (-653.346) (-653.722) [-654.817] (-652.947) * (-656.235) (-655.174) (-654.397) [-653.206] -- 0:00:26
581000 -- [-656.020] (-654.688) (-656.123) (-654.476) * [-654.644] (-656.694) (-654.160) (-657.495) -- 0:00:26
581500 -- (-655.110) (-654.848) (-655.425) [-655.617] * (-655.278) (-654.904) (-654.234) [-656.722] -- 0:00:26
582000 -- (-654.321) [-655.950] (-654.595) (-659.114) * (-654.085) (-654.447) [-654.401] (-655.665) -- 0:00:26
582500 -- [-654.622] (-656.618) (-654.100) (-666.036) * (-656.661) (-654.462) [-654.430] (-655.066) -- 0:00:26
583000 -- (-655.078) (-653.152) (-655.068) [-655.644] * (-654.168) (-653.171) (-658.871) [-654.176] -- 0:00:26
583500 -- (-654.456) (-653.506) [-654.677] (-654.661) * (-654.594) (-655.023) [-656.568] (-654.470) -- 0:00:26
584000 -- [-653.503] (-654.346) (-655.745) (-654.984) * (-657.709) (-653.499) (-656.741) [-652.983] -- 0:00:26
584500 -- (-653.287) (-654.549) [-655.972] (-652.790) * (-653.220) [-655.559] (-658.015) (-654.431) -- 0:00:27
585000 -- (-654.571) [-654.753] (-656.697) (-654.289) * (-654.198) (-653.740) [-653.936] (-654.121) -- 0:00:26
Average standard deviation of split frequencies: 0.009653
585500 -- [-655.143] (-657.236) (-658.949) (-657.135) * (-655.222) (-653.434) (-657.709) [-653.659] -- 0:00:26
586000 -- (-655.190) (-655.262) (-659.009) [-654.456] * (-655.614) [-652.832] (-656.056) (-653.964) -- 0:00:26
586500 -- (-654.625) (-655.529) (-654.062) [-655.834] * (-653.633) (-653.351) [-653.626] (-653.818) -- 0:00:26
587000 -- (-654.517) [-654.174] (-652.648) (-657.279) * [-652.935] (-653.203) (-654.632) (-655.107) -- 0:00:26
587500 -- (-656.142) (-655.563) (-652.743) [-653.698] * (-654.714) [-654.527] (-658.948) (-654.592) -- 0:00:26
588000 -- (-655.699) (-653.470) (-654.411) [-655.805] * (-654.847) (-654.691) (-655.546) [-656.594] -- 0:00:26
588500 -- (-656.040) [-655.139] (-654.115) (-656.626) * (-655.790) (-653.612) [-655.530] (-661.656) -- 0:00:26
589000 -- (-654.350) (-654.150) (-657.373) [-654.196] * (-655.613) [-653.399] (-654.542) (-656.537) -- 0:00:26
589500 -- [-654.289] (-654.290) (-653.011) (-655.290) * (-656.693) (-656.350) [-656.417] (-654.907) -- 0:00:26
590000 -- (-654.400) (-654.806) (-655.813) [-656.378] * (-655.042) (-654.782) [-654.957] (-654.949) -- 0:00:26
Average standard deviation of split frequencies: 0.009887
590500 -- (-656.840) [-654.261] (-654.141) (-657.587) * [-655.523] (-655.755) (-655.166) (-657.026) -- 0:00:26
591000 -- [-654.611] (-660.706) (-655.526) (-656.633) * [-655.838] (-655.066) (-654.810) (-656.887) -- 0:00:26
591500 -- (-653.825) (-655.906) [-656.944] (-656.124) * [-654.124] (-654.019) (-654.800) (-658.990) -- 0:00:26
592000 -- (-654.942) [-655.340] (-656.048) (-657.421) * (-653.560) (-653.665) (-656.686) [-655.546] -- 0:00:26
592500 -- (-652.811) [-657.140] (-656.945) (-653.442) * [-653.581] (-654.735) (-658.502) (-654.807) -- 0:00:26
593000 -- [-659.566] (-653.803) (-659.246) (-655.270) * (-653.939) (-654.442) [-656.345] (-659.060) -- 0:00:26
593500 -- (-653.988) (-654.393) [-656.121] (-657.159) * (-653.638) (-655.651) (-654.835) [-656.886] -- 0:00:26
594000 -- [-653.300] (-655.624) (-659.469) (-659.716) * (-654.056) (-653.082) (-654.760) [-655.526] -- 0:00:25
594500 -- (-657.296) (-657.605) [-656.371] (-657.574) * [-655.288] (-656.998) (-654.282) (-655.260) -- 0:00:25
595000 -- (-653.192) (-653.459) (-654.831) [-654.789] * (-656.483) (-655.072) (-653.457) [-654.009] -- 0:00:25
Average standard deviation of split frequencies: 0.010194
595500 -- (-653.188) [-654.873] (-657.464) (-657.156) * (-654.947) [-655.783] (-653.718) (-653.692) -- 0:00:25
596000 -- (-653.252) [-656.552] (-654.673) (-660.496) * (-657.345) (-655.189) (-654.090) [-653.340] -- 0:00:25
596500 -- [-655.029] (-654.119) (-654.412) (-659.790) * (-653.404) (-655.014) (-654.476) [-654.485] -- 0:00:25
597000 -- (-656.178) (-654.612) [-656.919] (-655.325) * (-653.206) (-657.326) [-653.717] (-656.163) -- 0:00:25
597500 -- (-655.855) (-654.345) (-653.579) [-657.390] * [-652.856] (-656.905) (-653.764) (-654.232) -- 0:00:25
598000 -- (-657.180) (-653.373) [-654.174] (-655.482) * (-653.366) [-656.636] (-656.280) (-654.162) -- 0:00:25
598500 -- [-658.641] (-655.319) (-655.943) (-655.031) * (-654.808) (-655.190) (-655.346) [-655.739] -- 0:00:25
599000 -- [-657.627] (-655.079) (-653.663) (-655.606) * (-654.469) (-654.951) [-656.700] (-658.908) -- 0:00:25
599500 -- (-654.421) (-656.582) (-654.756) [-652.964] * (-652.995) [-657.300] (-657.826) (-657.273) -- 0:00:26
600000 -- [-655.445] (-656.485) (-654.242) (-658.061) * (-654.734) [-654.152] (-655.836) (-655.006) -- 0:00:25
Average standard deviation of split frequencies: 0.010333
600500 -- (-653.938) (-657.832) (-656.904) [-654.740] * (-658.380) (-655.043) [-655.071] (-656.216) -- 0:00:25
601000 -- (-653.201) [-656.052] (-655.968) (-656.105) * (-653.058) [-654.083] (-656.015) (-653.492) -- 0:00:25
601500 -- [-653.250] (-655.817) (-654.557) (-654.779) * (-654.918) [-653.551] (-654.412) (-654.720) -- 0:00:25
602000 -- (-654.102) [-657.213] (-654.143) (-657.140) * (-654.275) (-655.068) [-654.818] (-653.337) -- 0:00:25
602500 -- (-654.535) [-655.799] (-653.799) (-657.701) * (-655.467) (-655.247) (-654.853) [-654.105] -- 0:00:25
603000 -- (-654.345) [-654.199] (-654.941) (-654.603) * (-657.950) (-654.212) (-654.170) [-653.294] -- 0:00:25
603500 -- [-657.934] (-657.737) (-655.452) (-654.408) * (-655.736) [-656.077] (-655.786) (-655.088) -- 0:00:25
604000 -- [-653.268] (-658.283) (-655.574) (-653.484) * (-653.329) [-654.158] (-653.998) (-657.078) -- 0:00:25
604500 -- [-654.208] (-654.386) (-656.321) (-653.384) * (-653.859) (-660.952) [-654.630] (-658.513) -- 0:00:25
605000 -- (-657.829) (-653.321) [-657.308] (-653.140) * (-656.941) (-655.399) (-654.969) [-652.722] -- 0:00:25
Average standard deviation of split frequencies: 0.009853
605500 -- [-655.026] (-653.932) (-653.143) (-653.873) * (-657.287) [-655.344] (-656.501) (-656.166) -- 0:00:25
606000 -- (-658.078) (-654.018) (-654.620) [-657.935] * [-653.004] (-657.666) (-653.827) (-656.363) -- 0:00:25
606500 -- (-652.755) (-655.931) (-654.086) [-657.407] * (-655.234) (-657.978) [-653.527] (-657.569) -- 0:00:25
607000 -- (-655.707) (-654.774) [-656.323] (-654.310) * (-655.333) (-653.132) [-653.588] (-657.107) -- 0:00:25
607500 -- (-655.827) [-658.103] (-653.579) (-657.026) * (-660.188) [-654.994] (-653.338) (-656.042) -- 0:00:25
608000 -- (-652.912) [-656.393] (-654.507) (-654.822) * (-654.148) (-654.660) [-654.839] (-655.014) -- 0:00:25
608500 -- [-653.510] (-653.798) (-655.775) (-655.573) * (-656.271) (-654.260) (-657.237) [-653.529] -- 0:00:25
609000 -- (-655.132) [-653.754] (-654.240) (-654.273) * [-654.673] (-655.825) (-661.399) (-653.098) -- 0:00:25
609500 -- (-654.663) [-653.530] (-655.296) (-653.467) * [-655.232] (-655.281) (-661.907) (-655.808) -- 0:00:24
610000 -- (-654.252) [-653.260] (-653.946) (-654.934) * (-658.052) [-654.613] (-657.406) (-655.562) -- 0:00:24
Average standard deviation of split frequencies: 0.009521
610500 -- (-654.384) [-653.417] (-655.390) (-654.922) * (-653.523) [-654.621] (-653.419) (-655.721) -- 0:00:24
611000 -- (-659.553) [-653.749] (-655.357) (-655.758) * [-654.600] (-660.080) (-653.749) (-656.780) -- 0:00:24
611500 -- (-658.305) (-655.321) [-655.941] (-658.280) * (-653.460) (-660.088) [-654.498] (-655.105) -- 0:00:24
612000 -- (-655.371) (-653.960) (-659.570) [-656.484] * (-655.074) (-657.465) [-653.490] (-655.020) -- 0:00:24
612500 -- (-653.735) (-654.176) [-654.360] (-652.809) * (-656.751) (-657.895) (-653.440) [-655.073] -- 0:00:24
613000 -- (-659.887) (-653.852) [-653.194] (-658.051) * (-654.960) [-658.234] (-654.143) (-653.269) -- 0:00:24
613500 -- [-653.869] (-654.044) (-655.160) (-658.463) * (-652.565) [-653.401] (-656.611) (-654.298) -- 0:00:24
614000 -- (-654.056) (-653.432) [-654.858] (-653.681) * (-652.679) [-656.841] (-655.030) (-655.015) -- 0:00:25
614500 -- (-654.879) (-661.308) [-654.270] (-653.306) * (-652.955) (-654.828) [-655.510] (-656.057) -- 0:00:25
615000 -- [-655.491] (-657.726) (-657.452) (-653.955) * [-656.724] (-656.565) (-654.319) (-653.993) -- 0:00:25
Average standard deviation of split frequencies: 0.009438
615500 -- (-656.440) [-656.946] (-655.049) (-657.415) * (-653.861) (-655.592) [-656.794] (-657.225) -- 0:00:24
616000 -- (-653.351) (-654.214) (-654.551) [-653.655] * [-654.979] (-658.922) (-653.621) (-655.544) -- 0:00:24
616500 -- (-654.164) [-656.529] (-655.188) (-655.656) * (-657.632) (-654.692) (-654.349) [-653.238] -- 0:00:24
617000 -- (-655.651) (-656.776) (-657.482) [-656.250] * (-657.619) [-653.033] (-655.653) (-655.784) -- 0:00:24
617500 -- (-656.425) (-653.546) (-654.871) [-655.201] * (-654.595) (-653.832) [-655.076] (-656.798) -- 0:00:24
618000 -- (-654.227) [-656.374] (-653.709) (-654.577) * [-659.283] (-653.403) (-652.853) (-655.950) -- 0:00:24
618500 -- (-655.319) (-655.295) [-654.343] (-653.211) * (-653.772) [-654.447] (-653.701) (-656.172) -- 0:00:24
619000 -- [-654.873] (-656.528) (-654.333) (-655.863) * (-656.377) (-655.638) (-655.868) [-654.647] -- 0:00:24
619500 -- (-656.023) (-655.377) (-657.722) [-653.739] * [-653.963] (-656.739) (-656.645) (-658.576) -- 0:00:24
620000 -- (-658.280) (-653.649) [-661.247] (-656.808) * (-656.254) (-653.926) (-655.292) [-657.723] -- 0:00:24
Average standard deviation of split frequencies: 0.008444
620500 -- (-653.821) [-653.375] (-654.310) (-657.242) * (-654.174) (-653.507) [-656.796] (-655.307) -- 0:00:24
621000 -- (-653.219) (-659.191) (-653.197) [-654.483] * (-654.967) [-653.791] (-654.764) (-652.686) -- 0:00:24
621500 -- (-653.989) (-656.966) (-658.033) [-655.114] * (-655.016) [-653.973] (-655.658) (-657.086) -- 0:00:24
622000 -- (-653.791) (-655.786) [-660.887] (-659.891) * [-654.153] (-655.477) (-653.783) (-654.665) -- 0:00:24
622500 -- (-654.685) (-656.398) [-661.191] (-654.205) * (-653.740) (-658.011) [-654.419] (-655.279) -- 0:00:24
623000 -- (-653.121) (-655.169) [-661.744] (-657.817) * (-656.584) (-658.582) (-654.817) [-654.915] -- 0:00:24
623500 -- (-655.427) (-656.008) (-655.052) [-655.759] * (-657.253) [-654.764] (-661.022) (-660.730) -- 0:00:24
624000 -- (-654.807) (-657.895) (-654.738) [-654.039] * (-653.866) (-655.519) (-657.875) [-654.907] -- 0:00:24
624500 -- (-656.401) (-656.102) [-653.268] (-653.605) * (-654.245) [-655.779] (-654.447) (-655.787) -- 0:00:24
625000 -- (-654.175) (-653.120) (-654.964) [-653.815] * (-653.997) [-655.701] (-657.026) (-654.211) -- 0:00:24
Average standard deviation of split frequencies: 0.009120
625500 -- (-655.085) [-654.904] (-653.265) (-655.391) * (-654.525) (-654.073) (-657.438) [-653.701] -- 0:00:23
626000 -- (-654.875) (-658.408) (-653.436) [-655.590] * (-654.714) [-655.421] (-654.281) (-655.971) -- 0:00:23
626500 -- (-654.826) [-654.090] (-652.881) (-652.952) * (-655.042) (-654.377) (-656.860) [-653.172] -- 0:00:23
627000 -- (-655.144) (-655.758) (-655.320) [-653.194] * (-653.821) (-656.176) [-658.333] (-654.681) -- 0:00:23
627500 -- [-653.830] (-655.043) (-656.411) (-654.983) * (-653.975) (-655.932) [-654.642] (-656.178) -- 0:00:23
628000 -- (-656.171) [-656.699] (-655.144) (-653.677) * [-653.213] (-657.392) (-654.972) (-658.479) -- 0:00:23
628500 -- (-656.248) (-655.918) [-653.972] (-654.767) * [-653.706] (-655.920) (-657.004) (-655.074) -- 0:00:23
629000 -- (-654.456) (-655.178) (-659.056) [-654.407] * (-657.933) (-654.647) [-654.986] (-656.924) -- 0:00:23
629500 -- [-652.926] (-653.388) (-656.906) (-652.910) * (-658.038) (-654.168) (-654.692) [-654.516] -- 0:00:24
630000 -- [-653.877] (-657.878) (-657.508) (-654.101) * [-654.330] (-655.293) (-658.193) (-653.194) -- 0:00:24
Average standard deviation of split frequencies: 0.008887
630500 -- (-656.663) [-656.175] (-655.910) (-653.121) * [-654.745] (-660.616) (-660.014) (-654.373) -- 0:00:24
631000 -- (-665.382) (-653.108) (-655.605) [-655.181] * [-653.803] (-656.888) (-654.768) (-654.164) -- 0:00:23
631500 -- (-658.331) (-656.981) [-655.423] (-655.753) * (-656.357) [-653.693] (-654.059) (-655.361) -- 0:00:23
632000 -- (-654.360) [-660.226] (-656.607) (-655.056) * (-662.777) [-653.454] (-655.979) (-656.269) -- 0:00:23
632500 -- (-653.868) (-655.825) [-655.232] (-655.648) * (-659.907) (-672.469) [-655.755] (-656.218) -- 0:00:23
633000 -- (-657.485) (-656.722) [-654.562] (-654.986) * (-653.442) [-655.871] (-655.197) (-660.962) -- 0:00:23
633500 -- [-654.121] (-655.967) (-655.442) (-657.671) * (-654.340) [-654.235] (-653.400) (-654.354) -- 0:00:23
634000 -- (-654.111) [-656.130] (-653.474) (-655.421) * (-655.028) (-655.376) [-654.542] (-663.474) -- 0:00:23
634500 -- [-653.001] (-655.032) (-653.666) (-654.780) * (-654.762) [-656.003] (-654.328) (-662.759) -- 0:00:23
635000 -- (-655.879) [-654.096] (-654.071) (-656.232) * (-652.843) (-654.024) (-658.534) [-654.007] -- 0:00:23
Average standard deviation of split frequencies: 0.008894
635500 -- [-654.345] (-656.864) (-654.223) (-652.768) * (-653.711) (-652.780) [-654.434] (-654.633) -- 0:00:23
636000 -- (-654.331) (-657.731) (-654.881) [-654.077] * (-654.167) (-654.616) [-654.296] (-654.424) -- 0:00:23
636500 -- (-655.269) (-655.812) (-657.290) [-655.512] * (-655.242) (-654.178) (-655.414) [-654.518] -- 0:00:23
637000 -- (-656.492) (-656.465) (-659.956) [-657.685] * (-658.294) (-653.536) [-655.105] (-653.603) -- 0:00:23
637500 -- (-657.186) [-654.839] (-654.554) (-654.919) * [-660.786] (-654.099) (-655.940) (-654.530) -- 0:00:23
638000 -- (-655.824) [-652.996] (-655.352) (-653.707) * (-654.404) (-656.984) [-655.026] (-654.322) -- 0:00:23
638500 -- (-654.832) [-653.352] (-654.954) (-655.163) * (-654.637) (-656.109) [-654.495] (-653.229) -- 0:00:23
639000 -- (-656.113) (-655.041) [-653.938] (-654.035) * [-656.644] (-656.214) (-654.275) (-654.228) -- 0:00:23
639500 -- (-655.935) [-654.643] (-653.164) (-653.747) * (-655.426) (-656.749) [-654.953] (-666.111) -- 0:00:23
640000 -- [-655.647] (-661.652) (-652.764) (-655.093) * (-654.918) [-653.707] (-654.913) (-656.174) -- 0:00:23
Average standard deviation of split frequencies: 0.008483
640500 -- (-654.244) (-655.704) [-653.557] (-655.359) * (-655.379) (-657.494) [-653.534] (-655.589) -- 0:00:23
641000 -- (-654.907) (-653.871) (-652.941) [-655.622] * (-654.009) [-655.740] (-653.892) (-660.401) -- 0:00:22
641500 -- (-655.748) (-654.131) [-654.817] (-655.193) * [-654.580] (-654.655) (-653.331) (-656.494) -- 0:00:22
642000 -- [-655.221] (-655.331) (-657.664) (-656.620) * (-654.079) (-658.070) [-653.931] (-656.062) -- 0:00:22
642500 -- (-655.649) [-655.514] (-655.901) (-654.400) * [-653.088] (-653.050) (-653.806) (-656.509) -- 0:00:23
643000 -- (-657.022) (-653.541) (-656.803) [-654.473] * (-652.743) (-652.854) [-657.810] (-656.765) -- 0:00:23
643500 -- (-656.048) (-653.581) [-654.333] (-654.201) * [-657.676] (-653.633) (-658.536) (-658.744) -- 0:00:23
644000 -- (-654.089) (-654.807) (-653.707) [-653.983] * [-654.857] (-658.566) (-653.827) (-653.121) -- 0:00:23
644500 -- (-656.678) (-654.747) (-654.019) [-655.503] * (-656.659) (-656.742) [-653.046] (-655.149) -- 0:00:23
645000 -- (-656.713) [-656.534] (-653.980) (-654.680) * [-660.853] (-654.553) (-657.931) (-653.247) -- 0:00:23
Average standard deviation of split frequencies: 0.008370
645500 -- (-653.781) [-653.460] (-658.835) (-655.723) * (-656.354) [-657.329] (-655.962) (-654.967) -- 0:00:23
646000 -- (-655.218) (-653.744) [-654.451] (-657.897) * (-655.047) (-655.463) (-656.866) [-654.584] -- 0:00:23
646500 -- (-656.599) [-654.462] (-660.014) (-656.502) * (-656.626) (-656.043) (-658.517) [-658.099] -- 0:00:22
647000 -- (-656.286) (-656.202) [-653.873] (-654.768) * (-653.794) (-657.462) (-659.943) [-653.760] -- 0:00:22
647500 -- [-655.167] (-656.357) (-654.609) (-653.456) * (-657.818) (-655.609) [-655.155] (-653.384) -- 0:00:22
648000 -- [-656.143] (-654.873) (-656.277) (-659.719) * (-657.698) (-654.821) (-654.768) [-653.550] -- 0:00:22
648500 -- (-654.276) (-656.487) (-657.272) [-653.701] * (-656.003) (-656.723) [-652.773] (-654.735) -- 0:00:22
