--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:06:01 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/3res/lpqH/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -654.27 -657.12
2 -654.21 -658.28
--------------------------------------
TOTAL -654.24 -657.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888514 0.088629 0.375146 1.483672 0.851039 1420.45 1460.73 1.000
r(A<->C){all} 0.153201 0.016744 0.000043 0.405999 0.118647 174.74 225.03 1.002
r(A<->G){all} 0.179335 0.022460 0.000038 0.483450 0.140998 212.16 221.06 1.004
r(A<->T){all} 0.159330 0.017737 0.000060 0.427189 0.123242 159.04 216.62 1.000
r(C<->G){all} 0.161855 0.018476 0.000086 0.430613 0.127731 160.69 281.23 1.001
r(C<->T){all} 0.186836 0.023737 0.000120 0.495206 0.146767 239.01 296.85 1.004
r(G<->T){all} 0.159443 0.019027 0.000012 0.441117 0.122458 197.32 255.42 1.001
pi(A){all} 0.250571 0.000401 0.207994 0.285566 0.250584 1343.69 1344.14 1.000
pi(C){all} 0.325034 0.000461 0.285584 0.369667 0.324685 1107.87 1173.54 1.000
pi(G){all} 0.274715 0.000414 0.234658 0.314731 0.274128 1065.17 1264.05 1.000
pi(T){all} 0.149681 0.000261 0.117448 0.180889 0.149252 1084.50 1188.49 1.000
alpha{1,2} 0.412857 0.217771 0.000166 1.337471 0.247888 1226.43 1344.00 1.001
alpha{3} 0.439860 0.222823 0.000152 1.403974 0.278780 1212.74 1242.61 1.000
pinvar{all} 0.996716 0.000016 0.989474 0.999998 0.997962 1385.37 1438.02 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -606.00056
Model 2: PositiveSelection -606.000549
Model 0: one-ratio -606.000565
Model 7: beta -606.000562
Model 8: beta&w>1 -606.000551
Model 0 vs 1 1.0000000202126103E-5
Model 2 vs 1 2.199999994445534E-5
Model 8 vs 7 2.199999994445534E-5
>C1
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C2
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C3
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C4
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C5
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C6
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=161
C1 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C2 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C3 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C4 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C5 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C6 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
**************************************************
C1 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C2 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C3 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C4 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C5 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C6 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
**************************************************
C1 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C2 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C3 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C4 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C5 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C6 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
**************************************************
C1 HKSFEIEVTCR
C2 HKSFEIEVTCR
C3 HKSFEIEVTCR
C4 HKSFEIEVTCR
C5 HKSFEIEVTCR
C6 HKSFEIEVTCR
***********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4830]--->[4830]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.470 Mb, Max= 30.697 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C2 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C3 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C4 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C5 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
C6 VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
**************************************************
C1 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C2 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C3 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C4 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C5 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
C6 AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
**************************************************
C1 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C2 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C3 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C4 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C5 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
C6 VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
**************************************************
C1 HKSFEIEVTCR
C2 HKSFEIEVTCR
C3 HKSFEIEVTCR
C4 HKSFEIEVTCR
C5 HKSFEIEVTCR
C6 HKSFEIEVTCR
***********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
C2 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
C3 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