649000 -- [-654.147] (-654.141) (-653.936) (-653.985) * [-654.015] (-655.426) (-659.718) (-653.756) -- 0:00:22
649500 -- (-654.039) (-654.913) [-653.445] (-653.971) * (-655.947) (-659.395) [-653.701] (-654.275) -- 0:00:22
650000 -- (-654.496) (-654.090) [-654.004] (-654.565) * (-655.718) (-654.157) [-655.072] (-657.064) -- 0:00:22
Average standard deviation of split frequencies: 0.008183
650500 -- (-655.877) (-654.747) [-654.864] (-653.667) * [-656.514] (-654.680) (-653.296) (-655.796) -- 0:00:22
651000 -- (-657.167) (-654.406) (-655.924) [-654.972] * [-655.317] (-654.190) (-654.386) (-654.075) -- 0:00:22
651500 -- (-656.113) (-655.731) (-655.277) [-654.559] * (-654.877) (-655.256) (-656.162) [-654.434] -- 0:00:22
652000 -- (-654.617) (-655.643) [-654.602] (-655.047) * [-653.476] (-654.255) (-655.771) (-653.346) -- 0:00:22
652500 -- (-653.964) (-655.820) (-656.101) [-656.971] * [-652.972] (-654.364) (-654.686) (-655.400) -- 0:00:22
653000 -- (-656.862) [-653.826] (-656.383) (-658.432) * (-654.280) [-654.219] (-653.992) (-655.741) -- 0:00:22
653500 -- (-655.490) (-658.249) [-653.974] (-655.879) * (-655.357) (-655.220) [-654.580] (-654.976) -- 0:00:22
654000 -- (-655.475) (-655.960) [-653.674] (-653.970) * [-659.785] (-652.838) (-653.174) (-653.900) -- 0:00:22
654500 -- (-652.970) [-653.520] (-654.735) (-657.907) * (-654.584) (-652.938) (-655.133) [-656.003] -- 0:00:22
655000 -- (-653.028) (-654.625) [-656.616] (-655.761) * (-654.054) [-656.095] (-655.654) (-653.056) -- 0:00:22
Average standard deviation of split frequencies: 0.008370
655500 -- (-653.083) [-654.247] (-657.109) (-653.865) * (-656.133) (-655.450) [-653.663] (-656.614) -- 0:00:22
656000 -- (-654.845) [-652.922] (-657.922) (-653.337) * (-653.587) (-654.909) (-653.633) [-654.136] -- 0:00:22
656500 -- (-654.525) [-653.231] (-657.035) (-654.683) * (-656.842) (-656.284) [-653.685] (-656.312) -- 0:00:22
657000 -- (-653.529) (-654.721) [-656.081] (-655.005) * (-657.083) [-653.304] (-655.185) (-655.906) -- 0:00:22
657500 -- [-652.833] (-657.243) (-657.608) (-656.879) * (-653.952) (-653.137) [-654.289] (-654.550) -- 0:00:22
658000 -- (-653.211) (-654.891) [-653.213] (-654.663) * (-658.549) [-656.808] (-653.923) (-653.279) -- 0:00:22
658500 -- (-653.213) (-654.925) [-653.455] (-654.335) * (-653.382) (-655.819) [-653.329] (-653.512) -- 0:00:22
659000 -- (-652.511) (-653.980) [-654.505] (-654.500) * [-658.807] (-655.788) (-653.255) (-658.005) -- 0:00:22
659500 -- (-655.632) [-654.626] (-652.803) (-656.065) * [-657.178] (-655.959) (-653.404) (-656.520) -- 0:00:22
660000 -- (-657.593) [-654.501] (-653.830) (-655.466) * (-658.187) [-655.968] (-653.663) (-656.437) -- 0:00:22
Average standard deviation of split frequencies: 0.008520
660500 -- (-657.019) (-652.996) (-654.771) [-659.846] * (-659.301) [-655.422] (-654.940) (-655.071) -- 0:00:22
661000 -- (-654.739) (-653.335) (-654.933) [-657.507] * (-654.720) [-657.063] (-658.956) (-655.038) -- 0:00:22
661500 -- [-652.857] (-659.844) (-656.184) (-660.194) * (-656.628) [-654.730] (-656.858) (-655.382) -- 0:00:22
662000 -- [-654.501] (-657.011) (-656.437) (-655.744) * (-655.593) (-655.185) [-653.528] (-655.560) -- 0:00:21
662500 -- [-656.239] (-653.408) (-653.305) (-660.990) * (-654.107) (-654.588) (-655.036) [-655.509] -- 0:00:21
663000 -- (-654.332) (-656.634) (-656.964) [-654.599] * [-654.928] (-652.917) (-654.910) (-656.345) -- 0:00:21
663500 -- (-654.042) (-654.812) [-656.940] (-655.494) * [-654.421] (-655.434) (-655.517) (-656.382) -- 0:00:21
664000 -- (-653.377) (-658.693) [-655.088] (-655.503) * (-657.024) [-653.338] (-658.136) (-660.155) -- 0:00:21
664500 -- [-655.077] (-659.948) (-654.361) (-656.532) * [-654.147] (-655.568) (-654.571) (-657.396) -- 0:00:21
665000 -- (-656.862) (-654.519) [-654.375] (-659.419) * (-654.662) (-659.624) [-655.978] (-654.665) -- 0:00:21
Average standard deviation of split frequencies: 0.008993
665500 -- (-653.179) [-654.480] (-655.978) (-656.104) * [-654.250] (-656.381) (-655.086) (-654.312) -- 0:00:21
666000 -- (-656.896) (-656.072) (-655.420) [-656.964] * [-653.168] (-655.797) (-654.190) (-654.614) -- 0:00:21
666500 -- (-654.779) [-652.852] (-653.208) (-655.918) * (-653.141) (-658.150) [-654.426] (-653.460) -- 0:00:21
667000 -- (-655.526) (-653.340) (-656.762) [-654.529] * [-653.236] (-654.431) (-655.695) (-655.290) -- 0:00:21
667500 -- (-655.014) (-655.478) [-655.529] (-654.334) * (-654.658) [-655.754] (-654.205) (-655.361) -- 0:00:21
668000 -- (-655.971) (-653.397) (-654.229) [-654.211] * (-654.258) [-655.669] (-654.824) (-655.409) -- 0:00:21
668500 -- (-657.533) (-654.866) [-653.876] (-654.135) * (-654.069) [-653.444] (-655.313) (-652.969) -- 0:00:21
669000 -- (-655.313) (-658.420) [-654.790] (-655.144) * (-654.371) [-654.618] (-654.914) (-653.118) -- 0:00:21
669500 -- (-655.701) (-655.634) [-656.018] (-653.814) * (-655.167) (-653.886) [-654.267] (-653.856) -- 0:00:21
670000 -- (-657.026) (-655.420) (-658.351) [-654.564] * [-657.941] (-655.190) (-654.764) (-653.857) -- 0:00:21
Average standard deviation of split frequencies: 0.008931
670500 -- (-654.034) (-657.703) [-653.319] (-653.786) * (-653.451) [-657.272] (-654.463) (-655.067) -- 0:00:21
671000 -- (-654.860) (-653.287) (-653.175) [-654.188] * (-655.747) (-652.717) (-655.909) [-653.623] -- 0:00:21
671500 -- (-654.271) [-656.669] (-656.535) (-654.404) * (-660.343) (-652.629) [-654.501] (-656.483) -- 0:00:21
672000 -- (-653.804) [-653.975] (-661.989) (-657.208) * (-655.571) [-658.273] (-654.314) (-659.020) -- 0:00:21
672500 -- (-653.983) (-655.855) (-656.635) [-655.877] * [-654.795] (-659.460) (-654.049) (-656.491) -- 0:00:21
673000 -- [-653.884] (-657.890) (-653.590) (-655.399) * [-656.482] (-664.458) (-653.946) (-653.670) -- 0:00:21
673500 -- [-654.294] (-657.103) (-653.145) (-653.583) * (-657.548) (-656.068) [-655.734] (-656.652) -- 0:00:21
674000 -- [-655.044] (-654.165) (-654.951) (-656.170) * [-655.884] (-655.814) (-655.275) (-655.163) -- 0:00:21
674500 -- (-656.215) [-654.992] (-655.516) (-653.602) * (-659.077) (-653.631) (-654.595) [-653.365] -- 0:00:21
675000 -- [-654.411] (-659.304) (-654.670) (-654.420) * (-656.487) (-654.902) [-656.811] (-657.684) -- 0:00:21
Average standard deviation of split frequencies: 0.008860
675500 -- (-654.930) (-659.947) (-657.262) [-655.948] * (-654.917) (-656.662) [-654.908] (-653.601) -- 0:00:21
676000 -- (-657.070) [-653.793] (-655.045) (-658.575) * (-655.044) (-653.785) [-655.718] (-653.774) -- 0:00:21
676500 -- (-653.159) [-653.659] (-654.200) (-653.781) * (-654.284) [-653.233] (-656.502) (-656.756) -- 0:00:21
677000 -- (-655.980) [-655.028] (-655.065) (-657.694) * [-656.925] (-655.875) (-652.876) (-655.785) -- 0:00:20
677500 -- (-657.372) (-659.389) (-655.797) [-656.365] * (-653.678) (-660.148) [-658.660] (-655.972) -- 0:00:20
678000 -- (-654.927) [-654.239] (-653.384) (-653.147) * (-655.726) (-655.938) (-666.476) [-657.401] -- 0:00:20
678500 -- (-656.225) [-655.554] (-655.304) (-658.524) * (-656.231) [-655.084] (-654.729) (-656.222) -- 0:00:20
679000 -- [-657.116] (-653.153) (-656.642) (-654.505) * (-659.636) (-653.500) [-653.621] (-655.494) -- 0:00:20
679500 -- [-653.646] (-652.867) (-654.446) (-658.517) * (-659.668) (-656.567) [-653.162] (-654.448) -- 0:00:20
680000 -- [-653.655] (-655.323) (-654.397) (-654.551) * (-654.334) (-655.298) (-653.275) [-656.177] -- 0:00:20
Average standard deviation of split frequencies: 0.009003
680500 -- (-656.391) (-652.965) [-653.534] (-654.041) * [-653.200] (-656.842) (-654.052) (-654.316) -- 0:00:20
681000 -- (-653.069) [-652.882] (-654.071) (-653.982) * (-657.076) (-655.466) [-657.782] (-654.592) -- 0:00:20
681500 -- (-654.095) [-655.089] (-653.460) (-654.395) * (-659.768) (-654.748) (-655.695) [-655.635] -- 0:00:20
682000 -- (-654.891) (-656.489) (-653.167) [-652.882] * [-654.284] (-654.169) (-654.583) (-653.626) -- 0:00:20
682500 -- (-656.349) (-652.858) [-655.075] (-656.873) * (-658.124) (-652.909) (-654.526) [-656.123] -- 0:00:20
683000 -- (-656.475) [-653.913] (-653.872) (-655.118) * (-653.326) (-653.138) (-654.497) [-653.933] -- 0:00:20
683500 -- (-656.426) (-653.212) (-656.272) [-654.806] * (-655.550) (-657.155) [-653.945] (-654.465) -- 0:00:20
684000 -- (-653.204) (-658.444) (-652.920) [-655.034] * (-655.370) (-660.235) [-655.342] (-654.532) -- 0:00:20
684500 -- [-653.844] (-657.185) (-660.723) (-655.925) * (-656.616) (-658.805) (-660.051) [-653.721] -- 0:00:20
685000 -- (-653.443) (-655.144) [-653.397] (-653.411) * [-654.055] (-653.630) (-658.698) (-654.086) -- 0:00:20
Average standard deviation of split frequencies: 0.009257
685500 -- (-654.818) [-654.456] (-653.009) (-656.308) * [-654.565] (-654.053) (-656.112) (-655.244) -- 0:00:20
686000 -- (-654.534) [-653.942] (-655.090) (-657.424) * [-656.208] (-654.208) (-653.690) (-654.373) -- 0:00:20
686500 -- (-657.109) (-655.185) [-654.299] (-654.669) * (-654.146) (-653.648) (-655.714) [-655.428] -- 0:00:20
687000 -- (-653.561) (-654.296) (-659.466) [-653.246] * (-655.330) (-655.460) [-654.308] (-656.510) -- 0:00:20
687500 -- [-655.897] (-657.448) (-661.228) (-653.057) * [-653.504] (-654.529) (-653.862) (-652.925) -- 0:00:20
688000 -- [-654.058] (-653.511) (-653.415) (-655.157) * (-654.504) [-653.772] (-655.845) (-655.060) -- 0:00:20
688500 -- (-657.672) [-653.625] (-653.555) (-654.147) * (-657.122) (-653.692) [-653.521] (-654.459) -- 0:00:20
689000 -- (-654.815) [-655.183] (-657.004) (-657.559) * (-660.968) (-655.158) [-654.760] (-654.307) -- 0:00:20
689500 -- [-656.003] (-656.206) (-653.486) (-656.235) * [-655.987] (-658.343) (-655.397) (-654.956) -- 0:00:20
690000 -- [-653.059] (-655.341) (-655.915) (-659.132) * (-653.783) (-656.870) [-654.758] (-654.125) -- 0:00:20
Average standard deviation of split frequencies: 0.009796
690500 -- (-653.297) (-655.299) [-656.588] (-663.461) * (-653.516) (-656.789) [-655.767] (-653.198) -- 0:00:20
691000 -- (-655.825) (-656.887) [-654.434] (-657.322) * [-657.789] (-654.936) (-658.005) (-655.150) -- 0:00:20
691500 -- (-658.287) (-657.281) [-658.612] (-654.473) * (-654.506) [-653.916] (-653.818) (-654.973) -- 0:00:20
692000 -- (-654.248) [-654.681] (-658.561) (-655.015) * (-653.052) (-658.033) [-655.391] (-654.733) -- 0:00:20
692500 -- (-654.511) (-659.016) [-656.916] (-654.999) * (-659.445) (-655.796) (-656.643) [-654.596] -- 0:00:19
693000 -- (-657.727) [-655.853] (-655.801) (-661.166) * [-653.808] (-655.652) (-654.551) (-656.249) -- 0:00:19
693500 -- (-656.296) (-660.649) [-655.728] (-654.758) * (-653.454) [-655.263] (-656.042) (-655.026) -- 0:00:19
694000 -- [-655.213] (-654.841) (-655.608) (-655.310) * [-655.100] (-659.017) (-661.333) (-653.745) -- 0:00:19
694500 -- (-653.719) (-653.952) [-654.951] (-656.448) * (-655.402) (-660.313) (-657.652) [-657.559] -- 0:00:19
695000 -- (-654.923) [-654.454] (-655.763) (-655.037) * [-655.819] (-655.186) (-656.223) (-653.596) -- 0:00:19
Average standard deviation of split frequencies: 0.009084
695500 -- (-653.941) [-653.128] (-655.630) (-656.431) * [-655.793] (-655.991) (-656.797) (-653.192) -- 0:00:19
696000 -- (-654.731) (-658.265) [-657.420] (-655.072) * [-654.097] (-655.744) (-659.619) (-654.302) -- 0:00:19
696500 -- (-654.910) (-655.492) [-654.704] (-654.093) * (-653.896) [-654.962] (-655.197) (-656.118) -- 0:00:19
697000 -- (-658.489) (-654.157) [-657.990] (-653.903) * (-653.487) (-655.883) (-653.619) [-653.206] -- 0:00:19
697500 -- (-658.958) (-655.939) [-654.580] (-653.644) * (-655.919) (-660.610) (-653.410) [-655.225] -- 0:00:19
698000 -- [-655.024] (-655.593) (-655.275) (-653.441) * (-656.743) (-661.937) [-657.535] (-655.875) -- 0:00:19
698500 -- (-656.091) (-654.974) [-653.746] (-654.637) * (-658.814) (-653.986) [-655.909] (-654.413) -- 0:00:19
699000 -- [-653.312] (-655.766) (-656.330) (-656.877) * [-653.910] (-658.616) (-653.211) (-655.984) -- 0:00:19
699500 -- (-654.919) (-654.941) (-656.312) [-653.688] * (-656.024) [-657.441] (-655.254) (-655.727) -- 0:00:19
700000 -- (-654.053) [-654.200] (-654.725) (-655.832) * (-653.360) [-657.414] (-653.962) (-655.484) -- 0:00:19
Average standard deviation of split frequencies: 0.008430
700500 -- [-653.757] (-656.282) (-654.021) (-656.456) * [-653.100] (-659.429) (-656.844) (-654.329) -- 0:00:19
701000 -- [-654.099] (-656.758) (-654.766) (-654.528) * (-656.591) [-653.443] (-652.693) (-655.075) -- 0:00:19
701500 -- (-656.060) (-654.956) (-655.430) [-655.871] * (-659.442) (-653.550) (-653.651) [-655.233] -- 0:00:19
702000 -- (-655.523) (-657.987) (-653.705) [-655.530] * (-659.864) (-652.832) (-653.994) [-653.581] -- 0:00:19
702500 -- [-655.625] (-656.711) (-655.363) (-656.604) * [-655.891] (-652.746) (-657.189) (-653.543) -- 0:00:19
703000 -- (-655.502) (-653.026) [-654.899] (-654.275) * (-653.745) (-653.988) (-653.301) [-653.775] -- 0:00:19
703500 -- (-654.777) (-656.695) [-654.505] (-653.048) * (-655.936) (-653.826) [-654.313] (-653.859) -- 0:00:19
704000 -- (-660.166) (-656.107) [-653.409] (-657.481) * [-653.618] (-654.196) (-654.819) (-655.414) -- 0:00:19
704500 -- [-655.031] (-653.808) (-655.348) (-655.254) * (-654.537) (-655.399) [-655.423] (-654.742) -- 0:00:19
705000 -- (-657.129) (-654.517) [-657.444] (-654.911) * (-653.933) [-657.136] (-653.153) (-655.506) -- 0:00:19
Average standard deviation of split frequencies: 0.008903
705500 -- (-656.219) (-655.661) [-653.496] (-657.634) * (-659.362) (-655.149) [-654.399] (-659.014) -- 0:00:19
706000 -- [-653.443] (-655.381) (-655.170) (-656.136) * (-653.127) (-656.694) (-657.586) [-653.222] -- 0:00:19
706500 -- (-658.508) [-655.239] (-655.436) (-656.070) * (-653.844) (-654.239) (-654.981) [-655.317] -- 0:00:19
707000 -- (-656.478) (-655.189) [-655.064] (-653.898) * [-654.905] (-653.042) (-655.104) (-655.857) -- 0:00:19
707500 -- (-657.787) [-653.747] (-654.387) (-653.355) * (-654.472) [-653.043] (-653.706) (-655.402) -- 0:00:19
708000 -- [-657.072] (-655.503) (-656.329) (-657.268) * (-655.943) (-653.227) [-653.361] (-657.830) -- 0:00:18
708500 -- (-655.363) (-653.628) (-657.715) [-655.633] * (-656.619) (-656.299) (-652.909) [-656.799] -- 0:00:18
709000 -- (-658.942) [-654.403] (-656.668) (-659.474) * (-655.188) (-655.766) [-652.932] (-655.350) -- 0:00:18
709500 -- [-654.289] (-655.984) (-655.400) (-657.884) * [-654.004] (-654.784) (-659.386) (-653.178) -- 0:00:18
710000 -- [-654.776] (-653.357) (-656.093) (-655.330) * (-653.660) (-657.729) [-660.285] (-654.871) -- 0:00:18
Average standard deviation of split frequencies: 0.009029
710500 -- (-656.636) [-658.510] (-655.763) (-661.184) * (-655.987) [-654.355] (-654.887) (-653.422) -- 0:00:18
711000 -- (-655.174) (-657.382) [-654.742] (-653.360) * [-657.219] (-654.414) (-653.842) (-654.077) -- 0:00:18
711500 -- (-653.665) (-658.514) [-658.221] (-660.325) * (-659.935) [-653.823] (-653.148) (-655.049) -- 0:00:18
712000 -- (-657.207) [-655.310] (-654.842) (-661.722) * (-658.946) (-653.538) (-655.515) [-656.126] -- 0:00:18
712500 -- (-655.256) [-653.253] (-658.829) (-655.911) * (-653.297) [-656.779] (-654.277) (-653.301) -- 0:00:18
713000 -- (-656.817) (-654.976) (-653.565) [-655.964] * (-656.389) [-656.244] (-653.477) (-653.637) -- 0:00:18
713500 -- (-654.545) (-654.015) (-659.573) [-657.585] * (-658.517) (-656.421) [-654.257] (-655.002) -- 0:00:18
714000 -- (-659.413) (-653.313) (-656.682) [-653.950] * (-654.133) (-653.883) [-653.529] (-653.992) -- 0:00:18
714500 -- (-657.700) [-653.616] (-655.243) (-654.033) * (-657.298) (-658.012) [-653.790] (-655.075) -- 0:00:18
715000 -- (-654.132) (-656.338) (-654.565) [-653.213] * (-655.619) (-656.705) [-654.430] (-655.330) -- 0:00:18
Average standard deviation of split frequencies: 0.008888
715500 -- (-655.764) (-655.795) (-656.343) [-654.710] * (-653.758) [-654.269] (-654.978) (-658.443) -- 0:00:18
716000 -- (-656.690) (-654.076) [-658.142] (-656.367) * (-655.028) (-654.572) [-653.157] (-657.458) -- 0:00:18
716500 -- (-657.518) (-652.619) (-659.076) [-653.631] * [-653.456] (-656.490) (-655.061) (-653.725) -- 0:00:18
717000 -- (-656.184) (-658.420) [-658.642] (-654.626) * (-655.800) (-655.905) (-653.726) [-657.239] -- 0:00:18
717500 -- (-655.262) (-656.908) [-657.751] (-654.614) * (-653.854) [-655.970] (-655.507) (-653.918) -- 0:00:18
718000 -- [-653.195] (-659.994) (-655.164) (-652.921) * (-657.406) (-654.445) (-654.535) [-653.780] -- 0:00:18
718500 -- (-653.121) [-656.852] (-654.445) (-652.887) * (-655.187) (-657.930) [-654.249] (-655.808) -- 0:00:18
719000 -- (-654.315) (-653.848) [-654.643] (-657.997) * (-653.016) [-653.280] (-653.700) (-653.225) -- 0:00:18
719500 -- (-653.092) (-654.541) [-653.580] (-653.519) * [-654.458] (-654.806) (-655.214) (-656.733) -- 0:00:18
720000 -- (-654.477) (-655.988) [-653.495] (-653.227) * (-657.187) [-655.286] (-656.891) (-656.029) -- 0:00:18
Average standard deviation of split frequencies: 0.008273
720500 -- [-654.200] (-653.827) (-655.912) (-656.453) * (-653.329) (-654.774) (-657.212) [-656.256] -- 0:00:18
721000 -- (-654.613) [-655.749] (-653.179) (-655.345) * (-654.406) [-656.325] (-656.305) (-654.218) -- 0:00:18
721500 -- (-654.475) (-655.919) [-656.239] (-658.958) * (-655.123) (-658.673) (-655.917) [-656.762] -- 0:00:18
722000 -- (-655.757) (-656.521) [-653.451] (-653.331) * [-655.612] (-658.459) (-654.637) (-654.248) -- 0:00:18
722500 -- [-656.865] (-657.341) (-653.066) (-654.820) * (-655.176) (-657.962) [-654.371] (-653.758) -- 0:00:18
723000 -- (-659.682) (-657.843) (-654.804) [-653.627] * (-654.787) (-654.699) (-653.871) [-657.503] -- 0:00:18
723500 -- (-654.353) [-656.723] (-656.331) (-655.822) * (-656.966) (-655.403) [-654.790] (-659.139) -- 0:00:17
724000 -- (-660.291) [-655.802] (-656.749) (-656.760) * (-654.734) (-655.956) [-653.032] (-656.117) -- 0:00:17
724500 -- (-657.759) (-655.121) (-655.622) [-655.208] * (-654.565) [-655.048] (-653.576) (-656.550) -- 0:00:17
725000 -- (-655.540) (-654.574) [-658.682] (-654.264) * (-654.837) (-654.932) (-656.753) [-653.812] -- 0:00:17
Average standard deviation of split frequencies: 0.008982
725500 -- (-655.850) (-653.286) [-653.733] (-653.354) * (-657.203) (-660.412) [-653.184] (-655.547) -- 0:00:17
726000 -- (-656.623) (-653.642) [-653.386] (-654.446) * (-653.788) (-658.017) (-658.174) [-654.358] -- 0:00:17
726500 -- [-653.810] (-655.307) (-656.039) (-654.059) * (-655.389) (-661.454) (-655.637) [-657.034] -- 0:00:17
727000 -- [-654.079] (-655.984) (-656.331) (-655.065) * (-654.277) (-652.758) [-654.169] (-658.587) -- 0:00:17
727500 -- [-654.064] (-657.560) (-655.427) (-655.260) * (-653.947) (-655.394) [-653.246] (-657.459) -- 0:00:17
728000 -- (-660.138) (-654.809) [-656.300] (-656.880) * (-654.245) (-653.545) [-655.821] (-654.553) -- 0:00:17
728500 -- (-657.688) [-652.824] (-655.584) (-657.022) * (-658.905) (-654.973) (-657.891) [-655.515] -- 0:00:17
729000 -- [-653.161] (-653.952) (-655.064) (-654.691) * [-655.414] (-653.175) (-656.770) (-654.612) -- 0:00:17
729500 -- (-654.204) (-653.503) (-654.606) [-656.511] * [-653.256] (-653.644) (-656.686) (-655.660) -- 0:00:17
730000 -- (-655.470) [-655.238] (-657.320) (-654.461) * (-655.444) (-652.883) (-654.731) [-654.059] -- 0:00:17
Average standard deviation of split frequencies: 0.009068
730500 -- (-654.843) (-655.840) (-653.287) [-654.711] * (-653.660) (-653.492) [-656.027] (-655.678) -- 0:00:17
731000 -- (-654.918) (-653.288) (-654.986) [-653.861] * (-654.106) [-655.885] (-656.136) (-653.865) -- 0:00:17
731500 -- [-656.399] (-654.408) (-658.335) (-654.032) * (-655.324) (-654.554) (-655.041) [-654.962] -- 0:00:17
732000 -- (-654.437) [-654.107] (-655.822) (-653.927) * (-652.740) [-653.589] (-655.180) (-654.126) -- 0:00:17
732500 -- (-654.246) (-657.386) [-655.730] (-653.923) * (-654.587) (-654.298) (-656.084) [-653.382] -- 0:00:17
733000 -- (-655.033) [-655.477] (-655.259) (-652.811) * (-653.355) (-656.812) (-654.176) [-657.154] -- 0:00:17
733500 -- [-653.508] (-653.179) (-655.458) (-655.061) * (-653.775) [-655.747] (-653.170) (-659.151) -- 0:00:17
734000 -- (-655.293) [-653.618] (-655.150) (-655.579) * (-654.457) (-654.562) (-656.775) [-654.361] -- 0:00:17
734500 -- [-656.928] (-655.601) (-653.594) (-653.788) * [-653.735] (-657.646) (-655.861) (-655.073) -- 0:00:17
735000 -- (-656.393) [-656.000] (-653.578) (-653.444) * [-653.909] (-655.135) (-652.960) (-658.395) -- 0:00:17
Average standard deviation of split frequencies: 0.009430
735500 -- (-654.011) (-658.264) (-659.335) [-654.078] * (-654.819) (-655.353) (-653.365) [-655.035] -- 0:00:17
736000 -- (-655.432) (-655.120) (-657.202) [-653.194] * (-655.930) [-656.851] (-655.516) (-653.881) -- 0:00:17
736500 -- (-655.560) (-656.007) (-659.888) [-655.411] * (-655.128) (-655.072) (-656.498) [-654.029] -- 0:00:17
737000 -- (-654.657) [-653.816] (-655.516) (-656.961) * (-655.758) [-654.979] (-653.857) (-654.416) -- 0:00:17
737500 -- (-655.578) (-654.124) [-657.532] (-653.051) * [-654.139] (-655.527) (-653.329) (-653.532) -- 0:00:17
738000 -- (-655.082) [-653.523] (-659.544) (-654.705) * (-654.429) (-659.351) [-655.144] (-656.104) -- 0:00:17
738500 -- (-656.219) (-658.491) [-656.015] (-656.672) * (-658.839) (-653.594) [-654.311] (-652.567) -- 0:00:16
739000 -- [-656.501] (-656.917) (-654.575) (-654.389) * [-654.605] (-654.346) (-653.420) (-655.014) -- 0:00:16
739500 -- (-656.190) (-653.958) (-653.582) [-655.650] * (-657.072) (-654.162) [-653.322] (-655.385) -- 0:00:16
740000 -- (-656.013) (-655.366) (-653.887) [-654.668] * (-656.289) (-657.661) [-653.188] (-654.054) -- 0:00:16
Average standard deviation of split frequencies: 0.009547
740500 -- (-655.288) [-653.462] (-653.896) (-655.908) * (-656.368) (-657.388) (-653.779) [-655.515] -- 0:00:16
741000 -- (-656.136) (-654.130) [-654.792] (-657.081) * (-656.466) (-653.380) [-652.916] (-657.050) -- 0:00:16
741500 -- (-653.700) (-654.073) (-654.873) [-655.810] * (-656.557) [-653.346] (-653.136) (-658.465) -- 0:00:16
742000 -- [-654.283] (-657.207) (-653.358) (-653.969) * (-655.524) [-654.761] (-653.531) (-654.858) -- 0:00:16
742500 -- (-654.854) (-657.161) (-654.998) [-653.399] * (-655.108) (-654.271) (-660.428) [-655.862] -- 0:00:16
743000 -- [-653.432] (-657.914) (-659.864) (-658.209) * [-654.919] (-661.861) (-656.711) (-656.168) -- 0:00:16
743500 -- [-655.618] (-663.005) (-656.247) (-657.958) * (-655.722) (-660.358) (-658.840) [-653.186] -- 0:00:16
744000 -- (-653.731) (-655.631) (-656.125) [-654.593] * (-657.105) (-655.382) [-654.934] (-654.667) -- 0:00:16
744500 -- (-654.745) (-657.223) (-656.304) [-654.593] * (-652.697) [-654.059] (-653.654) (-655.113) -- 0:00:16
745000 -- (-654.154) [-660.622] (-657.604) (-655.196) * [-653.371] (-654.870) (-653.640) (-655.636) -- 0:00:16
Average standard deviation of split frequencies: 0.009830
745500 -- (-655.198) [-653.854] (-654.192) (-653.792) * [-655.066] (-655.621) (-655.811) (-659.333) -- 0:00:16
746000 -- (-654.361) [-655.105] (-653.849) (-658.013) * (-655.108) [-658.002] (-656.608) (-656.776) -- 0:00:16
746500 -- (-653.470) [-655.896] (-655.110) (-653.339) * (-655.163) (-657.611) [-655.736] (-655.134) -- 0:00:16
747000 -- (-655.000) [-654.286] (-654.432) (-656.022) * [-656.196] (-655.071) (-658.388) (-656.917) -- 0:00:16
747500 -- [-655.061] (-653.873) (-654.507) (-653.387) * (-654.059) (-657.607) (-654.688) [-655.755] -- 0:00:16
748000 -- [-656.774] (-655.295) (-655.791) (-653.025) * [-654.024] (-655.948) (-654.191) (-654.310) -- 0:00:16
748500 -- (-657.100) (-653.236) [-654.262] (-654.822) * (-654.187) [-654.197] (-653.920) (-657.398) -- 0:00:16
749000 -- (-657.483) (-654.301) (-654.334) [-653.571] * (-653.424) (-654.068) (-654.947) [-654.106] -- 0:00:16
749500 -- [-658.585] (-652.784) (-653.706) (-657.787) * (-656.156) (-656.133) (-653.240) [-653.230] -- 0:00:16
750000 -- (-655.510) (-653.203) (-656.796) [-653.226] * (-656.986) [-654.647] (-655.311) (-654.849) -- 0:00:16
Average standard deviation of split frequencies: 0.009908
750500 -- (-656.002) [-653.740] (-656.111) (-656.353) * (-655.976) (-653.945) [-653.907] (-657.572) -- 0:00:16
751000 -- (-654.745) [-655.845] (-657.075) (-657.074) * (-653.910) (-654.120) [-655.539] (-655.087) -- 0:00:16
751500 -- (-655.189) (-653.116) (-655.060) [-653.856] * (-652.839) (-653.405) [-654.491] (-655.348) -- 0:00:16
752000 -- (-653.299) (-658.795) (-655.275) [-653.948] * (-656.007) (-658.006) (-655.826) [-655.289] -- 0:00:16
752500 -- (-655.438) (-656.517) (-653.407) [-655.582] * (-655.567) [-655.400] (-655.080) (-656.326) -- 0:00:16
753000 -- (-654.905) (-657.234) [-654.661] (-653.855) * (-657.214) (-655.109) (-655.403) [-655.971] -- 0:00:16
753500 -- (-653.197) [-652.903] (-657.258) (-652.943) * (-657.769) [-654.370] (-655.456) (-653.214) -- 0:00:16
754000 -- (-654.562) (-653.735) (-655.611) [-653.319] * (-654.903) (-653.177) [-653.829] (-661.054) -- 0:00:15
754500 -- (-653.474) [-655.254] (-654.448) (-654.852) * (-657.138) (-653.341) [-657.206] (-654.716) -- 0:00:15
755000 -- (-654.433) [-654.177] (-656.277) (-658.664) * (-658.154) (-653.679) (-655.935) [-653.515] -- 0:00:15
Average standard deviation of split frequencies: 0.009492
755500 -- (-654.013) (-657.582) [-655.810] (-661.251) * [-657.372] (-652.676) (-656.039) (-654.086) -- 0:00:15
756000 -- (-654.923) (-656.621) [-656.061] (-654.143) * (-654.563) (-654.062) [-653.863] (-655.550) -- 0:00:15
756500 -- (-653.577) (-653.067) (-662.970) [-652.925] * (-654.049) (-654.169) [-654.502] (-653.855) -- 0:00:15
757000 -- [-653.515] (-654.879) (-657.078) (-657.599) * (-654.992) (-654.417) [-653.488] (-655.170) -- 0:00:15
757500 -- (-654.424) [-656.623] (-654.045) (-657.593) * (-658.514) [-655.312] (-653.663) (-659.123) -- 0:00:15
758000 -- [-657.522] (-655.634) (-655.013) (-654.657) * (-657.106) (-656.306) [-653.991] (-660.206) -- 0:00:15
758500 -- [-654.493] (-655.163) (-654.585) (-657.745) * [-655.261] (-656.668) (-655.566) (-654.067) -- 0:00:15
759000 -- (-656.969) [-653.976] (-654.169) (-653.796) * (-653.770) [-655.258] (-654.327) (-653.512) -- 0:00:15
759500 -- (-655.366) [-655.286] (-655.668) (-657.408) * [-653.462] (-662.314) (-655.659) (-655.887) -- 0:00:15
760000 -- [-655.554] (-655.210) (-653.801) (-659.620) * (-654.486) [-653.495] (-653.311) (-657.401) -- 0:00:15
Average standard deviation of split frequencies: 0.009399
760500 -- (-656.496) [-654.909] (-657.256) (-653.413) * [-655.023] (-655.227) (-653.493) (-654.965) -- 0:00:15
761000 -- [-654.722] (-656.837) (-658.327) (-655.182) * (-654.747) [-654.187] (-656.190) (-655.128) -- 0:00:15
761500 -- (-654.192) [-652.827] (-654.233) (-653.021) * (-653.011) [-654.929] (-658.725) (-655.174) -- 0:00:15
762000 -- (-655.295) (-654.322) (-654.538) [-654.560] * [-654.382] (-653.847) (-655.767) (-653.043) -- 0:00:15
762500 -- (-654.168) [-655.722] (-657.210) (-655.178) * (-655.123) (-653.118) (-653.993) [-653.545] -- 0:00:15
763000 -- [-655.940] (-653.397) (-652.677) (-656.635) * (-657.551) (-653.118) (-654.316) [-654.142] -- 0:00:15
763500 -- (-654.996) (-653.991) [-653.574] (-658.932) * (-655.454) [-654.020] (-654.380) (-654.490) -- 0:00:15
764000 -- (-654.689) [-653.877] (-655.621) (-659.636) * (-655.101) (-653.407) [-654.556] (-659.263) -- 0:00:15
764500 -- (-658.410) (-655.026) (-653.386) [-655.708] * (-658.605) (-653.771) [-660.229] (-655.483) -- 0:00:15
765000 -- [-658.060] (-655.043) (-653.908) (-654.066) * (-654.947) (-654.164) [-653.690] (-654.613) -- 0:00:15
Average standard deviation of split frequencies: 0.009163
765500 -- (-655.115) (-653.496) [-660.412] (-654.187) * (-656.534) (-654.782) (-656.506) [-653.639] -- 0:00:15
766000 -- (-655.170) (-654.786) (-654.462) [-652.956] * (-656.012) [-654.621] (-657.429) (-655.051) -- 0:00:15
766500 -- [-654.764] (-654.757) (-653.760) (-653.064) * [-655.025] (-656.111) (-657.537) (-654.955) -- 0:00:15
767000 -- (-654.214) [-655.934] (-653.388) (-655.960) * (-658.140) (-655.942) [-664.591] (-656.966) -- 0:00:15
767500 -- (-654.653) (-657.306) [-654.728] (-652.896) * (-654.069) (-654.768) [-656.406] (-655.545) -- 0:00:15
768000 -- (-655.328) (-653.382) (-655.838) [-655.267] * [-654.960] (-655.752) (-654.268) (-655.361) -- 0:00:15
768500 -- (-657.509) (-654.308) [-656.979] (-658.740) * (-658.356) (-655.992) [-655.802] (-654.661) -- 0:00:15
769000 -- (-652.608) (-653.605) (-655.174) [-659.329] * (-652.974) (-656.490) [-653.324] (-653.436) -- 0:00:15
769500 -- [-652.833] (-653.767) (-654.354) (-660.086) * (-653.874) (-656.373) (-653.459) [-653.356] -- 0:00:14
770000 -- [-654.150] (-655.134) (-654.608) (-655.733) * (-657.201) (-654.143) [-654.131] (-654.446) -- 0:00:14
Average standard deviation of split frequencies: 0.009005
770500 -- (-653.646) [-654.515] (-659.377) (-654.291) * (-657.183) (-666.504) [-653.823] (-654.411) -- 0:00:14
771000 -- (-653.708) (-654.128) [-655.483] (-654.012) * [-661.046] (-656.443) (-654.893) (-655.174) -- 0:00:14
771500 -- [-654.216] (-653.990) (-653.722) (-661.126) * [-652.830] (-655.663) (-655.762) (-653.720) -- 0:00:14
772000 -- (-655.537) (-655.680) [-653.803] (-656.390) * (-657.207) (-655.197) (-653.884) [-654.018] -- 0:00:14
772500 -- (-654.624) [-654.626] (-657.044) (-653.223) * [-655.505] (-655.535) (-656.315) (-654.400) -- 0:00:14
773000 -- (-656.967) (-655.872) (-654.058) [-655.140] * (-653.797) [-654.369] (-656.995) (-655.545) -- 0:00:14
773500 -- (-654.428) [-656.877] (-653.791) (-654.795) * (-654.068) (-653.912) [-656.756] (-656.837) -- 0:00:14
774000 -- (-654.013) (-659.720) [-654.386] (-656.251) * (-653.734) [-652.812] (-656.710) (-657.665) -- 0:00:14
774500 -- [-653.868] (-653.487) (-656.808) (-654.515) * (-655.423) [-652.738] (-656.015) (-655.624) -- 0:00:14
775000 -- (-656.665) [-654.537] (-656.595) (-654.365) * [-656.893] (-653.467) (-659.305) (-654.104) -- 0:00:14
Average standard deviation of split frequencies: 0.009011
775500 -- [-653.160] (-653.719) (-654.723) (-659.030) * (-654.794) (-654.174) [-655.653] (-657.850) -- 0:00:14
776000 -- (-658.739) [-654.891] (-653.692) (-657.771) * [-653.623] (-659.675) (-653.270) (-656.884) -- 0:00:14
776500 -- (-654.324) [-656.671] (-653.161) (-653.740) * (-657.298) [-655.614] (-657.009) (-654.955) -- 0:00:14
777000 -- [-653.938] (-654.124) (-652.799) (-653.923) * (-654.002) (-658.607) (-656.545) [-656.193] -- 0:00:14
777500 -- (-653.937) (-656.415) [-655.291] (-655.338) * [-652.991] (-656.073) (-654.888) (-653.487) -- 0:00:14
778000 -- (-656.068) (-653.422) (-658.995) [-653.193] * (-653.965) [-657.737] (-656.099) (-654.064) -- 0:00:14
778500 -- (-657.049) (-657.518) [-653.327] (-653.514) * (-658.141) [-653.536] (-657.242) (-654.592) -- 0:00:14
779000 -- (-656.030) [-654.277] (-655.515) (-654.060) * (-657.784) (-657.511) (-659.318) [-654.119] -- 0:00:14
779500 -- [-655.862] (-655.209) (-653.270) (-655.262) * (-654.342) (-658.752) (-656.609) [-655.912] -- 0:00:14
780000 -- (-657.081) [-654.368] (-656.046) (-655.851) * (-656.546) (-659.169) [-654.442] (-655.926) -- 0:00:14
Average standard deviation of split frequencies: 0.008856
780500 -- (-655.781) (-654.035) (-654.379) [-653.851] * (-654.336) (-653.589) (-655.490) [-655.288] -- 0:00:14
781000 -- (-655.591) [-653.952] (-658.043) (-654.559) * (-654.733) (-654.742) (-655.888) [-662.476] -- 0:00:14
781500 -- (-654.217) [-657.852] (-653.408) (-654.008) * (-656.903) (-656.871) [-655.273] (-656.655) -- 0:00:14
782000 -- [-655.408] (-654.633) (-654.415) (-655.040) * [-655.405] (-657.795) (-656.342) (-653.583) -- 0:00:14
782500 -- [-654.908] (-655.148) (-654.438) (-653.986) * [-658.647] (-657.983) (-655.748) (-653.186) -- 0:00:14
783000 -- (-656.545) (-657.751) (-653.544) [-652.693] * (-656.379) [-657.499] (-658.757) (-655.427) -- 0:00:14
783500 -- (-653.597) (-654.216) (-655.773) [-655.659] * (-654.180) (-654.418) (-656.257) [-653.660] -- 0:00:14
784000 -- (-652.945) (-658.694) [-653.285] (-656.175) * (-655.078) [-653.287] (-654.391) (-654.993) -- 0:00:14
784500 -- (-652.578) (-653.036) [-653.662] (-653.397) * (-656.835) (-653.444) [-656.649] (-654.807) -- 0:00:14
785000 -- (-657.210) (-656.270) (-654.572) [-654.575] * [-656.670] (-656.315) (-655.208) (-659.722) -- 0:00:13