C4 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
C5 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
C6 GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
**************************************************
C1 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
C2 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
C3 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
C4 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
C5 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
C6 CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
**************************************************
C1 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
C2 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
C3 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
C4 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
C5 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
C6 AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
**************************************************
C1 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
C2 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
C3 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
C4 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
C5 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
C6 GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
**************************************************
C1 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
C2 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
C3 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
C4 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
C5 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
C6 TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
**************************************************
C1 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
C2 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
C3 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
C4 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
C5 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
C6 GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
**************************************************
C1 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
C2 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
C3 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
C4 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
C5 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
C6 GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
**************************************************
C1 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
C2 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
C3 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
C4 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
C5 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
C6 CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
**************************************************
C1 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
C2 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
C3 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
C4 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
C5 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
C6 ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
**************************************************
C1 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
C2 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
C3 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
C4 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
C5 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
C6 CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
*********************************
>C1
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C2
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C3
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C4
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C5
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C6
GTGAGGCATAAGTTATTGGCCGCCATCTACGCCGTCACGATCATGGCCGG
CGCGGCGGGCTGCAGCGGGGGCACGCAGGCTCCCACCCCTTCGGTGAGCA
AAACCACAAACTCCAGCCCCACAACCGTAGCGAGCAGCATTCCCGACGCA
GCAGCCGGAGAAACGAAGGTCACCATCGGCGGCCAGCCACAAAAAGTCAG
TGGCCCGGTCGTGTGCTCAACTACAAACGGCAAGTTCTCGATCGCGATCG
GTGACATGATCACCGGAGTCATCGTTGGCTTGGAGCCGGACGCATCGGTG
GTCCATAACGCCGGCCTCGGCACCATAGACGGTGTGGTCATAGCCTTCAC
CGAGGGCGTCCCCAGCGAGAACGCCAATGCCACCAAAAACGGCAACACAT
ACCAAATCACCGGTACAGCCAGCGGTGTAGACAATACCGGCCAGCAGATC
CATAAGTCTTTCGAAATCGAAGTCACCTGCCGC
>C1
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C2
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C3
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C4
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C5
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
>C6
VRHKLLAAIYAVTIMAGAAGCSGGTQAPTPSVSKTTNSSPTTVASSIPDA
AAGETKVTIGGQPQKVSGPVVCSTTNGKFSIAIGDMITGVIVGLEPDASV