Average standard deviation of split frequencies: 0.009196
785500 -- (-655.600) [-655.458] (-654.859) (-658.315) * (-659.205) [-653.860] (-654.128) (-655.500) -- 0:00:13
786000 -- (-658.667) (-656.826) [-656.576] (-655.843) * [-658.667] (-656.054) (-655.142) (-655.812) -- 0:00:13
786500 -- (-659.933) (-654.659) [-657.136] (-656.728) * [-656.274] (-655.948) (-655.795) (-653.937) -- 0:00:14
787000 -- [-655.007] (-653.345) (-656.734) (-656.386) * (-656.049) [-657.356] (-660.452) (-654.322) -- 0:00:14
787500 -- (-655.828) [-653.199] (-654.401) (-656.470) * [-657.814] (-654.951) (-655.880) (-653.554) -- 0:00:14
788000 -- [-656.324] (-655.143) (-654.798) (-655.355) * (-653.820) [-654.487] (-652.973) (-653.168) -- 0:00:13
788500 -- (-657.856) (-656.065) (-656.479) [-653.400] * (-655.690) [-655.255] (-660.434) (-655.579) -- 0:00:13
789000 -- (-655.236) (-654.353) [-656.119] (-656.822) * [-657.157] (-654.912) (-655.160) (-653.569) -- 0:00:13
789500 -- (-655.049) [-655.196] (-654.000) (-654.001) * [-655.528] (-653.998) (-655.590) (-654.439) -- 0:00:13
790000 -- (-655.421) (-653.551) [-659.588] (-653.405) * (-657.371) (-655.261) [-654.846] (-653.725) -- 0:00:13
Average standard deviation of split frequencies: 0.009208
790500 -- (-654.234) (-654.248) [-658.991] (-654.744) * (-662.161) [-655.450] (-653.214) (-662.155) -- 0:00:13
791000 -- [-655.338] (-655.757) (-655.235) (-655.064) * (-654.917) (-656.108) (-656.397) [-654.589] -- 0:00:13
791500 -- [-655.755] (-654.157) (-655.841) (-656.459) * (-655.112) (-654.624) [-653.498] (-653.562) -- 0:00:13
792000 -- (-655.575) (-657.735) (-657.037) [-654.882] * [-655.702] (-654.108) (-655.423) (-656.776) -- 0:00:13
792500 -- (-653.929) (-655.045) [-653.858] (-655.995) * (-658.662) (-657.332) (-655.203) [-654.078] -- 0:00:13
793000 -- (-653.222) [-653.486] (-665.122) (-660.895) * [-654.546] (-654.587) (-654.838) (-654.841) -- 0:00:13
793500 -- (-654.426) [-656.415] (-666.611) (-653.329) * (-654.520) (-653.789) (-653.573) [-653.981] -- 0:00:13
794000 -- (-653.175) (-656.086) (-656.299) [-653.599] * (-653.756) (-653.937) [-654.155] (-653.717) -- 0:00:13
794500 -- (-654.750) (-653.929) [-657.782] (-653.899) * (-655.166) (-653.178) [-654.520] (-653.830) -- 0:00:13
795000 -- (-653.410) (-654.717) (-653.746) [-654.116] * [-655.485] (-653.272) (-653.328) (-653.072) -- 0:00:13
Average standard deviation of split frequencies: 0.008949
795500 -- [-654.371] (-653.858) (-655.504) (-656.288) * (-656.233) (-657.775) (-653.397) [-654.369] -- 0:00:13
796000 -- (-657.313) (-653.983) [-655.987] (-655.272) * (-657.479) (-657.434) (-654.121) [-654.340] -- 0:00:13
796500 -- (-656.227) (-660.838) [-653.985] (-654.924) * (-659.388) (-654.508) (-653.393) [-655.170] -- 0:00:13
797000 -- [-653.404] (-654.125) (-655.910) (-655.223) * (-658.001) (-657.162) [-656.051] (-655.083) -- 0:00:13
797500 -- (-653.880) (-655.141) (-654.032) [-655.702] * (-656.839) (-654.804) (-657.323) [-654.680] -- 0:00:13
798000 -- (-653.290) (-655.995) [-653.916] (-657.794) * [-653.422] (-656.329) (-654.465) (-653.433) -- 0:00:13
798500 -- [-655.731] (-655.710) (-660.911) (-657.993) * (-653.718) (-653.616) (-655.494) [-655.080] -- 0:00:13
799000 -- (-656.323) (-653.602) [-655.008] (-659.611) * [-653.590] (-653.945) (-653.942) (-654.478) -- 0:00:13
799500 -- (-654.547) [-655.232] (-653.128) (-658.878) * (-655.008) (-655.026) (-653.974) [-657.430] -- 0:00:13
800000 -- (-654.072) [-655.687] (-656.079) (-656.181) * (-653.905) [-656.441] (-654.187) (-657.395) -- 0:00:12
Average standard deviation of split frequencies: 0.008701
800500 -- [-656.527] (-655.306) (-657.104) (-657.333) * (-653.632) [-654.561] (-655.383) (-654.768) -- 0:00:12
801000 -- (-654.535) (-653.831) [-654.630] (-655.900) * (-655.062) (-654.353) [-654.080] (-655.354) -- 0:00:12
801500 -- (-655.312) (-657.283) (-655.698) [-654.909] * (-654.258) (-653.857) (-654.133) [-654.139] -- 0:00:13
802000 -- [-656.223] (-658.452) (-653.516) (-655.438) * (-654.471) (-655.216) [-655.260] (-655.165) -- 0:00:13
802500 -- (-653.287) [-659.165] (-654.752) (-660.004) * (-656.920) [-654.397] (-656.244) (-657.923) -- 0:00:13
803000 -- (-653.425) [-656.394] (-654.172) (-656.226) * (-653.883) (-652.875) (-656.444) [-656.433] -- 0:00:13
803500 -- (-656.511) [-653.331] (-658.639) (-659.050) * [-654.589] (-653.713) (-654.520) (-656.359) -- 0:00:12
804000 -- (-655.817) (-654.142) (-661.019) [-653.775] * (-656.413) (-653.834) (-659.574) [-653.776] -- 0:00:12
804500 -- [-658.532] (-653.839) (-659.382) (-654.693) * (-655.547) [-654.290] (-653.688) (-654.324) -- 0:00:12
805000 -- [-657.942] (-652.911) (-657.250) (-655.280) * (-655.103) (-655.266) [-653.677] (-655.807) -- 0:00:12
Average standard deviation of split frequencies: 0.008936
805500 -- (-657.147) (-657.570) [-657.111] (-655.566) * (-654.155) (-655.112) (-656.092) [-653.080] -- 0:00:12
806000 -- (-657.095) (-657.385) [-656.066] (-658.358) * (-655.551) (-656.940) [-653.128] (-656.644) -- 0:00:12
806500 -- (-654.199) (-654.785) (-653.202) [-657.511] * [-654.950] (-657.351) (-655.159) (-652.972) -- 0:00:12
807000 -- (-657.658) (-655.944) [-653.660] (-654.236) * (-654.937) (-658.765) [-653.923] (-656.392) -- 0:00:12
807500 -- (-654.194) (-659.719) (-654.537) [-654.518] * (-652.985) [-654.981] (-653.711) (-655.601) -- 0:00:12
808000 -- [-653.922] (-655.444) (-653.353) (-654.034) * (-652.798) (-657.166) [-654.298] (-655.604) -- 0:00:12
808500 -- (-655.397) (-655.382) (-656.087) [-654.077] * (-653.393) [-654.830] (-656.182) (-657.340) -- 0:00:12
809000 -- (-653.519) (-656.606) [-654.851] (-653.527) * (-652.934) (-656.336) (-655.788) [-655.268] -- 0:00:12
809500 -- [-653.145] (-653.374) (-653.504) (-655.720) * (-654.478) (-655.647) (-654.511) [-652.610] -- 0:00:12
810000 -- (-653.976) [-657.577] (-653.429) (-653.087) * (-657.857) (-655.679) [-654.680] (-653.064) -- 0:00:12
Average standard deviation of split frequencies: 0.008981
810500 -- [-654.520] (-654.309) (-652.658) (-652.813) * (-655.766) (-653.530) (-654.556) [-652.728] -- 0:00:12
811000 -- (-652.910) [-656.153] (-654.461) (-658.121) * (-654.543) [-652.801] (-654.812) (-655.583) -- 0:00:12
811500 -- (-655.192) (-653.583) [-654.112] (-657.039) * (-654.216) (-652.765) (-660.700) [-654.460] -- 0:00:12
812000 -- (-656.726) [-654.546] (-657.037) (-657.108) * [-654.440] (-654.048) (-659.469) (-654.421) -- 0:00:12
812500 -- [-654.172] (-654.280) (-654.380) (-655.392) * [-654.859] (-658.927) (-655.365) (-654.349) -- 0:00:12
813000 -- (-655.239) [-653.220] (-654.880) (-655.091) * (-656.757) [-656.057] (-658.824) (-657.867) -- 0:00:12
813500 -- (-653.228) (-655.708) (-654.474) [-659.778] * (-655.836) (-654.633) [-656.049] (-657.907) -- 0:00:12
814000 -- (-653.046) [-657.855] (-657.806) (-656.055) * (-656.032) (-653.537) [-656.489] (-660.047) -- 0:00:12
814500 -- (-656.800) (-655.101) [-656.276] (-655.207) * (-653.797) (-656.449) (-658.038) [-657.164] -- 0:00:12
815000 -- [-655.927] (-658.407) (-654.974) (-655.007) * [-656.306] (-653.994) (-655.108) (-659.478) -- 0:00:12
Average standard deviation of split frequencies: 0.008762
815500 -- (-657.257) [-654.007] (-654.690) (-654.315) * [-656.164] (-653.684) (-654.723) (-655.704) -- 0:00:11
816000 -- (-654.575) [-654.654] (-654.389) (-654.503) * [-656.004] (-655.709) (-653.082) (-664.108) -- 0:00:12
816500 -- (-654.812) (-653.579) [-654.344] (-655.188) * [-653.732] (-660.134) (-655.729) (-653.080) -- 0:00:12
817000 -- [-657.199] (-653.443) (-655.281) (-655.932) * (-653.977) (-654.729) (-654.651) [-655.873] -- 0:00:12
817500 -- [-653.513] (-653.303) (-653.840) (-654.492) * (-654.953) (-655.543) [-654.949] (-656.172) -- 0:00:12
818000 -- (-656.695) (-653.988) (-653.996) [-653.509] * (-654.222) (-656.982) [-655.161] (-655.372) -- 0:00:12
818500 -- (-654.587) (-657.716) [-657.897] (-653.710) * (-655.519) (-653.920) [-654.531] (-655.950) -- 0:00:11
819000 -- (-653.231) (-658.458) (-654.112) [-653.176] * [-654.483] (-653.223) (-657.439) (-653.550) -- 0:00:11
819500 -- (-653.151) (-656.025) (-656.732) [-653.588] * [-656.356] (-654.020) (-656.320) (-653.767) -- 0:00:11
820000 -- (-654.036) [-654.914] (-654.114) (-655.082) * (-654.990) (-654.949) (-657.107) [-654.231] -- 0:00:11
Average standard deviation of split frequencies: 0.008109
820500 -- [-654.351] (-654.531) (-655.102) (-654.098) * [-652.791] (-654.385) (-653.047) (-655.206) -- 0:00:11
821000 -- (-661.535) (-662.230) [-654.882] (-654.556) * (-652.821) (-653.948) [-653.592] (-654.827) -- 0:00:11
821500 -- (-654.921) (-660.838) [-653.936] (-655.036) * (-654.625) [-655.985] (-653.807) (-660.024) -- 0:00:11
822000 -- (-654.550) [-654.814] (-656.962) (-658.519) * (-654.164) (-660.208) (-654.328) [-656.841] -- 0:00:11
822500 -- (-654.421) (-653.406) [-657.014] (-654.732) * (-656.630) (-658.036) [-653.702] (-655.609) -- 0:00:11
823000 -- (-654.514) (-652.921) [-658.088] (-653.870) * [-656.973] (-658.887) (-655.031) (-663.111) -- 0:00:11
823500 -- (-655.317) [-653.673] (-658.662) (-653.572) * [-653.581] (-653.946) (-653.582) (-654.526) -- 0:00:11
824000 -- [-656.264] (-652.897) (-656.783) (-653.223) * (-653.459) [-652.837] (-657.325) (-655.017) -- 0:00:11
824500 -- (-654.099) (-656.950) [-656.930] (-654.760) * (-654.702) [-655.829] (-654.941) (-656.469) -- 0:00:11
825000 -- (-660.373) (-654.092) [-652.863] (-655.605) * [-654.502] (-652.933) (-656.131) (-653.706) -- 0:00:11
Average standard deviation of split frequencies: 0.008091
825500 -- (-653.314) (-656.247) (-652.855) [-655.085] * [-654.233] (-654.747) (-659.188) (-653.263) -- 0:00:11
826000 -- (-655.098) [-653.034] (-653.806) (-656.343) * (-659.213) [-653.311] (-655.847) (-656.020) -- 0:00:11
826500 -- (-656.737) [-655.405] (-656.159) (-659.668) * (-663.924) [-654.754] (-655.474) (-656.918) -- 0:00:11
827000 -- (-653.160) (-653.664) [-655.031] (-654.707) * [-654.122] (-655.443) (-654.408) (-656.054) -- 0:00:11
827500 -- (-653.880) (-657.166) (-653.349) [-653.977] * (-656.168) (-654.739) [-655.152] (-659.108) -- 0:00:11
828000 -- (-653.516) [-656.560] (-657.093) (-653.658) * (-654.085) (-654.301) [-654.953] (-655.287) -- 0:00:11
828500 -- (-657.709) (-654.469) [-656.915] (-654.086) * [-654.457] (-653.084) (-662.342) (-654.911) -- 0:00:11
829000 -- (-659.696) (-656.723) (-653.220) [-654.665] * [-653.040] (-654.135) (-659.443) (-654.533) -- 0:00:11
829500 -- (-654.047) (-656.195) [-654.750] (-656.193) * [-655.850] (-652.948) (-655.792) (-656.363) -- 0:00:11
830000 -- (-656.561) [-655.846] (-654.584) (-654.109) * [-654.359] (-660.342) (-654.681) (-655.788) -- 0:00:11
Average standard deviation of split frequencies: 0.008245
830500 -- (-656.825) (-656.463) [-654.722] (-655.733) * [-653.614] (-657.599) (-655.941) (-658.710) -- 0:00:11
831000 -- [-657.182] (-656.722) (-655.819) (-655.086) * [-654.556] (-654.333) (-654.577) (-654.391) -- 0:00:11
831500 -- (-654.767) [-653.576] (-658.284) (-655.025) * (-657.198) (-652.820) [-657.161] (-656.125) -- 0:00:11
832000 -- [-655.042] (-653.512) (-656.500) (-654.913) * (-654.610) [-652.818] (-655.499) (-653.575) -- 0:00:11
832500 -- (-653.472) [-654.646] (-657.899) (-656.586) * [-654.759] (-654.494) (-656.048) (-652.895) -- 0:00:11
833000 -- (-655.490) [-656.362] (-656.553) (-656.909) * (-654.461) [-657.143] (-654.299) (-654.235) -- 0:00:11
833500 -- (-657.634) [-655.145] (-656.994) (-654.716) * (-654.193) (-656.027) (-654.037) [-653.637] -- 0:00:10
834000 -- (-654.987) (-654.485) [-657.475] (-656.542) * (-653.470) [-659.033] (-656.375) (-656.984) -- 0:00:10
834500 -- (-654.168) [-654.377] (-657.042) (-656.376) * [-653.017] (-656.239) (-654.579) (-658.076) -- 0:00:10
835000 -- [-653.977] (-658.430) (-654.531) (-654.195) * [-654.824] (-660.383) (-657.890) (-655.256) -- 0:00:10
Average standard deviation of split frequencies: 0.008093
835500 -- (-655.671) (-657.630) (-653.839) [-654.263] * [-654.948] (-658.159) (-657.401) (-654.222) -- 0:00:10
836000 -- [-654.248] (-652.775) (-653.215) (-655.349) * (-656.529) [-655.969] (-655.493) (-653.611) -- 0:00:10
836500 -- (-656.537) (-654.838) (-654.626) [-653.504] * (-656.057) [-653.312] (-653.621) (-654.988) -- 0:00:10
837000 -- [-655.029] (-655.431) (-659.009) (-653.425) * (-657.397) (-655.880) [-653.312] (-656.618) -- 0:00:10
837500 -- (-653.757) (-657.412) (-654.618) [-653.901] * (-656.234) (-655.788) [-653.754] (-655.122) -- 0:00:10
838000 -- (-654.300) (-657.560) [-655.498] (-653.663) * (-654.422) [-653.378] (-653.737) (-655.074) -- 0:00:10
838500 -- [-654.044] (-655.123) (-655.948) (-654.997) * (-653.454) [-653.738] (-653.189) (-656.206) -- 0:00:10
839000 -- (-654.691) [-655.171] (-653.766) (-655.538) * (-659.527) [-654.666] (-653.327) (-658.007) -- 0:00:10
839500 -- (-655.142) [-653.508] (-655.922) (-658.602) * (-660.004) [-654.667] (-656.793) (-655.714) -- 0:00:10
840000 -- (-657.749) [-654.703] (-655.359) (-657.754) * [-658.900] (-656.118) (-656.130) (-655.055) -- 0:00:10
Average standard deviation of split frequencies: 0.008287
840500 -- [-654.621] (-656.343) (-654.880) (-659.338) * (-660.890) (-657.434) [-653.687] (-656.739) -- 0:00:10
841000 -- (-659.757) (-653.380) [-653.233] (-656.038) * [-653.655] (-655.359) (-652.639) (-655.875) -- 0:00:10
841500 -- (-655.654) [-654.278] (-653.861) (-654.649) * (-657.556) (-653.586) (-653.390) [-653.703] -- 0:00:10
842000 -- (-661.479) (-653.395) (-658.778) [-654.651] * [-654.032] (-658.112) (-654.873) (-655.230) -- 0:00:10
842500 -- (-654.207) (-657.951) [-657.169] (-654.781) * [-654.874] (-660.798) (-654.571) (-657.449) -- 0:00:10
843000 -- (-660.132) (-658.776) [-657.903] (-652.803) * [-656.670] (-655.875) (-654.986) (-653.319) -- 0:00:10
843500 -- (-654.885) (-657.529) (-655.931) [-652.768] * (-653.584) [-654.069] (-656.561) (-654.188) -- 0:00:10
844000 -- (-656.921) [-656.130] (-652.724) (-654.272) * (-655.971) (-654.069) [-657.620] (-656.016) -- 0:00:10
844500 -- (-652.966) (-655.726) (-653.515) [-655.579] * (-653.540) [-653.800] (-653.739) (-657.867) -- 0:00:10
845000 -- (-653.889) (-655.222) (-658.138) [-655.656] * (-653.031) (-655.619) [-654.811] (-658.092) -- 0:00:10
Average standard deviation of split frequencies: 0.008049
845500 -- (-654.192) (-655.950) (-655.277) [-655.607] * [-653.130] (-655.758) (-653.534) (-659.783) -- 0:00:10
846000 -- (-653.619) (-654.252) [-654.159] (-654.341) * (-654.734) [-655.901] (-657.022) (-658.503) -- 0:00:10
846500 -- (-656.252) (-655.281) (-654.704) [-656.436] * (-654.257) (-658.062) (-658.650) [-654.946] -- 0:00:10
847000 -- [-653.849] (-657.326) (-655.447) (-656.715) * (-654.391) (-653.936) (-654.901) [-657.128] -- 0:00:10
847500 -- (-658.536) (-655.309) (-655.680) [-652.985] * (-654.160) [-654.730] (-660.037) (-656.967) -- 0:00:10
848000 -- (-655.122) [-659.931] (-653.944) (-654.180) * (-654.348) (-654.355) (-654.723) [-658.772] -- 0:00:10
848500 -- (-660.962) [-655.817] (-653.701) (-655.545) * (-654.778) (-655.504) [-655.855] (-655.515) -- 0:00:09
849000 -- [-656.175] (-655.122) (-654.124) (-655.780) * [-655.209] (-657.206) (-654.278) (-655.668) -- 0:00:09
849500 -- (-654.958) (-654.319) [-656.677] (-654.208) * (-653.825) [-655.569] (-655.943) (-655.641) -- 0:00:09
850000 -- [-653.384] (-653.790) (-655.450) (-653.453) * (-655.096) (-658.087) [-654.127] (-653.771) -- 0:00:09
Average standard deviation of split frequencies: 0.008374
850500 -- (-655.066) [-659.210] (-654.439) (-657.037) * (-655.170) (-655.942) [-654.976] (-653.424) -- 0:00:09
851000 -- (-655.767) [-653.320] (-654.356) (-654.835) * [-654.980] (-655.869) (-654.888) (-653.675) -- 0:00:09
851500 -- (-656.961) (-654.823) [-654.891] (-653.251) * (-659.339) [-655.540] (-655.035) (-654.425) -- 0:00:09
852000 -- (-659.646) (-653.801) (-655.304) [-656.479] * [-659.811] (-653.721) (-654.367) (-655.303) -- 0:00:09
852500 -- (-657.794) [-656.383] (-654.936) (-655.541) * (-654.525) (-653.496) [-653.894] (-654.521) -- 0:00:09
853000 -- (-657.727) [-658.778] (-653.841) (-659.453) * (-653.573) [-653.922] (-653.729) (-655.173) -- 0:00:09