VHNAGLGTIDGVVIAFTEGVPSENANATKNGNTYQITGTASGVDNTGQQI
HKSFEIEVTCR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 483 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791876
Setting output file names to "/data/3res/lpqH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1084329827
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0043475635
Seed = 1949380451
Swapseed = 1579791876
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1080.977161 -- -24.965149
Chain 2 -- -1080.977161 -- -24.965149
Chain 3 -- -1080.977161 -- -24.965149
Chain 4 -- -1080.976996 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1080.977161 -- -24.965149
Chain 2 -- -1080.977100 -- -24.965149
Chain 3 -- -1080.977161 -- -24.965149
Chain 4 -- -1080.977100 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1080.977] (-1080.977) (-1080.977) (-1080.977) * [-1080.977] (-1080.977) (-1080.977) (-1080.977)
500 -- (-682.147) [-675.538] (-668.616) (-672.662) * (-678.737) (-681.152) [-668.668] (-663.586) -- 0:00:00
1000 -- (-675.466) (-668.836) (-665.153) [-663.050] * (-672.153) (-673.959) [-661.047] (-665.712) -- 0:00:00
1500 -- [-660.433] (-667.156) (-660.911) (-665.666) * (-669.082) (-664.359) [-665.476] (-667.629) -- 0:00:00
2000 -- (-665.110) (-665.986) (-660.187) [-665.318] * (-670.573) (-663.730) (-664.986) [-658.872] -- 0:00:00
2500 -- (-662.089) [-662.627] (-668.798) (-661.091) * (-669.521) (-661.473) [-663.635] (-661.508) -- 0:00:00
3000 -- [-659.598] (-671.726) (-660.195) (-666.066) * [-667.464] (-661.932) (-662.201) (-661.686) -- 0:00:00
3500 -- (-661.955) (-661.174) [-665.005] (-665.004) * (-666.073) [-659.071] (-664.049) (-666.635) -- 0:00:00
4000 -- [-664.281] (-661.168) (-662.629) (-669.364) * [-666.178] (-664.076) (-672.450) (-669.831) -- 0:00:00
4500 -- [-664.117] (-663.339) (-668.517) (-664.868) * (-667.357) (-662.056) [-661.008] (-669.575) -- 0:03:41
5000 -- [-661.824] (-662.550) (-659.684) (-671.059) * (-664.581) (-662.641) (-669.437) [-664.161] -- 0:03:19
Average standard deviation of split frequencies: 0.095647
5500 -- (-670.756) (-663.796) (-662.499) [-667.864] * (-662.806) [-660.934] (-660.981) (-669.081) -- 0:03:00
6000 -- (-662.833) [-665.383] (-669.149) (-665.176) * (-668.290) [-670.572] (-671.003) (-665.792) -- 0:02:45
6500 -- [-665.609] (-666.606) (-662.956) (-668.954) * (-664.139) (-661.225) (-666.147) [-665.160] -- 0:02:32
7000 -- (-665.404) [-660.671] (-670.400) (-661.886) * (-668.463) (-662.187) [-665.472] (-669.082) -- 0:02:21
7500 -- (-659.193) (-664.250) (-661.057) [-662.371] * (-661.260) (-665.295) (-657.289) [-664.618] -- 0:02:12
8000 -- [-666.823] (-659.992) (-668.248) (-662.877) * (-663.033) [-671.445] (-661.026) (-664.222) -- 0:02:04
8500 -- (-662.023) (-662.535) [-665.524] (-658.900) * (-664.963) (-672.534) [-664.303] (-659.943) -- 0:01:56
9000 -- [-673.339] (-670.863) (-665.400) (-663.384) * [-662.682] (-662.945) (-661.281) (-672.974) -- 0:01:50
9500 -- [-668.913] (-663.409) (-670.980) (-664.731) * (-656.125) (-655.994) (-669.688) [-670.446] -- 0:01:44
10000 -- [-666.519] (-661.494) (-671.451) (-661.923) * [-666.747] (-654.061) (-667.335) (-672.166) -- 0:01:39
Average standard deviation of split frequencies: 0.090493
10500 -- (-668.187) [-664.509] (-660.229) (-670.006) * [-663.536] (-654.953) (-661.410) (-665.323) -- 0:01:34
11000 -- (-663.835) [-662.099] (-663.859) (-656.186) * (-665.943) (-657.596) (-664.575) [-660.492] -- 0:01:29
11500 -- [-664.851] (-668.678) (-667.070) (-663.852) * (-656.659) [-655.310] (-664.075) (-664.337) -- 0:01:25
12000 -- (-662.843) [-663.267] (-666.879) (-667.304) * (-668.136) (-653.178) [-663.561] (-664.524) -- 0:01:22
12500 -- (-663.539) (-661.872) (-669.079) [-663.245] * [-665.533] (-655.369) (-679.706) (-672.597) -- 0:01:19
13000 -- [-665.081] (-669.103) (-660.320) (-666.430) * [-662.872] (-656.563) (-675.899) (-661.503) -- 0:01:15
13500 -- (-668.876) (-664.018) [-663.694] (-669.193) * (-661.806) (-656.603) [-655.740] (-666.112) -- 0:01:13
14000 -- (-662.075) [-659.650] (-662.105) (-657.414) * (-667.141) (-657.770) [-654.213] (-661.075) -- 0:01:10
14500 -- (-664.058) (-665.347) [-660.015] (-667.166) * (-667.855) (-655.839) [-652.815] (-666.250) -- 0:01:07
15000 -- (-667.784) (-664.598) (-664.456) [-660.294] * (-667.022) (-655.759) [-654.234] (-668.047) -- 0:01:05
Average standard deviation of split frequencies: 0.063836
15500 -- (-668.894) (-668.361) (-654.474) [-658.601] * (-660.132) (-655.331) [-654.347] (-669.302) -- 0:01:03
16000 -- (-669.211) (-662.996) [-657.144] (-662.359) * (-662.710) (-653.544) [-653.569] (-663.806) -- 0:01:01
16500 -- [-672.326] (-660.903) (-654.138) (-663.512) * (-664.162) (-654.674) [-658.983] (-663.517) -- 0:00:59
17000 -- [-663.936] (-660.827) (-654.938) (-664.915) * (-662.501) (-654.983) [-654.700] (-664.499) -- 0:00:57
17500 -- (-668.531) [-659.695] (-652.941) (-665.260) * (-668.252) (-653.812) [-656.680] (-660.227) -- 0:00:56