853500 -- [-657.714] (-656.530) (-654.189) (-656.099) * (-653.906) [-652.976] (-653.187) (-654.297) -- 0:00:09
854000 -- (-654.612) (-655.024) [-653.033] (-657.262) * (-655.598) (-657.280) (-653.951) [-654.088] -- 0:00:09
854500 -- [-656.233] (-653.767) (-656.697) (-656.569) * (-657.280) (-654.133) [-652.858] (-654.253) -- 0:00:09
855000 -- (-653.045) (-653.735) (-655.843) [-658.749] * [-657.946] (-656.817) (-652.835) (-655.843) -- 0:00:09
Average standard deviation of split frequencies: 0.008398
855500 -- (-654.268) [-657.527] (-656.345) (-654.887) * (-654.873) (-653.279) [-654.142] (-657.871) -- 0:00:09
856000 -- [-653.152] (-656.245) (-655.923) (-653.775) * (-653.742) [-654.930] (-654.090) (-658.018) -- 0:00:09
856500 -- (-657.246) (-656.362) [-655.036] (-654.540) * (-654.270) [-655.172] (-654.267) (-658.194) -- 0:00:09
857000 -- (-653.727) [-656.138] (-654.731) (-653.735) * (-654.995) [-656.323] (-654.176) (-658.877) -- 0:00:09
857500 -- (-655.345) (-657.055) [-653.626] (-657.093) * [-654.279] (-655.095) (-662.952) (-655.478) -- 0:00:09
858000 -- (-654.765) (-656.185) (-656.806) [-656.456] * [-653.691] (-656.611) (-654.279) (-655.248) -- 0:00:09
858500 -- (-652.946) [-653.377] (-654.247) (-654.302) * (-655.459) (-653.697) [-653.075] (-656.027) -- 0:00:09
859000 -- (-656.513) [-653.612] (-653.981) (-655.092) * (-654.852) [-653.376] (-653.505) (-654.937) -- 0:00:09
859500 -- (-655.906) (-659.103) (-655.582) [-658.856] * (-657.575) (-653.833) [-653.813] (-657.096) -- 0:00:09
860000 -- [-654.238] (-653.719) (-656.105) (-656.102) * (-656.573) (-656.371) (-654.913) [-654.900] -- 0:00:09
Average standard deviation of split frequencies: 0.008284
860500 -- (-655.020) [-653.628] (-655.482) (-661.241) * (-655.216) (-655.666) (-655.279) [-654.064] -- 0:00:09
861000 -- (-652.966) (-657.358) (-659.826) [-660.124] * (-658.612) (-659.512) [-655.426] (-660.366) -- 0:00:09
861500 -- [-653.552] (-655.873) (-657.032) (-652.981) * (-652.977) (-653.750) (-656.375) [-658.936] -- 0:00:09
862000 -- (-654.068) (-653.141) (-655.042) [-652.951] * (-655.375) [-655.185] (-655.450) (-658.057) -- 0:00:09
862500 -- (-653.710) [-655.084] (-654.228) (-653.086) * (-657.596) [-653.916] (-656.272) (-657.110) -- 0:00:09
863000 -- (-655.764) [-658.670] (-655.724) (-654.562) * [-655.173] (-653.467) (-655.090) (-656.852) -- 0:00:09
863500 -- (-656.226) [-653.261] (-654.213) (-660.377) * (-654.841) (-654.383) [-654.044] (-655.697) -- 0:00:09
864000 -- (-656.356) (-653.453) (-654.258) [-656.192] * [-655.432] (-655.271) (-653.940) (-657.737) -- 0:00:08
864500 -- (-654.787) (-653.715) (-655.472) [-654.971] * [-658.142] (-658.024) (-653.783) (-659.677) -- 0:00:08
865000 -- (-653.228) (-654.069) (-655.855) [-653.913] * (-658.239) [-653.816] (-655.068) (-658.380) -- 0:00:08
Average standard deviation of split frequencies: 0.008233
865500 -- (-655.604) (-655.257) [-654.571] (-655.340) * (-657.467) (-653.656) (-656.349) [-654.536] -- 0:00:08
866000 -- (-653.962) (-657.366) [-656.231] (-654.075) * (-655.537) (-653.753) [-654.112] (-655.628) -- 0:00:08
866500 -- (-653.364) (-654.629) (-655.869) [-653.949] * (-655.876) [-652.819] (-655.315) (-655.407) -- 0:00:08
867000 -- (-654.231) (-655.750) [-658.955] (-652.864) * (-654.838) (-654.559) (-656.524) [-654.040] -- 0:00:08
867500 -- [-656.182] (-657.643) (-655.333) (-652.953) * (-655.147) (-656.311) (-655.816) [-655.023] -- 0:00:08
868000 -- (-654.921) (-655.451) [-653.769] (-654.049) * (-657.996) [-657.214] (-654.301) (-656.840) -- 0:00:08
868500 -- (-656.384) [-653.689] (-655.777) (-653.732) * (-657.574) (-653.861) (-655.989) [-653.942] -- 0:00:08
869000 -- (-660.588) [-655.886] (-655.625) (-656.714) * (-658.316) [-653.828] (-653.721) (-654.639) -- 0:00:08
869500 -- (-661.575) (-656.368) (-655.091) [-655.812] * [-654.211] (-657.051) (-653.524) (-655.963) -- 0:00:08
870000 -- (-658.818) (-654.928) (-655.385) [-653.400] * (-656.258) (-654.970) [-653.387] (-653.276) -- 0:00:08
Average standard deviation of split frequencies: 0.008561
870500 -- (-654.684) (-657.498) (-658.371) [-654.143] * (-660.201) [-654.021] (-653.808) (-655.138) -- 0:00:08
871000 -- (-655.831) [-654.927] (-654.030) (-652.910) * (-653.762) [-654.803] (-653.593) (-655.177) -- 0:00:08
871500 -- (-655.358) [-654.913] (-653.849) (-654.233) * (-654.707) (-657.061) [-653.858] (-658.434) -- 0:00:08
872000 -- [-653.736] (-654.963) (-655.591) (-657.493) * (-654.756) (-653.572) [-657.504] (-655.547) -- 0:00:08
872500 -- (-656.871) (-655.035) [-652.958] (-654.099) * [-660.721] (-653.784) (-655.291) (-656.412) -- 0:00:08
873000 -- (-654.886) [-652.772] (-655.347) (-653.247) * (-656.227) [-655.064] (-656.904) (-654.454) -- 0:00:08
873500 -- (-655.664) (-657.564) [-655.327] (-657.588) * (-654.085) (-654.280) (-653.413) [-654.253] -- 0:00:08
874000 -- [-653.955] (-655.682) (-654.666) (-654.972) * (-654.371) (-655.809) (-653.814) [-657.508] -- 0:00:08
874500 -- [-654.362] (-654.149) (-654.802) (-658.580) * (-655.056) [-653.635] (-656.420) (-655.145) -- 0:00:08
875000 -- [-652.914] (-656.903) (-653.940) (-656.954) * (-653.460) (-654.368) [-652.962] (-654.445) -- 0:00:08
Average standard deviation of split frequencies: 0.008543
875500 -- (-653.997) (-656.986) [-656.432] (-653.854) * (-652.859) (-656.899) [-658.191] (-653.533) -- 0:00:08
876000 -- (-655.034) (-654.626) [-655.745] (-653.506) * (-655.517) (-654.172) (-656.137) [-653.789] -- 0:00:08
876500 -- (-657.990) [-660.096] (-653.419) (-653.654) * (-653.431) (-655.079) [-654.063] (-653.415) -- 0:00:08
877000 -- (-653.683) [-654.704] (-657.711) (-654.411) * (-654.800) (-653.567) [-657.297] (-655.235) -- 0:00:08
877500 -- (-654.326) (-654.908) (-654.783) [-658.278] * [-652.670] (-653.103) (-654.488) (-659.234) -- 0:00:08
878000 -- [-654.192] (-655.878) (-652.814) (-656.005) * [-652.670] (-656.398) (-656.136) (-656.877) -- 0:00:08
878500 -- (-655.280) (-659.764) (-653.806) [-653.322] * [-652.598] (-652.835) (-658.305) (-655.849) -- 0:00:08
879000 -- [-654.757] (-657.615) (-653.674) (-654.708) * (-656.507) (-654.551) [-657.713] (-656.310) -- 0:00:07
879500 -- [-656.354] (-654.737) (-654.682) (-653.629) * (-657.120) (-659.287) (-654.123) [-653.771] -- 0:00:07
880000 -- [-654.084] (-656.109) (-656.607) (-652.914) * (-656.333) (-656.823) (-659.021) [-654.881] -- 0:00:08
Average standard deviation of split frequencies: 0.007929
880500 -- (-654.468) (-655.678) (-655.651) [-655.694] * (-653.467) [-657.160] (-654.307) (-654.038) -- 0:00:08
881000 -- (-655.328) [-657.328] (-653.151) (-654.181) * (-654.542) (-654.221) (-656.442) [-658.668] -- 0:00:07
881500 -- (-658.498) (-656.117) [-652.836] (-655.430) * [-654.230] (-654.166) (-655.963) (-657.120) -- 0:00:07
882000 -- (-658.909) (-658.181) (-653.184) [-654.521] * (-655.390) (-654.684) [-655.425] (-653.741) -- 0:00:07
882500 -- (-653.158) [-654.239] (-654.097) (-652.920) * (-654.235) [-653.070] (-653.572) (-654.343) -- 0:00:07
883000 -- (-657.847) [-653.553] (-656.533) (-654.772) * (-654.721) [-652.968] (-655.587) (-657.972) -- 0:00:07
883500 -- (-660.301) (-658.415) (-655.360) [-653.945] * (-654.875) [-654.206] (-654.374) (-654.508) -- 0:00:07
884000 -- (-653.964) (-656.889) [-654.507] (-654.932) * (-654.262) (-653.334) (-653.783) [-656.645] -- 0:00:07
884500 -- (-656.065) (-654.857) (-658.097) [-653.715] * (-657.588) [-653.447] (-657.381) (-657.015) -- 0:00:07
885000 -- (-664.162) (-655.960) (-655.022) [-654.950] * [-655.947] (-657.204) (-656.350) (-656.216) -- 0:00:07
Average standard deviation of split frequencies: 0.008014
885500 -- (-652.926) (-657.452) (-655.463) [-653.599] * (-654.839) (-653.678) (-654.762) [-656.158] -- 0:00:07
886000 -- (-656.404) (-658.087) (-654.875) [-656.924] * (-654.672) [-653.736] (-654.991) (-658.340) -- 0:00:07
886500 -- (-655.084) (-655.776) [-656.498] (-657.042) * (-654.760) [-654.692] (-654.461) (-659.585) -- 0:00:07
887000 -- [-654.289] (-653.141) (-659.875) (-656.295) * [-656.610] (-654.390) (-655.082) (-654.312) -- 0:00:07
887500 -- [-654.608] (-652.816) (-656.317) (-654.358) * [-653.297] (-653.149) (-655.406) (-652.904) -- 0:00:07
888000 -- (-654.513) [-654.331] (-654.379) (-653.767) * [-653.376] (-657.559) (-656.454) (-654.667) -- 0:00:07
888500 -- (-659.018) (-654.969) [-654.767] (-653.738) * (-655.129) (-655.522) [-654.435] (-654.292) -- 0:00:07
889000 -- (-656.211) (-655.765) [-655.274] (-655.288) * (-655.171) (-653.791) [-654.802] (-655.865) -- 0:00:07
889500 -- (-657.574) (-655.453) [-654.811] (-657.822) * [-657.027] (-654.835) (-655.661) (-657.122) -- 0:00:07
890000 -- (-652.852) (-654.696) (-653.956) [-657.924] * (-654.369) [-654.398] (-654.622) (-655.751) -- 0:00:07
Average standard deviation of split frequencies: 0.007774
890500 -- (-654.354) [-653.279] (-653.953) (-658.473) * (-654.578) (-656.165) (-657.029) [-653.991] -- 0:00:07
891000 -- (-657.100) (-653.284) (-654.413) [-656.854] * [-652.832] (-656.485) (-653.294) (-654.909) -- 0:00:07
891500 -- (-658.670) (-657.744) [-659.361] (-655.624) * (-652.698) (-656.733) (-654.798) [-653.135] -- 0:00:07
892000 -- (-661.822) (-657.106) [-656.549] (-654.632) * (-653.035) (-657.430) [-655.553] (-655.924) -- 0:00:07
892500 -- (-655.094) (-657.255) [-655.846] (-654.789) * (-654.421) [-654.341] (-655.754) (-654.987) -- 0:00:07
893000 -- (-653.292) [-655.527] (-655.394) (-657.067) * (-652.930) (-653.332) (-656.005) [-657.000] -- 0:00:07
893500 -- (-653.277) [-653.698] (-657.507) (-653.418) * (-658.725) [-656.213] (-655.174) (-654.798) -- 0:00:07
894000 -- [-655.214] (-655.958) (-654.324) (-657.855) * [-655.575] (-655.585) (-655.119) (-653.983) -- 0:00:07
894500 -- (-653.992) (-655.271) [-653.784] (-653.555) * (-659.860) (-655.974) (-655.617) [-654.207] -- 0:00:07
895000 -- (-653.754) (-654.661) (-654.090) [-657.573] * (-655.727) [-653.146] (-658.230) (-654.240) -- 0:00:07
Average standard deviation of split frequencies: 0.007662
895500 -- (-654.192) (-654.125) (-657.341) [-656.871] * (-656.111) (-654.538) (-661.264) [-653.744] -- 0:00:07
896000 -- (-653.956) (-654.339) (-657.971) [-653.370] * (-654.014) [-653.904] (-661.661) (-654.630) -- 0:00:06
896500 -- (-654.729) [-655.540] (-655.214) (-654.293) * [-655.104] (-653.235) (-659.276) (-655.069) -- 0:00:06
897000 -- [-655.459] (-657.586) (-653.581) (-653.835) * (-653.857) (-653.880) [-656.974] (-653.278) -- 0:00:06
897500 -- [-653.538] (-655.427) (-655.228) (-653.522) * (-656.630) (-654.606) [-654.676] (-653.366) -- 0:00:06
898000 -- (-653.894) [-653.874] (-657.590) (-654.331) * (-654.738) [-653.681] (-656.171) (-653.500) -- 0:00:06
898500 -- [-656.199] (-654.303) (-661.026) (-654.379) * (-654.340) (-656.252) (-653.568) [-655.495] -- 0:00:06
899000 -- (-657.844) (-653.621) [-653.538] (-653.966) * [-655.461] (-658.693) (-653.329) (-655.524) -- 0:00:06
899500 -- (-658.151) (-656.270) [-658.062] (-655.903) * (-659.276) (-654.776) [-654.502] (-655.948) -- 0:00:06
900000 -- (-655.462) [-654.531] (-654.731) (-655.455) * (-656.322) (-653.368) [-655.376] (-654.354) -- 0:00:06
Average standard deviation of split frequencies: 0.008047
900500 -- (-653.607) (-655.539) [-655.320] (-660.130) * (-652.767) (-654.372) [-654.601] (-653.953) -- 0:00:06
901000 -- (-657.179) (-655.068) [-655.613] (-655.774) * (-654.657) [-653.556] (-653.553) (-657.617) -- 0:00:06
901500 -- (-655.492) (-655.055) (-659.979) [-655.905] * (-654.594) (-653.370) (-652.982) [-656.014] -- 0:00:06
902000 -- (-656.054) (-655.056) [-654.455] (-653.209) * [-656.673] (-653.172) (-652.981) (-656.683) -- 0:00:06
902500 -- [-654.360] (-654.518) (-655.563) (-656.857) * [-657.292] (-653.875) (-654.261) (-655.835) -- 0:00:06
903000 -- (-658.356) (-654.445) (-653.866) [-659.146] * (-653.927) (-655.599) (-655.782) [-655.523] -- 0:00:06
903500 -- [-654.158] (-654.169) (-656.158) (-658.015) * [-654.130] (-654.652) (-654.268) (-654.245) -- 0:00:06
904000 -- (-653.928) (-657.640) [-657.741] (-656.101) * (-653.985) [-653.452] (-658.415) (-654.162) -- 0:00:06
904500 -- (-654.956) (-657.079) (-658.293) [-656.265] * (-656.000) (-654.213) (-653.588) [-654.874] -- 0:00:06
905000 -- (-654.237) (-654.263) [-654.065] (-654.781) * (-653.495) [-654.146] (-655.389) (-654.705) -- 0:00:06
Average standard deviation of split frequencies: 0.008600
905500 -- (-655.244) [-653.760] (-653.243) (-655.642) * (-653.762) [-656.872] (-656.044) (-656.755) -- 0:00:06
906000 -- (-653.349) (-656.582) [-653.273] (-659.141) * (-654.201) (-660.864) (-654.877) [-652.859] -- 0:00:06
906500 -- [-653.677] (-654.694) (-654.335) (-653.350) * (-653.003) (-655.750) (-657.001) [-654.264] -- 0:00:06
907000 -- [-655.090] (-654.872) (-654.907) (-655.698) * [-654.877] (-653.329) (-660.160) (-652.829) -- 0:00:06
907500 -- (-655.992) [-656.372] (-655.893) (-663.186) * (-655.703) [-654.399] (-658.591) (-656.740) -- 0:00:06
908000 -- (-658.561) [-655.581] (-656.932) (-655.679) * [-655.382] (-653.702) (-656.533) (-654.131) -- 0:00:06
908500 -- (-656.962) (-654.194) (-657.413) [-657.234] * [-654.131] (-655.287) (-655.914) (-657.413) -- 0:00:06
909000 -- [-655.391] (-654.318) (-655.520) (-658.419) * (-653.848) (-657.892) (-654.801) [-658.004] -- 0:00:06
909500 -- [-654.606] (-656.105) (-656.417) (-657.066) * [-653.914] (-657.085) (-660.277) (-654.106) -- 0:00:06
910000 -- [-653.818] (-653.934) (-656.876) (-657.873) * (-655.723) (-655.179) (-659.982) [-653.778] -- 0:00:06
Average standard deviation of split frequencies: 0.008153
910500 -- [-653.383] (-655.879) (-655.524) (-654.664) * (-654.386) (-653.082) (-654.369) [-654.605] -- 0:00:05
911000 -- (-657.259) (-655.729) [-655.964] (-656.023) * (-654.718) [-653.589] (-654.471) (-660.090) -- 0:00:05
911500 -- (-654.006) (-654.067) (-655.681) [-655.436] * [-654.656] (-656.002) (-654.480) (-656.420) -- 0:00:05
912000 -- [-654.724] (-656.760) (-654.773) (-655.972) * [-654.418] (-655.833) (-656.460) (-655.977) -- 0:00:05
912500 -- (-654.100) (-656.385) [-653.558] (-657.475) * (-655.125) [-654.481] (-659.637) (-655.399) -- 0:00:05
913000 -- (-658.277) (-654.632) (-653.683) [-653.131] * (-657.948) (-655.355) [-657.625] (-655.024) -- 0:00:05
913500 -- (-654.934) [-654.740] (-653.638) (-654.121) * (-659.486) (-653.640) [-656.221] (-653.675) -- 0:00:05
914000 -- (-657.497) [-654.525] (-654.124) (-661.883) * (-654.306) [-653.791] (-654.733) (-652.966) -- 0:00:05
914500 -- (-660.345) (-652.647) [-653.994] (-661.879) * [-656.091] (-654.884) (-655.342) (-653.052) -- 0:00:05
915000 -- (-654.767) (-653.102) [-653.287] (-657.340) * [-655.975] (-657.056) (-659.380) (-653.405) -- 0:00:05
Average standard deviation of split frequencies: 0.008202
915500 -- (-652.615) [-657.722] (-657.575) (-658.495) * (-657.923) [-658.460] (-654.317) (-653.500) -- 0:00:05
916000 -- (-652.893) [-654.292] (-653.859) (-658.318) * [-658.109] (-660.315) (-653.641) (-655.161) -- 0:00:05
916500 -- (-652.935) [-655.458] (-657.365) (-660.447) * (-658.247) (-656.014) (-653.800) [-655.400] -- 0:00:05
917000 -- (-653.820) (-653.170) [-653.566] (-657.568) * [-654.620] (-655.723) (-653.581) (-656.066) -- 0:00:05
917500 -- (-654.197) (-654.633) [-654.729] (-654.208) * (-656.425) (-660.193) [-653.816] (-654.311) -- 0:00:05
918000 -- [-653.678] (-654.038) (-653.119) (-654.539) * (-654.244) (-653.207) [-653.500] (-653.668) -- 0:00:05
918500 -- (-656.434) (-654.705) (-653.353) [-653.499] * (-654.969) [-656.731] (-654.363) (-655.695) -- 0:00:05
919000 -- (-653.834) [-654.508] (-654.335) (-654.660) * (-658.001) (-657.980) (-656.693) [-657.394] -- 0:00:05
919500 -- (-655.915) [-654.675] (-653.997) (-656.177) * (-653.800) (-656.797) [-653.769] (-653.572) -- 0:00:05
920000 -- (-654.099) (-653.755) [-654.116] (-655.599) * (-657.056) (-654.958) [-656.146] (-653.567) -- 0:00:05
Average standard deviation of split frequencies: 0.008416
920500 -- (-659.925) (-657.932) [-653.784] (-656.105) * (-660.482) [-653.209] (-654.183) (-656.209) -- 0:00:05
921000 -- (-653.731) (-654.605) [-655.134] (-658.088) * (-656.424) [-656.172] (-655.312) (-655.390) -- 0:00:05
921500 -- (-654.840) [-653.779] (-653.225) (-656.607) * [-654.271] (-654.221) (-654.040) (-656.095) -- 0:00:05
922000 -- (-654.439) [-656.916] (-653.109) (-656.640) * [-656.034] (-656.146) (-654.621) (-655.362) -- 0:00:05
922500 -- (-656.512) (-653.600) (-655.304) [-656.331] * [-654.164] (-654.857) (-654.626) (-657.743) -- 0:00:05
923000 -- [-655.787] (-652.934) (-653.125) (-653.618) * [-653.293] (-655.360) (-657.632) (-656.386) -- 0:00:05
923500 -- [-653.422] (-654.758) (-654.642) (-657.946) * [-654.044] (-655.165) (-656.246) (-656.555) -- 0:00:05
924000 -- (-653.999) (-658.615) [-654.484] (-654.772) * (-653.215) [-654.744] (-655.341) (-654.980) -- 0:00:05
924500 -- (-653.080) [-657.053] (-655.408) (-653.614) * (-656.976) [-654.796] (-654.090) (-656.531) -- 0:00:05
925000 -- (-655.188) (-653.298) [-657.804] (-656.685) * (-655.542) (-654.571) (-659.855) [-653.867] -- 0:00:05
Average standard deviation of split frequencies: 0.008336
925500 -- (-653.228) (-654.691) (-656.448) [-653.693] * (-654.676) [-653.481] (-656.599) (-656.285) -- 0:00:04
926000 -- [-654.761] (-653.145) (-655.523) (-653.832) * [-652.954] (-653.603) (-658.196) (-655.136) -- 0:00:04
926500 -- (-653.540) (-653.224) (-656.297) [-653.136] * (-654.998) [-653.638] (-656.500) (-653.344) -- 0:00:04
927000 -- [-655.247] (-652.800) (-654.563) (-662.002) * (-657.893) (-653.829) (-656.490) [-655.383] -- 0:00:04
927500 -- (-653.940) (-654.345) [-655.507] (-657.570) * (-657.498) (-655.836) (-656.884) [-656.939] -- 0:00:04
928000 -- [-657.532] (-654.465) (-658.667) (-654.175) * (-657.324) [-654.599] (-655.709) (-656.099) -- 0:00:04
928500 -- (-654.531) (-656.532) (-657.286) [-655.868] * (-655.626) [-656.508] (-658.694) (-654.166) -- 0:00:04
929000 -- [-653.749] (-656.016) (-654.591) (-657.210) * [-657.645] (-657.725) (-654.241) (-659.162) -- 0:00:04
929500 -- (-654.651) (-658.276) (-653.223) [-654.601] * (-655.365) (-655.733) (-653.372) [-653.599] -- 0:00:04
930000 -- (-655.107) [-655.541] (-656.169) (-657.173) * [-654.813] (-658.280) (-655.680) (-654.687) -- 0:00:04
Average standard deviation of split frequencies: 0.008009
930500 -- (-657.659) (-662.701) [-655.595] (-656.261) * [-658.214] (-654.233) (-657.167) (-654.933) -- 0:00:04
931000 -- (-656.015) (-658.496) [-653.273] (-657.686) * (-655.330) [-652.934] (-656.709) (-655.171) -- 0:00:04
931500 -- (-654.909) [-657.906] (-653.145) (-658.196) * (-655.366) [-653.112] (-654.901) (-653.625) -- 0:00:04
932000 -- (-653.717) (-658.109) [-653.865] (-658.603) * (-655.709) (-654.987) (-655.015) [-654.148] -- 0:00:04
932500 -- (-654.097) [-655.510] (-653.019) (-653.785) * (-654.591) (-658.670) [-654.264] (-653.956) -- 0:00:04
933000 -- (-655.473) (-653.627) [-653.564] (-656.937) * (-653.427) (-658.111) (-654.237) [-654.847] -- 0:00:04
933500 -- [-653.549] (-654.631) (-657.532) (-656.317) * [-654.442] (-655.765) (-654.395) (-652.885) -- 0:00:04
934000 -- (-653.898) (-654.122) (-654.279) [-654.810] * (-654.767) [-653.149] (-655.414) (-656.460) -- 0:00:04
934500 -- (-653.393) (-656.509) [-653.793] (-665.696) * [-655.300] (-653.149) (-654.667) (-654.842) -- 0:00:04
935000 -- (-654.839) (-660.436) [-654.597] (-657.679) * (-654.893) [-655.679] (-657.895) (-655.196) -- 0:00:04
Average standard deviation of split frequencies: 0.007460
935500 -- [-654.725] (-655.625) (-654.007) (-656.055) * [-654.090] (-655.134) (-657.745) (-656.268) -- 0:00:04
936000 -- (-654.422) [-654.769] (-655.622) (-657.678) * (-652.824) [-654.407] (-656.011) (-655.387) -- 0:00:04
936500 -- (-653.932) (-658.403) [-653.908] (-655.681) * (-653.562) [-654.381] (-657.784) (-653.972) -- 0:00:04
937000 -- (-655.281) [-654.980] (-659.225) (-654.650) * (-654.372) (-654.344) [-653.651] (-656.353) -- 0:00:04
937500 -- (-654.130) [-653.359] (-654.788) (-653.826) * (-654.718) (-656.185) [-658.401] (-658.309) -- 0:00:04
938000 -- (-653.535) [-652.993] (-656.012) (-655.864) * (-657.895) [-656.267] (-659.045) (-655.012) -- 0:00:04
938500 -- (-655.575) [-656.368] (-653.758) (-656.725) * (-658.617) (-655.182) (-656.861) [-652.871] -- 0:00:04
939000 -- (-653.413) (-656.885) [-655.840] (-655.720) * (-657.524) [-654.766] (-660.311) (-655.852) -- 0:00:04
939500 -- (-655.165) (-660.541) [-654.511] (-654.269) * (-654.285) [-655.300] (-653.462) (-656.861) -- 0:00:04
940000 -- (-657.731) (-656.662) [-659.596] (-653.030) * (-653.351) (-654.610) (-654.274) [-655.383] -- 0:00:04
Average standard deviation of split frequencies: 0.007423
940500 -- (-655.314) (-655.762) [-656.474] (-653.076) * (-655.040) (-654.442) (-655.747) [-654.642] -- 0:00:03
941000 -- (-654.415) (-655.109) (-657.336) [-657.649] * (-655.818) (-654.893) (-657.463) [-653.417] -- 0:00:03
941500 -- [-655.324] (-656.222) (-654.262) (-657.179) * (-652.929) (-654.445) (-653.707) [-653.558] -- 0:00:03
942000 -- [-653.753] (-656.903) (-655.327) (-654.235) * (-653.525) (-656.216) (-656.224) [-655.367] -- 0:00:03
942500 -- [-653.441] (-653.829) (-657.284) (-659.059) * (-655.470) [-656.633] (-653.237) (-657.799) -- 0:00:03
943000 -- (-653.833) [-656.291] (-655.873) (-655.427) * (-657.361) (-658.052) (-654.281) [-658.834] -- 0:00:03
943500 -- (-653.766) (-656.744) (-656.880) [-656.824] * [-657.741] (-658.056) (-654.523) (-657.234) -- 0:00:03
944000 -- (-655.841) (-654.511) (-661.046) [-653.531] * (-658.728) (-654.553) [-653.550] (-653.271) -- 0:00:03
944500 -- (-653.312) (-654.739) (-655.338) [-656.131] * [-653.815] (-654.312) (-654.367) (-653.002) -- 0:00:03
945000 -- (-652.951) (-656.237) (-654.741) [-652.558] * [-653.629] (-656.698) (-653.653) (-655.880) -- 0:00:03
Average standard deviation of split frequencies: 0.007039
945500 -- (-653.985) (-655.033) (-652.988) [-652.912] * (-653.489) (-654.642) (-655.206) [-653.331] -- 0:00:03
946000 -- (-655.437) (-654.761) (-654.936) [-652.706] * (-655.395) (-655.488) (-656.350) [-654.761] -- 0:00:03
946500 -- [-654.257] (-653.743) (-656.563) (-657.059) * (-656.876) [-652.823] (-653.416) (-657.458) -- 0:00:03
947000 -- (-657.925) [-654.329] (-660.433) (-653.853) * (-654.810) (-660.683) (-653.207) [-655.159] -- 0:00:03
947500 -- (-660.074) (-656.852) [-654.690] (-653.085) * [-653.393] (-659.867) (-653.885) (-657.280) -- 0:00:03
948000 -- [-654.304] (-655.971) (-657.553) (-656.701) * [-653.126] (-656.711) (-653.295) (-657.671) -- 0:00:03
948500 -- (-654.155) (-652.909) [-660.711] (-664.051) * [-652.982] (-656.070) (-658.568) (-654.092) -- 0:00:03
949000 -- (-658.571) [-653.174] (-662.448) (-653.427) * (-655.228) (-654.590) [-654.327] (-654.933) -- 0:00:03
949500 -- (-654.525) [-653.391] (-661.328) (-653.284) * (-657.381) (-652.636) (-653.559) [-657.098] -- 0:00:03
950000 -- (-655.580) [-653.551] (-659.356) (-653.390) * (-655.099) (-655.164) [-653.824] (-662.541) -- 0:00:03
Average standard deviation of split frequencies: 0.007159
950500 -- (-655.347) [-657.007] (-653.914) (-654.150) * [-656.643] (-654.944) (-653.140) (-661.294) -- 0:00:03
951000 -- [-654.766] (-657.776) (-654.072) (-656.033) * [-656.493] (-654.852) (-654.995) (-654.212) -- 0:00:03
951500 -- (-655.761) [-654.675] (-653.329) (-654.173) * (-656.462) (-659.061) [-654.840] (-654.916) -- 0:00:03
952000 -- (-658.276) [-657.709] (-654.419) (-653.552) * (-655.328) (-654.877) (-658.298) [-653.870] -- 0:00:03
952500 -- (-655.237) (-657.727) [-658.816] (-653.854) * (-653.193) (-662.718) [-653.186] (-654.474) -- 0:00:03
953000 -- (-654.965) [-653.688] (-653.957) (-654.313) * (-653.630) [-658.242] (-656.047) (-655.403) -- 0:00:03
953500 -- (-654.049) (-655.002) [-656.455] (-655.782) * (-658.015) (-656.444) [-654.706] (-656.777) -- 0:00:03
954000 -- [-655.312] (-653.907) (-653.906) (-657.372) * (-653.961) [-655.057] (-653.165) (-652.972) -- 0:00:03
954500 -- (-654.661) [-653.798] (-654.161) (-655.211) * (-654.211) (-655.008) (-655.610) [-655.370] -- 0:00:03
955000 -- (-653.670) (-653.169) (-655.213) [-655.652] * (-654.397) (-657.502) [-655.126] (-657.031) -- 0:00:03
Average standard deviation of split frequencies: 0.007304
955500 -- (-657.179) (-655.085) (-654.102) [-655.349] * (-654.232) (-658.473) [-654.300] (-655.117) -- 0:00:02
956000 -- (-654.625) (-653.952) (-655.390) [-655.043] * (-654.572) (-656.654) [-654.613] (-655.242) -- 0:00:02
956500 -- (-653.885) (-655.977) (-654.127) [-653.575] * (-655.927) (-655.531) [-655.503] (-656.823) -- 0:00:02
957000 -- (-662.878) (-653.981) (-655.399) [-654.125] * (-656.001) (-653.769) (-654.705) [-656.160] -- 0:00:02
957500 -- (-653.036) (-656.766) (-652.896) [-654.811] * (-655.287) (-654.109) (-654.630) [-653.769] -- 0:00:02
958000 -- [-653.910] (-658.181) (-654.501) (-662.558) * [-655.115] (-657.019) (-658.885) (-654.328) -- 0:00:02
958500 -- [-653.405] (-654.271) (-654.575) (-655.962) * [-657.587] (-659.263) (-657.736) (-657.393) -- 0:00:02
959000 -- [-656.343] (-654.665) (-656.189) (-654.969) * [-652.711] (-658.265) (-655.490) (-657.388) -- 0:00:02
959500 -- (-655.838) [-654.957] (-654.092) (-654.946) * (-654.407) [-653.030] (-658.681) (-654.813) -- 0:00:02
960000 -- (-654.467) (-654.550) (-654.661) [-653.531] * [-653.723] (-656.178) (-656.130) (-656.693) -- 0:00:02
Average standard deviation of split frequencies: 0.007483
960500 -- (-653.583) (-656.126) (-655.563) [-652.887] * (-655.846) (-654.343) (-654.896) [-656.582] -- 0:00:02
961000 -- (-658.345) (-655.429) (-653.162) [-653.650] * (-657.140) (-654.406) [-654.531] (-657.567) -- 0:00:02
961500 -- (-653.280) [-657.229] (-653.846) (-654.785) * (-656.044) (-655.071) (-653.790) [-655.782] -- 0:00:02
962000 -- (-655.585) (-655.315) [-655.060] (-655.410) * (-662.571) [-654.368] (-654.111) (-661.694) -- 0:00:02
962500 -- [-654.472] (-659.870) (-656.164) (-655.143) * (-656.653) (-653.441) [-656.666] (-656.232) -- 0:00:02
963000 -- [-655.317] (-655.514) (-656.585) (-655.220) * [-656.172] (-655.203) (-657.417) (-657.343) -- 0:00:02
963500 -- (-653.740) (-653.568) [-653.715] (-656.937) * [-657.054] (-654.487) (-661.591) (-655.853) -- 0:00:02
964000 -- (-654.278) (-655.982) (-656.554) [-654.250] * (-658.124) (-655.828) [-654.428] (-654.154) -- 0:00:02
964500 -- (-653.715) (-657.627) (-656.034) [-656.380] * [-654.941] (-656.753) (-654.265) (-653.777) -- 0:00:02
965000 -- (-659.978) (-655.437) (-656.110) [-656.504] * (-655.087) (-653.794) [-655.352] (-655.813) -- 0:00:02
Average standard deviation of split frequencies: 0.007472
965500 -- (-660.159) (-653.065) [-655.712] (-653.953) * (-654.844) (-656.593) (-655.046) [-655.785] -- 0:00:02
966000 -- (-655.461) (-655.047) [-655.130] (-653.075) * [-655.306] (-655.172) (-657.099) (-656.976) -- 0:00:02
966500 -- [-657.880] (-656.527) (-656.269) (-653.327) * (-656.901) (-657.909) [-654.653] (-658.167) -- 0:00:02
967000 -- (-653.984) (-657.459) [-660.053] (-653.428) * (-653.868) [-656.735] (-655.952) (-656.452) -- 0:00:02
967500 -- (-653.255) (-660.929) [-653.264] (-653.719) * (-654.095) [-655.122] (-653.693) (-654.733) -- 0:00:02
968000 -- (-656.259) (-657.537) (-655.869) [-656.835] * (-655.260) (-654.021) [-655.533] (-656.064) -- 0:00:02
968500 -- (-655.950) (-654.501) (-655.481) [-656.821] * (-656.666) (-654.144) (-654.098) [-656.096] -- 0:00:02
969000 -- (-662.631) (-657.039) [-658.791] (-656.860) * [-656.668] (-654.033) (-658.098) (-665.163) -- 0:00:02
969500 -- [-657.221] (-653.929) (-654.029) (-662.063) * (-656.032) (-657.326) [-656.133] (-658.621) -- 0:00:02
970000 -- (-653.680) (-654.064) (-656.092) [-653.041] * (-655.187) (-653.687) [-656.241] (-655.458) -- 0:00:02
Average standard deviation of split frequencies: 0.007188
970500 -- (-654.975) (-653.315) [-656.000] (-654.341) * (-654.514) (-657.537) [-657.684] (-655.587) -- 0:00:01
971000 -- (-653.878) (-659.990) [-656.735] (-653.214) * [-654.819] (-659.890) (-653.687) (-656.758) -- 0:00:01
971500 -- [-654.972] (-656.565) (-658.220) (-654.357) * (-654.639) [-654.253] (-653.198) (-654.253) -- 0:00:01
972000 -- (-656.323) (-659.812) (-658.243) [-653.978] * (-654.601) (-654.463) [-654.380] (-655.703) -- 0:00:01
972500 -- (-654.246) [-654.991] (-655.071) (-653.135) * (-656.004) (-655.167) (-660.621) [-653.229] -- 0:00:01
973000 -- [-655.780] (-655.249) (-654.525) (-656.640) * (-659.379) (-656.552) [-659.176] (-654.097) -- 0:00:01
973500 -- [-654.457] (-655.135) (-654.484) (-653.610) * (-654.964) (-654.900) [-657.370] (-661.034) -- 0:00:01
974000 -- (-656.204) [-658.219] (-654.034) (-653.100) * (-654.397) (-657.871) [-655.797] (-661.078) -- 0:00:01
974500 -- (-656.242) (-654.790) [-654.566] (-653.052) * (-656.892) [-657.905] (-654.666) (-654.165) -- 0:00:01
975000 -- (-654.533) [-653.968] (-654.457) (-658.813) * (-653.320) [-654.600] (-653.093) (-656.186) -- 0:00:01
Average standard deviation of split frequencies: 0.007535
975500 -- [-653.230] (-657.168) (-659.198) (-656.305) * [-653.457] (-656.317) (-652.712) (-657.694) -- 0:00:01
976000 -- (-657.839) [-653.716] (-656.918) (-654.897) * [-654.268] (-654.925) (-656.185) (-658.430) -- 0:00:01
976500 -- (-657.385) (-653.680) (-656.815) [-655.532] * (-654.391) (-655.161) (-655.812) [-655.154] -- 0:00:01
977000 -- (-657.186) [-653.604] (-654.066) (-656.745) * (-656.982) (-655.293) (-654.069) [-657.205] -- 0:00:01
977500 -- (-654.163) (-653.429) (-653.865) [-653.589] * (-657.623) (-654.727) [-655.424] (-654.468) -- 0:00:01
978000 -- (-657.224) (-657.335) [-656.317] (-654.826) * (-653.928) (-655.503) [-652.993] (-653.987) -- 0:00:01
978500 -- (-655.817) (-654.703) [-655.524] (-653.359) * (-654.829) (-658.451) (-653.396) [-654.357] -- 0:00:01
979000 -- (-654.978) [-653.503] (-653.564) (-656.422) * (-654.849) (-660.229) (-653.185) [-655.534] -- 0:00:01
979500 -- (-655.278) [-653.744] (-653.719) (-656.501) * [-653.755] (-658.244) (-653.747) (-653.803) -- 0:00:01
980000 -- (-654.643) (-656.542) [-654.358] (-653.505) * [-653.626] (-657.633) (-654.472) (-654.878) -- 0:00:01
Average standard deviation of split frequencies: 0.007851
980500 -- [-653.942] (-657.032) (-658.580) (-655.143) * (-654.606) (-658.845) (-655.351) [-653.242] -- 0:00:01
981000 -- (-654.916) (-657.016) (-655.875) [-654.563] * (-654.251) (-660.423) [-655.777] (-657.386) -- 0:00:01
981500 -- [-655.267] (-661.355) (-659.599) (-659.512) * (-657.784) (-654.284) (-653.533) [-655.972] -- 0:00:01
982000 -- (-656.250) (-653.642) [-656.317] (-655.153) * (-655.860) (-656.833) (-656.701) [-653.783] -- 0:00:01
982500 -- [-656.563] (-653.934) (-656.637) (-653.971) * (-653.053) (-660.880) (-657.821) [-657.710] -- 0:00:01
983000 -- (-655.112) (-653.936) [-655.643] (-654.228) * [-653.657] (-655.350) (-653.899) (-655.683) -- 0:00:01
983500 -- (-654.367) (-654.312) [-655.336] (-659.619) * (-653.665) (-654.751) [-654.634] (-656.710) -- 0:00:01
984000 -- [-656.068] (-655.654) (-653.977) (-656.759) * [-656.030] (-656.182) (-653.342) (-655.836) -- 0:00:01
984500 -- (-656.608) (-654.068) (-655.159) [-656.810] * (-654.782) (-657.207) (-653.102) [-653.641] -- 0:00:01
985000 -- (-655.116) (-654.188) (-654.080) [-654.358] * (-656.210) (-654.912) (-655.758) [-654.139] -- 0:00:01
Average standard deviation of split frequencies: 0.007650
985500 -- (-656.320) (-653.348) (-655.991) [-659.697] * (-654.927) (-653.240) (-655.394) [-653.788] -- 0:00:00
986000 -- (-653.946) [-653.523] (-657.176) (-654.218) * (-654.359) (-658.231) (-654.400) [-653.858] -- 0:00:00
986500 -- (-654.358) (-653.745) [-655.000] (-654.716) * (-654.889) [-659.407] (-658.617) (-656.192) -- 0:00:00
987000 -- (-655.191) (-657.489) [-655.305] (-652.858) * (-655.783) (-652.798) [-655.201] (-654.403) -- 0:00:00
987500 -- (-658.481) (-662.493) [-654.996] (-653.202) * [-654.121] (-653.478) (-655.005) (-658.085) -- 0:00:00
988000 -- [-653.708] (-658.193) (-653.576) (-655.460) * (-653.979) [-655.566] (-654.158) (-658.421) -- 0:00:00
988500 -- (-655.062) [-654.724] (-653.635) (-654.688) * [-656.010] (-653.824) (-658.277) (-655.740) -- 0:00:00
989000 -- (-653.909) (-653.801) (-654.352) [-656.989] * [-653.149] (-656.751) (-659.683) (-657.062) -- 0:00:00
989500 -- (-655.202) (-654.075) (-653.493) [-658.220] * [-653.872] (-653.100) (-656.375) (-653.540) -- 0:00:00
990000 -- (-656.626) [-655.840] (-654.706) (-654.554) * (-653.814) [-656.032] (-654.867) (-654.792) -- 0:00:00
Average standard deviation of split frequencies: 0.007703
990500 -- (-656.676) [-655.118] (-654.226) (-655.291) * [-653.888] (-654.614) (-654.074) (-655.103) -- 0:00:00
991000 -- (-657.610) (-659.724) (-656.954) [-653.920] * [-653.594] (-654.594) (-655.018) (-654.837) -- 0:00:00
991500 -- [-655.610] (-662.755) (-654.991) (-655.118) * (-652.883) (-654.999) (-654.555) [-652.741] -- 0:00:00
992000 -- (-655.949) (-657.199) [-654.600] (-654.283) * [-654.070] (-653.837) (-654.198) (-653.561) -- 0:00:00
992500 -- (-654.003) (-657.621) [-655.498] (-654.158) * [-655.639] (-654.927) (-653.237) (-658.190) -- 0:00:00
993000 -- (-653.999) (-659.978) [-654.939] (-654.027) * (-656.634) (-653.264) (-658.366) [-654.350] -- 0:00:00
993500 -- (-654.750) [-655.790] (-653.939) (-657.256) * (-653.387) (-654.294) [-653.092] (-654.025) -- 0:00:00
994000 -- (-655.803) (-654.881) (-655.820) [-657.596] * (-653.324) [-653.319] (-658.043) (-653.230) -- 0:00:00
994500 -- (-653.639) [-653.608] (-652.982) (-654.565) * [-653.289] (-655.126) (-656.568) (-657.148) -- 0:00:00
995000 -- (-654.767) (-654.294) [-654.160] (-658.562) * [-653.959] (-654.267) (-655.972) (-652.824) -- 0:00:00
Average standard deviation of split frequencies: 0.007731
995500 -- (-656.030) [-654.719] (-654.215) (-661.094) * (-653.459) [-654.220] (-660.330) (-658.209) -- 0:00:00
996000 -- (-655.057) (-654.875) [-654.251] (-656.263) * [-652.902] (-654.769) (-654.500) (-653.540) -- 0:00:00
996500 -- (-658.008) (-655.989) (-654.733) [-655.401] * (-654.100) (-655.547) [-657.413] (-658.217) -- 0:00:00
997000 -- [-652.795] (-653.721) (-653.906) (-653.465) * (-654.602) (-653.067) (-656.115) [-654.751] -- 0:00:00
997500 -- (-653.663) [-653.355] (-653.885) (-659.564) * (-655.396) [-653.809] (-654.539) (-653.861) -- 0:00:00
998000 -- (-654.467) [-654.509] (-653.880) (-656.211) * (-654.843) [-656.623] (-654.848) (-653.782) -- 0:00:00
998500 -- (-656.346) (-654.461) (-657.780) [-654.730] * (-654.076) (-657.239) (-654.834) [-654.818] -- 0:00:00
999000 -- [-652.563] (-654.253) (-656.997) (-654.237) * (-655.623) (-657.652) (-655.063) [-654.969] -- 0:00:00
999500 -- (-653.647) (-656.740) (-653.535) [-655.401] * (-654.683) (-657.113) (-653.617) [-656.383] -- 0:00:00
1000000 -- (-653.620) (-654.993) (-654.677) [-656.188] * [-654.710] (-653.871) (-653.252) (-655.974) -- 0:00:00
Average standard deviation of split frequencies: 0.007506
Analysis completed in 1 mins 6 seconds
Analysis used 65.03 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -652.50
Likelihood of best state for "cold" chain of run 2 was -652.50
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
31.9 % ( 27 %) Dirichlet(Pi{all})
32.8 % ( 31 %) Slider(Pi{all})
78.7 % ( 47 %) Multiplier(Alpha{1,2})
77.4 % ( 56 %) Multiplier(Alpha{3})
24.8 % ( 26 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.3 % ( 19 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
31.4 % ( 24 %) Dirichlet(Pi{all})
32.2 % ( 18 %) Slider(Pi{all})
79.1 % ( 59 %) Multiplier(Alpha{1,2})
77.9 % ( 55 %) Multiplier(Alpha{3})
22.6 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 79 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 34 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.3 % ( 33 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166908 0.83 0.67
3 | 166198 167187 0.84
4 | 166958 166116 166633
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167193 0.82 0.67
3 | 166521 166835 0.84
4 | 166603 166276 166572
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -654.22
| 2 2 2 |
| 2 1 |
| 2 1 21 1 1 2 2|
| 1 1 2 2 2 1 1 2 2 12 |
| 2 2 * 2 1 |
| * 1 1 1 1 * 1 1 22 1 212 2 12 2 |
|2 2* 1 1 121 2 2 2 2 1* 11|
|1 2 1 2 112 22 1 2 2*11 2 1 1 1 |
| 2 1 2 2 2 1 1 1 2 2 |
| 1 2 2 1 1 1 2 1 1 |
| * 2 1 |
| 2 1 1 1 |
| 1 1 |
| 2 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -656.09
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -654.27 -657.12
2 -654.21 -658.28
--------------------------------------
TOTAL -654.24 -657.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888514 0.088629 0.375146 1.483672 0.851039 1420.45 1460.73 1.000
r(A<->C){all} 0.153201 0.016744 0.000043 0.405999 0.118647 174.74 225.03 1.002
r(A<->G){all} 0.179335 0.022460 0.000038 0.483450 0.140998 212.16 221.06 1.004
r(A<->T){all} 0.159330 0.017737 0.000060 0.427189 0.123242 159.04 216.62 1.000
r(C<->G){all} 0.161855 0.018476 0.000086 0.430613 0.127731 160.69 281.23 1.001
r(C<->T){all} 0.186836 0.023737 0.000120 0.495206 0.146767 239.01 296.85 1.004
r(G<->T){all} 0.159443 0.019027 0.000012 0.441117 0.122458 197.32 255.42 1.001
pi(A){all} 0.250571 0.000401 0.207994 0.285566 0.250584 1343.69 1344.14 1.000
pi(C){all} 0.325034 0.000461 0.285584 0.369667 0.324685 1107.87 1173.54 1.000
pi(G){all} 0.274715 0.000414 0.234658 0.314731 0.274128 1065.17 1264.05 1.000
pi(T){all} 0.149681 0.000261 0.117448 0.180889 0.149252 1084.50 1188.49 1.000
alpha{1,2} 0.412857 0.217771 0.000166 1.337471 0.247888 1226.43 1344.00 1.001
alpha{3} 0.439860 0.222823 0.000152 1.403974 0.278780 1212.74 1242.61 1.000
pinvar{all} 0.996716 0.000016 0.989474 0.999998 0.997962 1385.37 1438.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .*..*.
9 -- ..*.*.
10 -- .*.*..
11 -- ..*..*
12 -- .****.
13 -- .*.***
14 -- ...**.
15 -- .**.**
16 -- ..****
17 -- ..**..
18 -- .*...*
19 -- ....**
20 -- .***.*
21 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 465 0.154897 0.018373 0.141905 0.167888 2
8 459 0.152898 0.006124 0.148568 0.157229 2
9 459 0.152898 0.009893 0.145903 0.159893 2
10 454 0.151233 0.010364 0.143904 0.158561 2
11 443 0.147568 0.003298 0.145237 0.149900 2
12 434 0.144570 0.000942 0.143904 0.145237 2
13 425 0.141572 0.008009 0.135909 0.147235 2
14 421 0.140240 0.004240 0.137242 0.143238 2
15 418 0.139241 0.004711 0.135909 0.142572 2
16 416 0.138574 0.014133 0.128581 0.148568 2
17 416 0.138574 0.023555 0.121919 0.155230 2
18 415 0.138241 0.000471 0.137908 0.138574 2
19 412 0.137242 0.002827 0.135243 0.139241 2
20 405 0.134910 0.001413 0.133911 0.135909 2
21 383 0.127582 0.004240 0.124584 0.130580 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096347 0.009052 0.000027 0.284695 0.067836 1.001 2
length{all}[2] 0.098742 0.009971 0.000007 0.288137 0.068039 1.000 2
length{all}[3] 0.097216 0.009675 0.000017 0.293633 0.067543 1.000 2
length{all}[4] 0.099090 0.009591 0.000052 0.301503 0.070499 1.000 2
length{all}[5] 0.099293 0.009486 0.000038 0.295501 0.070674 1.000 2
length{all}[6] 0.099286 0.010251 0.000023 0.290969 0.069236 1.000 2
length{all}[7] 0.093992 0.009398 0.000157 0.267927 0.067337 0.998 2
length{all}[8] 0.106521 0.011241 0.000140 0.353836 0.074991 0.999 2
length{all}[9] 0.094323 0.008513 0.000119 0.276951 0.071841 1.001 2
length{all}[10] 0.108313 0.011761 0.000470 0.323396 0.077391 1.002 2
length{all}[11] 0.104987 0.011852 0.000089 0.329081 0.069592 0.999 2
length{all}[12] 0.103418 0.013126 0.000708 0.312606 0.066176 0.999 2
length{all}[13] 0.099266 0.008889 0.000290 0.266928 0.078923 1.002 2
length{all}[14] 0.100069 0.011225 0.000465 0.310300 0.067504 1.000 2
length{all}[15] 0.095102 0.009558 0.000070 0.287375 0.062683 0.998 2
length{all}[16] 0.098159 0.009753 0.000111 0.295435 0.066032 0.998 2
length{all}[17] 0.103754 0.011334 0.000789 0.320672 0.072392 1.001 2
length{all}[18] 0.093161 0.009297 0.000012 0.302921 0.062895 0.998 2
length{all}[19] 0.107467 0.012152 0.000052 0.304106 0.078312 0.998 2
length{all}[20] 0.089113 0.007194 0.000364 0.271869 0.064194 0.998 2
length{all}[21] 0.098483 0.009556 0.000241 0.290080 0.066549 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007506
Maximum standard deviation of split frequencies = 0.023555
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 483
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 161 / 161 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 161 / 161 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.045633 0.068290 0.021121 0.095105 0.093152 0.039328 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -663.335862
Iterating by ming2
Initial: fx= 663.335862
x= 0.04563 0.06829 0.02112 0.09510 0.09315 0.03933 0.30000 1.30000
1 h-m-p 0.0000 0.0001 385.2200 ++ 643.539906 m 0.0001 13 | 1/8
2 h-m-p 0.0009 0.0058 52.2274 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 352.7014 ++ 629.176900 m 0.0001 44 | 2/8
4 h-m-p 0.0009 0.0079 38.5460 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 316.2429 ++ 625.177930 m 0.0000 75 | 3/8
6 h-m-p 0.0004 0.0105 29.2050 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 273.6425 ++ 614.343216 m 0.0001 105 | 4/8
8 h-m-p 0.0015 0.0148 20.8973 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 224.1374 ++ 606.318428 m 0.0002 136 | 5/8
10 h-m-p 0.0022 0.0279 11.4492 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 159.3491 ++ 606.000565 m 0.0000 168 | 6/8
12 h-m-p 0.0172 8.0000 0.0000 +C 606.000565 0 0.0688 180 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 -----Y 606.000565 0 0.0003 198
Out..
lnL = -606.000565
199 lfun, 199 eigenQcodon, 1194 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.085101 0.047736 0.075859 0.021036 0.056359 0.091535 0.299836 0.643515 0.110247
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.887859
np = 9
lnL0 = -660.656796
Iterating by ming2
Initial: fx= 660.656796
x= 0.08510 0.04774 0.07586 0.02104 0.05636 0.09153 0.29984 0.64351 0.11025
1 h-m-p 0.0000 0.0002 323.5910 ++ 643.727961 m 0.0002 14 | 1/9
2 h-m-p 0.0001 0.0005 254.8635 ++ 623.993670 m 0.0005 26 | 2/9
3 h-m-p 0.0000 0.0000 14996.1019 ++ 622.395496 m 0.0000 38 | 3/9
4 h-m-p 0.0002 0.0074 29.7118 +++ 618.114199 m 0.0074 51 | 4/9
5 h-m-p 0.0001 0.0006 101.5687 ++ 608.405590 m 0.0006 63 | 5/9
6 h-m-p 0.0000 0.0001 611.3908 ++ 608.124022 m 0.0001 75 | 6/9
7 h-m-p 0.0000 0.0000 1267.5216 ++ 606.000578 m 0.0000 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0003 ++ 606.000578 m 8.0000 99 | 7/9
9 h-m-p 0.0089 2.8264 0.3054 +++++ 606.000568 m 2.8264 116 | 8/9
10 h-m-p 1.6000 8.0000 0.0521 ++ 606.000560 m 8.0000 130 | 8/9
11 h-m-p 0.3499 8.0000 1.1909 -----------C 606.000560 0 0.0000 154 | 8/9
12 h-m-p 0.0787 8.0000 0.0000 Y 606.000560 0 0.0197 166 | 8/9
13 h-m-p 0.0857 8.0000 0.0000 --------Y 606.000560 0 0.0000 187
Out..
lnL = -606.000560
188 lfun, 564 eigenQcodon, 2256 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.066453 0.047617 0.088082 0.079410 0.095991 0.012982 0.008226 1.327330 0.171403 0.264862 1.327364
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.190900
np = 11
lnL0 = -663.872071
Iterating by ming2
Initial: fx= 663.872071
x= 0.06645 0.04762 0.08808 0.07941 0.09599 0.01298 0.00823 1.32733 0.17140 0.26486 1.32736
1 h-m-p 0.0000 0.0001 339.9886 ++ 653.127656 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0007 226.3968 ++ 626.990940 m 0.0007 30 | 2/11
3 h-m-p 0.0000 0.0000 2626.6392 ++ 619.891917 m 0.0000 44 | 3/11
4 h-m-p 0.0029 0.0146 10.0859 ------------.. | 3/11
5 h-m-p 0.0000 0.0000 298.7384 ++ 616.045678 m 0.0000 82 | 4/11
6 h-m-p 0.0003 0.0023 39.1284 ++ 612.892940 m 0.0023 96 | 5/11
7 h-m-p 0.0003 0.0013 28.7225 ++ 612.788957 m 0.0013 110 | 6/11
8 h-m-p 0.0000 0.0001 112.8767 ++ 610.562902 m 0.0001 124 | 7/11
9 h-m-p 0.0030 0.2314 2.2792 ------------.. | 7/11
10 h-m-p 0.0000 0.0002 153.0283 +++ 606.000570 m 0.0002 163 | 8/11
11 h-m-p 0.9416 8.0000 0.0000 ++ 606.000570 m 8.0000 177 | 8/11
12 h-m-p 0.0160 8.0000 0.0167 +++++ 606.000569 m 8.0000 197 | 8/11
13 h-m-p 0.0811 8.0000 1.6447 +++Y 606.000556 0 4.1862 217 | 8/11
14 h-m-p 1.6000 8.0000 0.1963 ++ 606.000556 m 8.0000 231 | 8/11
15 h-m-p 1.0105 5.0527 1.1883 Y 606.000556 0 0.4311 248 | 8/11
16 h-m-p 1.6000 8.0000 0.1132 ------N 606.000556 0 0.0000 268 | 8/11
17 h-m-p 1.6000 8.0000 0.0000 ++ 606.000556 m 8.0000 285 | 8/11
18 h-m-p 0.0160 8.0000 0.0161 -----C 606.000556 0 0.0000 307 | 8/11
19 h-m-p 0.0160 8.0000 0.0002 +++++ 606.000556 m 8.0000 327 | 8/11
20 h-m-p 0.0160 8.0000 1.7290 +++++ 606.000549 m 8.0000 347 | 8/11
21 h-m-p 1.6000 8.0000 0.3948 ---------Y 606.000549 0 0.0000 370 | 8/11
22 h-m-p 0.7543 8.0000 0.0000 -----Y 606.000549 0 0.0002 392
Out..
lnL = -606.000549
393 lfun, 1572 eigenQcodon, 7074 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -605.997900 S = -605.996869 -0.000394
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:03
did 20 / 48 patterns 0:03
did 30 / 48 patterns 0:03
did 40 / 48 patterns 0:03
did 48 / 48 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.098423 0.032720 0.052594 0.036404 0.027496 0.109955 0.000100 0.251111 1.208664
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 22.381633
np = 9
lnL0 = -658.759432
Iterating by ming2
Initial: fx= 658.759432
x= 0.09842 0.03272 0.05259 0.03640 0.02750 0.10996 0.00011 0.25111 1.20866
1 h-m-p 0.0000 0.0000 338.1341 ++ 657.977334 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0480 21.6684 ++++CYYCCCCCC 653.164097 8 0.0436 45 | 1/9
3 h-m-p 0.0000 0.0002 801.4169 YCCCCC 653.078426 5 0.0000 66 | 1/9
4 h-m-p 0.0218 0.1850 1.4805 -------------.. | 1/9
5 h-m-p 0.0000 0.0002 341.2224 +++ 630.298921 m 0.0002 102 | 2/9
6 h-m-p 0.0000 0.0000 10610.7237 ++ 626.760359 m 0.0000 114 | 3/9
7 h-m-p 0.0003 0.0013 12.4247 ++ 626.741617 m 0.0013 126 | 4/9
8 h-m-p 0.0000 0.0002 75.8707 ++ 624.108504 m 0.0002 138 | 5/9
9 h-m-p 0.0001 0.0019 127.4472 +++ 618.865861 m 0.0019 151 | 5/9
10 h-m-p 0.0036 0.0178 6.5945 ------------.. | 5/9
11 h-m-p 0.0000 0.0001 228.8283 ++ 616.279972 m 0.0001 185 | 6/9
12 h-m-p 0.0000 0.0001 1112.6258 ++ 606.000562 m 0.0001 197 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 ++ 606.000562 m 8.0000 209 | 7/9
14 h-m-p 0.1677 8.0000 0.0000 +++ 606.000562 m 8.0000 224 | 7/9
15 h-m-p 0.0297 1.3211 0.0073 +++ 606.000562 m 1.3211 239 | 8/9
16 h-m-p 1.6000 8.0000 0.0004 -----Y 606.000562 0 0.0004 258 | 8/9
17 h-m-p 0.0160 8.0000 0.0000 +Y 606.000562 0 0.0640 272 | 8/9
18 h-m-p 0.0160 8.0000 0.0000 -Y 606.000562 0 0.0010 286 | 8/9
19 h-m-p 0.0160 8.0000 0.0000 N 606.000562 0 0.0040 299 | 8/9
20 h-m-p 0.0160 8.0000 0.0000 ----N 606.000562 0 0.0000 316
Out..
lnL = -606.000562
317 lfun, 3487 eigenQcodon, 19020 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031126 0.071586 0.074947 0.033189 0.036270 0.040159 0.000100 0.900000 1.022300 1.469584 1.300020
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.604605
np = 11
lnL0 = -649.647485
Iterating by ming2
Initial: fx= 649.647485
x= 0.03113 0.07159 0.07495 0.03319 0.03627 0.04016 0.00011 0.90000 1.02230 1.46958 1.30002
1 h-m-p 0.0000 0.0000 355.7789 ++ 648.319944 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0039 91.0324 ++++ 620.018072 m 0.0039 32 | 2/11
3 h-m-p 0.0000 0.0000 48326.8131 ++ 618.502578 m 0.0000 46 | 3/11
4 h-m-p 0.0002 0.0010 18.0631 ++ 618.453850 m 0.0010 60 | 4/11
5 h-m-p 0.0000 0.0001 78.5651 ++ 617.819839 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0002 901.2068 +++ 615.015994 m 0.0002 89 | 6/11
7 h-m-p 0.0008 0.0041 190.3968 ++ 611.178157 m 0.0041 103 | 6/11
8 h-m-p 0.0898 0.4490 3.6932 --------------.. | 6/11
9 h-m-p 0.0000 0.0002 157.0637 +++ 606.000563 m 0.0002 144 | 7/11
10 h-m-p 0.6504 8.0000 0.0000 ++ 606.000563 m 8.0000 158 | 7/11
11 h-m-p 0.0012 0.0058 0.0171 ----C 606.000563 0 0.0000 180 | 7/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 606.000563 m 8.0000 201 | 7/11
13 h-m-p 0.0009 0.4325 1.3018 +++++ 606.000558 m 0.4325 222 | 8/11
14 h-m-p 0.2021 1.8531 1.5962 ++ 606.000551 m 1.8531 236 | 8/11
15 h-m-p -0.0000 -0.0000 0.4999
h-m-p: -1.04232058e-16 -5.21160289e-16 4.99853437e-01 606.000551
.. | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +Y 606.000551 0 0.0640 265 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 C 606.000551 0 0.0040 282 | 8/11
18 h-m-p 0.0160 8.0000 0.0001 -------------.. | 8/11
19 h-m-p 0.0160 8.0000 0.0000 ------------Y 606.000551 0 0.0000 339
Out..
lnL = -606.000551
340 lfun, 4080 eigenQcodon, 22440 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -605.999970 S = -605.997023 -0.001290
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:14
did 20 / 48 patterns 0:15
did 30 / 48 patterns 0:15
did 40 / 48 patterns 0:15
did 48 / 48 patterns 0:15
Time used: 0:15
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=161
NC_011896_1_WP_010908650_1_2097_MLBR_RS09960 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
NC_002677_1_NP_302330_1_1202_lpqH VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
**************************************************
NC_011896_1_WP_010908650_1_2097_MLBR_RS09960 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
NC_002677_1_NP_302330_1_1202_lpqH AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
**************************************************
NC_011896_1_WP_010908650_1_2097_MLBR_RS09960 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
NC_002677_1_NP_302330_1_1202_lpqH VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
**************************************************
NC_011896_1_WP_010908650_1_2097_MLBR_RS09960 HKSFEIEVTCR
NC_002677_1_NP_302330_1_1202_lpqH HKSFEIEVTCR
NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440 HKSFEIEVTCR
NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750 HKSFEIEVTCR
NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790 HKSFEIEVTCR
NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085 HKSFEIEVTCR
***********
>NC_011896_1_WP_010908650_1_2097_MLBR_RS09960 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC >NC_002677_1_NP_302330_1_1202_lpqH GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC >NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC >NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC >NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC >NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>NC_011896_1_WP_010908650_1_2097_MLBR_RS09960 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI HKSFEIEVTCR >NC_002677_1_NP_302330_1_1202_lpqH VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI HKSFEIEVTCR >NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI HKSFEIEVTCR >NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI HKSFEIEVTCR >NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI HKSFEIEVTCR >NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI HKSFEIEVTCR
#NEXUS
[ID: 0043475635]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908650_1_2097_MLBR_RS09960
NC_002677_1_NP_302330_1_1202_lpqH
NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440
NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750
NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790
NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908650_1_2097_MLBR_RS09960,
2 NC_002677_1_NP_302330_1_1202_lpqH,
3 NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440,
4 NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750,
5 NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790,
6 NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0678358,2:0.06803865,3:0.06754314,4:0.0704987,5:0.07067401,6:0.06923626);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0678358,2:0.06803865,3:0.06754314,4:0.0704987,5:0.07067401,6:0.06923626);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -654.27 -657.12
2 -654.21 -658.28
--------------------------------------
TOTAL -654.24 -657.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888514 0.088629 0.375146 1.483672 0.851039 1420.45 1460.73 1.000
r(A<->C){all} 0.153201 0.016744 0.000043 0.405999 0.118647 174.74 225.03 1.002
r(A<->G){all} 0.179335 0.022460 0.000038 0.483450 0.140998 212.16 221.06 1.004
r(A<->T){all} 0.159330 0.017737 0.000060 0.427189 0.123242 159.04 216.62 1.000
r(C<->G){all} 0.161855 0.018476 0.000086 0.430613 0.127731 160.69 281.23 1.001
r(C<->T){all} 0.186836 0.023737 0.000120 0.495206 0.146767 239.01 296.85 1.004
r(G<->T){all} 0.159443 0.019027 0.000012 0.441117 0.122458 197.32 255.42 1.001
pi(A){all} 0.250571 0.000401 0.207994 0.285566 0.250584 1343.69 1344.14 1.000
pi(C){all} 0.325034 0.000461 0.285584 0.369667 0.324685 1107.87 1173.54 1.000
pi(G){all} 0.274715 0.000414 0.234658 0.314731 0.274128 1065.17 1264.05 1.000
pi(T){all} 0.149681 0.000261 0.117448 0.180889 0.149252 1084.50 1188.49 1.000
alpha{1,2} 0.412857 0.217771 0.000166 1.337471 0.247888 1226.43 1344.00 1.001
alpha{3} 0.439860 0.222823 0.000152 1.403974 0.278780 1212.74 1242.61 1.000
pinvar{all} 0.996716 0.000016 0.989474 0.999998 0.997962 1385.37 1438.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/3res/lpqH/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 161
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 2 2 2 2 2 2 | TGC 3 3 3 3 3 3
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 4 4 4 4 4 4 | CAC 0 0 0 0 0 0 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 0 0 0 0 0 0 | CCG 2 2 2 2 2 2 | CAG 4 4 4 4 4 4 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 10 10 10 10 10 10 | ACC 11 11 11 11 11 11 | AAC 6 6 6 6 6 6 | AGC 7 7 7 7 7 7
ATA 2 2 2 2 2 2 | ACA 5 5 5 5 5 5 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 3 3 3 3 3 3 | AAG 4 4 4 4 4 4 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 1 1 1 1 1 1 | Asp GAT 0 0 0 0 0 0 | Gly GGT 4 4 4 4 4 4
GTC 9 9 9 9 9 9 | GCC 10 10 10 10 10 10 | GAC 5 5 5 5 5 5 | GGC 13 13 13 13 13 13
GTA 2 2 2 2 2 2 | GCA 3 3 3 3 3 3 | Glu GAA 3 3 3 3 3 3 | GGA 2 2 2 2 2 2
GTG 5 5 5 5 5 5 | GCG 4 4 4 4 4 4 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908650_1_2097_MLBR_RS09960
position 1: T:0.10559 C:0.11801 A:0.36646 G:0.40994
position 2: T:0.24224 C:0.32298 A:0.22981 G:0.20497
position 3: T:0.09938 C:0.53416 A:0.15528 G:0.21118
Average T:0.14907 C:0.32505 A:0.25052 G:0.27536
#2: NC_002677_1_NP_302330_1_1202_lpqH
position 1: T:0.10559 C:0.11801 A:0.36646 G:0.40994
position 2: T:0.24224 C:0.32298 A:0.22981 G:0.20497
position 3: T:0.09938 C:0.53416 A:0.15528 G:0.21118
Average T:0.14907 C:0.32505 A:0.25052 G:0.27536
#3: NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440
position 1: T:0.10559 C:0.11801 A:0.36646 G:0.40994
position 2: T:0.24224 C:0.32298 A:0.22981 G:0.20497
position 3: T:0.09938 C:0.53416 A:0.15528 G:0.21118
Average T:0.14907 C:0.32505 A:0.25052 G:0.27536
#4: NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750
position 1: T:0.10559 C:0.11801 A:0.36646 G:0.40994
position 2: T:0.24224 C:0.32298 A:0.22981 G:0.20497
position 3: T:0.09938 C:0.53416 A:0.15528 G:0.21118
Average T:0.14907 C:0.32505 A:0.25052 G:0.27536
#5: NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790
position 1: T:0.10559 C:0.11801 A:0.36646 G:0.40994
position 2: T:0.24224 C:0.32298 A:0.22981 G:0.20497
position 3: T:0.09938 C:0.53416 A:0.15528 G:0.21118
Average T:0.14907 C:0.32505 A:0.25052 G:0.27536
#6: NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085
position 1: T:0.10559 C:0.11801 A:0.36646 G:0.40994
position 2: T:0.24224 C:0.32298 A:0.22981 G:0.20497
position 3: T:0.09938 C:0.53416 A:0.15528 G:0.21118
Average T:0.14907 C:0.32505 A:0.25052 G:0.27536
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 6 | TAC 12 | TGC 18
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 18 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 0
CTC 6 | CCC 24 | CAC 0 | CGC 6
CTA 0 | CCA 6 | Gln Q CAA 12 | CGA 0
CTG 0 | CCG 12 | CAG 24 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 6
ATC 60 | ACC 66 | AAC 36 | AGC 42
ATA 12 | ACA 30 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 12 | ACG 18 | AAG 24 | AGG 6
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 6 | Asp D GAT 0 | Gly G GGT 24
GTC 54 | GCC 60 | GAC 30 | GGC 78
GTA 12 | GCA 18 | Glu E GAA 18 | GGA 12
GTG 30 | GCG 24 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10559 C:0.11801 A:0.36646 G:0.40994
position 2: T:0.24224 C:0.32298 A:0.22981 G:0.20497
position 3: T:0.09938 C:0.53416 A:0.15528 G:0.21118
Average T:0.14907 C:0.32505 A:0.25052 G:0.27536
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -606.000565 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299836 1.300020
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908650_1_2097_MLBR_RS09960: 0.000004, NC_002677_1_NP_302330_1_1202_lpqH: 0.000004, NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440: 0.000004, NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750: 0.000004, NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790: 0.000004, NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29984
omega (dN/dS) = 1.30002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 386.1 96.9 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 386.1 96.9 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 386.1 96.9 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 386.1 96.9 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 386.1 96.9 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 386.1 96.9 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -606.000560 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.008226 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908650_1_2097_MLBR_RS09960: 0.000004, NC_002677_1_NP_302330_1_1202_lpqH: 0.000004, NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440: 0.000004, NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750: 0.000004, NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790: 0.000004, NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00823
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 385.0 98.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 385.0 98.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 385.0 98.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 385.0 98.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 385.0 98.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 385.0 98.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -606.000549 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000005 0.001325 0.000001 8.799674
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908650_1_2097_MLBR_RS09960: 0.000004, NC_002677_1_NP_302330_1_1202_lpqH: 0.000004, NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440: 0.000004, NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750: 0.000004, NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790: 0.000004, NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00133 0.99867
w: 0.00000 1.00000 8.79967
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 385.0 98.0 8.7893 0.0000 0.0000 0.0 0.0
7..2 0.000 385.0 98.0 8.7893 0.0000 0.0000 0.0 0.0
7..3 0.000 385.0 98.0 8.7893 0.0000 0.0000 0.0 0.0
7..4 0.000 385.0 98.0 8.7893 0.0000 0.0000 0.0 0.0
7..5 0.000 385.0 98.0 8.7893 0.0000 0.0000 0.0 0.0
7..6 0.000 385.0 98.0 8.7893 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908650_1_2097_MLBR_RS09960)
Pr(w>1) post mean +- SE for w
1 V 0.999** 8.789
2 R 0.999** 8.789
3 H 0.999** 8.789
4 K 0.999** 8.789
5 L 0.999** 8.789
6 L 0.999** 8.789
7 A 0.999** 8.789
8 A 0.999** 8.789
9 I 0.999** 8.789
10 Y 0.999** 8.789
11 A 0.999** 8.789
12 V 0.999** 8.789
13 T 0.999** 8.789
14 I 0.999** 8.789
15 M 0.999** 8.789
16 A 0.999** 8.789
17 G 0.999** 8.789
18 A 0.999** 8.789
19 A 0.999** 8.789
20 G 0.999** 8.789
21 C 0.999** 8.789
22 S 0.999** 8.789
23 G 0.999** 8.789
24 G 0.999** 8.789
25 T 0.999** 8.789
26 Q 0.999** 8.789
27 A 0.999** 8.789
28 P 0.999** 8.789
29 T 0.999** 8.789
30 P 0.999** 8.789
31 S 0.999** 8.789
32 V 0.999** 8.789
33 S 0.999** 8.789
34 K 0.999** 8.789
35 T 0.999** 8.789
36 T 0.999** 8.789
37 N 0.999** 8.789
38 S 0.999** 8.789
39 S 0.999** 8.789
40 P 0.999** 8.789
41 T 0.999** 8.789
42 T 0.999** 8.789
43 V 0.999** 8.789
44 A 0.999** 8.789
45 S 0.999** 8.789
46 S 0.999** 8.789
47 I 0.999** 8.789
48 P 0.999** 8.789
49 D 0.999** 8.789
50 A 0.999** 8.789
51 A 0.999** 8.789
52 A 0.999** 8.789
53 G 0.999** 8.789
54 E 0.999** 8.789
55 T 0.999** 8.789
56 K 0.999** 8.789
57 V 0.999** 8.789
58 T 0.999** 8.789
59 I 0.999** 8.789
60 G 0.999** 8.789
61 G 0.999** 8.789
62 Q 0.999** 8.789
63 P 0.999** 8.789
64 Q 0.999** 8.789
65 K 0.999** 8.789
66 V 0.999** 8.789
67 S 0.999** 8.789
68 G 0.999** 8.789
69 P 0.999** 8.789
70 V 0.999** 8.789
71 V 0.999** 8.789
72 C 0.999** 8.789
73 S 0.999** 8.789
74 T 0.999** 8.789
75 T 0.999** 8.789
76 N 0.999** 8.789
77 G 0.999** 8.789
78 K 0.999** 8.789
79 F 0.999** 8.789
80 S 0.999** 8.789
81 I 0.999** 8.789
82 A 0.999** 8.789
83 I 0.999** 8.789
84 G 0.999** 8.789
85 D 0.999** 8.789
86 M 0.999** 8.789
87 I 0.999** 8.789
88 T 0.999** 8.789
89 G 0.999** 8.789
90 V 0.999** 8.789
91 I 0.999** 8.789
92 V 0.999** 8.789
93 G 0.999** 8.789
94 L 0.999** 8.789
95 E 0.999** 8.789
96 P 0.999** 8.789
97 D 0.999** 8.789
98 A 0.999** 8.789
99 S 0.999** 8.789
100 V 0.999** 8.789
101 V 0.999** 8.789
102 H 0.999** 8.789
103 N 0.999** 8.789
104 A 0.999** 8.789
105 G 0.999** 8.789
106 L 0.999** 8.789
107 G 0.999** 8.789
108 T 0.999** 8.789
109 I 0.999** 8.789
110 D 0.999** 8.789
111 G 0.999** 8.789
112 V 0.999** 8.789
113 V 0.999** 8.789
114 I 0.999** 8.789
115 A 0.999** 8.789
116 F 0.999** 8.789
117 T 0.999** 8.789
118 E 0.999** 8.789
119 G 0.999** 8.789
120 V 0.999** 8.789
121 P 0.999** 8.789
122 S 0.999** 8.789
123 E 0.999** 8.789
124 N 0.999** 8.789
125 A 0.999** 8.789
126 N 0.999** 8.789
127 A 0.999** 8.789
128 T 0.999** 8.789
129 K 0.999** 8.789
130 N 0.999** 8.789
131 G 0.999** 8.789
132 N 0.999** 8.789
133 T 0.999** 8.789
134 Y 0.999** 8.789
135 Q 0.999** 8.789
136 I 0.999** 8.789
137 T 0.999** 8.789
138 G 0.999** 8.789
139 T 0.999** 8.789
140 A 0.999** 8.789
141 S 0.999** 8.789
142 G 0.999** 8.789
143 V 0.999** 8.789
144 D 0.999** 8.789
145 N 0.999** 8.789
146 T 0.999** 8.789
147 G 0.999** 8.789
148 Q 0.999** 8.789
149 Q 0.999** 8.789
150 I 0.999** 8.789
151 H 0.999** 8.789
152 K 0.999** 8.789
153 S 0.999** 8.789
154 F 0.999** 8.789
155 E 0.999** 8.789
156 I 0.999** 8.789
157 E 0.999** 8.789
158 V 0.999** 8.789
159 T 0.999** 8.789
160 C 0.999** 8.789
161 R 0.999** 8.789
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908650_1_2097_MLBR_RS09960)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -606.000562 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.018668 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908650_1_2097_MLBR_RS09960: 0.000004, NC_002677_1_NP_302330_1_1202_lpqH: 0.000004, NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440: 0.000004, NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750: 0.000004, NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790: 0.000004, NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.01867 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.99996 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 385.0 98.0 0.8000 0.0000 0.0000 0.0 0.0
7..2 0.000 385.0 98.0 0.8000 0.0000 0.0000 0.0 0.0
7..3 0.000 385.0 98.0 0.8000 0.0000 0.0000 0.0 0.0
7..4 0.000 385.0 98.0 0.8000 0.0000 0.0000 0.0 0.0
7..5 0.000 385.0 98.0 0.8000 0.0000 0.0000 0.0 0.0
7..6 0.000 385.0 98.0 0.8000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -606.000551 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 2.086145 0.005000 3.878325
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908650_1_2097_MLBR_RS09960: 0.000004, NC_002677_1_NP_302330_1_1202_lpqH: 0.000004, NZ_LVXE01000050_1_WP_010908650_1_2116_A3216_RS11440: 0.000004, NZ_LYPH01000079_1_WP_010908650_1_2649_A8144_RS12750: 0.000004, NZ_CP029543_1_WP_010908650_1_2119_DIJ64_RS10790: 0.000004, NZ_AP014567_1_WP_010908650_1_2178_JK2ML_RS11085: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 2.08614 q = 0.00500
(p1 = 0.99999) w = 3.87833
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 3.87833
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 385.0 98.0 3.8783 0.0000 0.0000 0.0 0.0
7..2 0.000 385.0 98.0 3.8783 0.0000 0.0000 0.0 0.0
7..3 0.000 385.0 98.0 3.8783 0.0000 0.0000 0.0 0.0
7..4 0.000 385.0 98.0 3.8783 0.0000 0.0000 0.0 0.0
7..5 0.000 385.0 98.0 3.8783 0.0000 0.0000 0.0 0.0
7..6 0.000 385.0 98.0 3.8783 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908650_1_2097_MLBR_RS09960)
Pr(w>1) post mean +- SE for w
1 V 1.000** 3.878
2 R 1.000** 3.878
3 H 1.000** 3.878
4 K 1.000** 3.878
5 L 1.000** 3.878
6 L 1.000** 3.878
7 A 1.000** 3.878
8 A 1.000** 3.878
9 I 1.000** 3.878
10 Y 1.000** 3.878
11 A 1.000** 3.878
12 V 1.000** 3.878
13 T 1.000** 3.878
14 I 1.000** 3.878
15 M 1.000** 3.878
16 A 1.000** 3.878
17 G 1.000** 3.878
18 A 1.000** 3.878
19 A 1.000** 3.878
20 G 1.000** 3.878
21 C 1.000** 3.878
22 S 1.000** 3.878
23 G 1.000** 3.878
24 G 1.000** 3.878
25 T 1.000** 3.878
26 Q 1.000** 3.878
27 A 1.000** 3.878
28 P 1.000** 3.878
29 T 1.000** 3.878
30 P 1.000** 3.878
31 S 1.000** 3.878
32 V 1.000** 3.878
33 S 1.000** 3.878
34 K 1.000** 3.878
35 T 1.000** 3.878
36 T 1.000** 3.878
37 N 1.000** 3.878
38 S 1.000** 3.878
39 S 1.000** 3.878
40 P 1.000** 3.878
41 T 1.000** 3.878
42 T 1.000** 3.878
43 V 1.000** 3.878
44 A 1.000** 3.878
45 S 1.000** 3.878
46 S 1.000** 3.878
47 I 1.000** 3.878
48 P 1.000** 3.878
49 D 1.000** 3.878
50 A 1.000** 3.878
51 A 1.000** 3.878
52 A 1.000** 3.878
53 G 1.000** 3.878
54 E 1.000** 3.878
55 T 1.000** 3.878
56 K 1.000** 3.878
57 V 1.000** 3.878
58 T 1.000** 3.878
59 I 1.000** 3.878
60 G 1.000** 3.878
61 G 1.000** 3.878
62 Q 1.000** 3.878
63 P 1.000** 3.878
64 Q 1.000** 3.878
65 K 1.000** 3.878
66 V 1.000** 3.878
67 S 1.000** 3.878
68 G 1.000** 3.878
69 P 1.000** 3.878
70 V 1.000** 3.878
71 V 1.000** 3.878
72 C 1.000** 3.878
73 S 1.000** 3.878
74 T 1.000** 3.878
75 T 1.000** 3.878
76 N 1.000** 3.878
77 G 1.000** 3.878
78 K 1.000** 3.878
79 F 1.000** 3.878
80 S 1.000** 3.878
81 I 1.000** 3.878
82 A 1.000** 3.878
83 I 1.000** 3.878
84 G 1.000** 3.878
85 D 1.000** 3.878
86 M 1.000** 3.878
87 I 1.000** 3.878
88 T 1.000** 3.878
89 G 1.000** 3.878
90 V 1.000** 3.878
91 I 1.000** 3.878
92 V 1.000** 3.878
93 G 1.000** 3.878
94 L 1.000** 3.878
95 E 1.000** 3.878
96 P 1.000** 3.878
97 D 1.000** 3.878
98 A 1.000** 3.878
99 S 1.000** 3.878
100 V 1.000** 3.878
101 V 1.000** 3.878
102 H 1.000** 3.878
103 N 1.000** 3.878
104 A 1.000** 3.878
105 G 1.000** 3.878
106 L 1.000** 3.878
107 G 1.000** 3.878
108 T 1.000** 3.878
109 I 1.000** 3.878
110 D 1.000** 3.878
111 G 1.000** 3.878
112 V 1.000** 3.878
113 V 1.000** 3.878
114 I 1.000** 3.878
115 A 1.000** 3.878
116 F 1.000** 3.878
117 T 1.000** 3.878
118 E 1.000** 3.878
119 G 1.000** 3.878
120 V 1.000** 3.878
121 P 1.000** 3.878
122 S 1.000** 3.878
123 E 1.000** 3.878
124 N 1.000** 3.878
125 A 1.000** 3.878
126 N 1.000** 3.878
127 A 1.000** 3.878
128 T 1.000** 3.878
129 K 1.000** 3.878
130 N 1.000** 3.878
131 G 1.000** 3.878
132 N 1.000** 3.878
133 T 1.000** 3.878
134 Y 1.000** 3.878
135 Q 1.000** 3.878
136 I 1.000** 3.878
137 T 1.000** 3.878
138 G 1.000** 3.878
139 T 1.000** 3.878
140 A 1.000** 3.878
141 S 1.000** 3.878
142 G 1.000** 3.878
143 V 1.000** 3.878
144 D 1.000** 3.878
145 N 1.000** 3.878
146 T 1.000** 3.878
147 G 1.000** 3.878
148 Q 1.000** 3.878
149 Q 1.000** 3.878
150 I 1.000** 3.878
151 H 1.000** 3.878
152 K 1.000** 3.878
153 S 1.000** 3.878
154 F 1.000** 3.878
155 E 1.000** 3.878
156 I 1.000** 3.878
157 E 1.000** 3.878
158 V 1.000** 3.878
159 T 1.000** 3.878
160 C 1.000** 3.878
161 R 1.000** 3.878
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908650_1_2097_MLBR_RS09960)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:15
Model 1: NearlyNeutral -606.00056 Model 2: PositiveSelection -606.000549 Model 0: one-ratio -606.000565 Model 7: beta -606.000562 Model 8: beta&w>1 -606.000551 Model 0 vs 1 1.0000000202126103E-5 Model 2 vs 1 2.199999994445534E-5 Model 8 vs 7 2.199999994445534E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