18000 -- (-666.621) (-671.640) [-653.820] (-669.822) * (-664.299) (-659.301) [-653.192] (-671.827) -- 0:00:54
18500 -- (-663.195) (-658.941) (-657.287) [-663.209] * (-665.904) (-653.631) (-655.894) [-667.561] -- 0:00:53
19000 -- (-664.637) (-666.000) [-652.975] (-672.686) * (-667.085) [-653.181] (-659.038) (-669.947) -- 0:00:51
19500 -- (-666.029) (-661.735) (-653.789) [-662.178] * (-665.892) [-656.773] (-656.698) (-666.047) -- 0:01:40
20000 -- (-661.522) (-666.953) (-653.346) [-663.161] * (-666.346) (-658.244) [-654.706] (-664.274) -- 0:01:38
Average standard deviation of split frequencies: 0.073499
20500 -- (-664.611) [-664.549] (-655.111) (-672.337) * (-672.817) (-659.095) (-653.891) [-666.956] -- 0:01:35
21000 -- (-671.851) [-659.973] (-654.751) (-664.512) * (-668.430) (-654.016) (-653.845) [-663.143] -- 0:01:33
21500 -- [-662.848] (-661.981) (-654.318) (-667.357) * (-672.160) (-656.508) [-653.440] (-659.880) -- 0:01:31
22000 -- (-659.315) (-665.131) [-654.676] (-663.239) * (-665.941) [-653.265] (-654.017) (-670.352) -- 0:01:28
22500 -- [-664.311] (-668.272) (-655.626) (-661.955) * (-664.454) (-656.421) [-654.962] (-664.072) -- 0:01:26
23000 -- [-657.407] (-667.304) (-655.336) (-666.370) * (-666.180) (-658.574) (-654.181) [-665.714] -- 0:01:24
23500 -- (-663.118) (-668.184) [-655.748] (-664.232) * (-668.404) (-654.670) [-656.521] (-667.381) -- 0:01:23
24000 -- [-663.515] (-673.546) (-653.826) (-661.897) * [-668.077] (-654.287) (-658.006) (-668.476) -- 0:01:21
24500 -- [-663.857] (-661.964) (-657.112) (-662.712) * (-670.793) (-654.260) [-655.337] (-659.869) -- 0:01:19
25000 -- (-670.270) (-664.095) [-654.250] (-664.964) * (-663.268) (-654.231) (-653.101) [-663.774] -- 0:01:18
Average standard deviation of split frequencies: 0.056983
25500 -- [-661.870] (-667.103) (-654.660) (-664.723) * (-666.753) (-655.701) (-653.125) [-658.687] -- 0:01:16
26000 -- (-668.197) (-670.259) [-653.942] (-664.184) * (-671.209) (-653.607) (-653.337) [-661.214] -- 0:01:14
26500 -- (-668.660) [-663.011] (-654.595) (-661.345) * (-663.565) [-654.643] (-654.998) (-659.518) -- 0:01:13
27000 -- (-666.814) (-665.261) (-656.395) [-664.248] * (-663.602) (-653.869) [-659.583] (-661.022) -- 0:01:12
27500 -- [-663.527] (-674.932) (-653.949) (-670.909) * (-669.600) [-656.327] (-656.167) (-663.027) -- 0:01:10
28000 -- (-663.455) [-659.958] (-656.836) (-663.807) * (-665.939) (-654.600) (-657.895) [-659.387] -- 0:01:09
28500 -- (-662.697) [-663.980] (-653.507) (-664.113) * (-666.289) (-653.951) (-655.608) [-659.147] -- 0:01:08
29000 -- (-668.577) (-666.004) (-657.141) [-664.041] * (-670.641) (-654.321) [-654.182] (-671.919) -- 0:01:06
29500 -- [-670.588] (-668.181) (-655.983) (-668.459) * (-666.235) (-655.219) (-654.265) [-662.468] -- 0:01:05
30000 -- [-670.587] (-661.508) (-655.619) (-660.582) * (-663.648) (-653.856) (-653.085) [-662.839] -- 0:01:04
Average standard deviation of split frequencies: 0.048212
30500 -- (-664.295) (-659.971) [-658.119] (-664.645) * (-663.639) [-656.559] (-654.352) (-663.801) -- 0:01:03
31000 -- (-661.716) (-671.189) (-657.254) [-659.018] * (-662.658) (-657.180) [-653.832] (-660.320) -- 0:01:02
31500 -- [-661.055] (-664.938) (-659.348) (-662.532) * (-670.569) (-654.422) (-653.423) [-664.119] -- 0:01:01
32000 -- (-678.322) (-659.014) (-655.694) [-662.046] * (-660.525) (-658.381) (-653.217) [-659.613] -- 0:01:00
32500 -- (-672.836) (-670.193) (-653.884) [-661.928] * (-659.942) [-657.219] (-654.120) (-666.877) -- 0:00:59
33000 -- [-662.633] (-668.974) (-657.530) (-666.396) * (-662.104) (-656.424) [-654.317] (-659.375) -- 0:00:58
33500 -- [-670.368] (-669.482) (-660.774) (-670.856) * (-663.464) (-655.781) (-654.109) [-658.484] -- 0:00:57
34000 -- [-661.844] (-666.071) (-654.781) (-664.621) * (-665.275) (-654.325) (-655.063) [-659.267] -- 0:01:25
34500 -- (-663.648) (-663.424) [-654.533] (-660.742) * (-676.864) [-655.850] (-654.052) (-674.279) -- 0:01:23
35000 -- [-659.840] (-663.138) (-653.475) (-658.167) * (-658.579) (-654.931) [-655.811] (-668.203) -- 0:01:22
Average standard deviation of split frequencies: 0.045236
35500 -- (-665.393) (-666.995) [-654.201] (-657.555) * [-658.064] (-656.307) (-654.552) (-670.924) -- 0:01:21
36000 -- [-667.698] (-664.645) (-653.789) (-653.970) * [-656.250] (-654.767) (-656.385) (-673.727) -- 0:01:20
36500 -- (-660.680) (-663.919) [-656.643] (-654.798) * (-658.971) (-654.613) [-654.925] (-665.039) -- 0:01:19
37000 -- (-663.557) (-667.112) [-656.232] (-654.011) * (-654.018) (-655.033) (-656.154) [-657.701] -- 0:01:18
37500 -- [-658.254] (-671.238) (-654.362) (-654.802) * [-655.740] (-655.421) (-657.032) (-665.909) -- 0:01:17
38000 -- [-657.762] (-662.425) (-653.674) (-654.623) * (-656.152) [-653.230] (-656.487) (-660.908) -- 0:01:15
38500 -- (-669.768) [-659.495] (-654.961) (-655.730) * (-657.064) (-652.994) [-654.382] (-668.196) -- 0:01:14
39000 -- (-662.585) [-659.116] (-654.652) (-657.990) * (-655.086) [-653.401] (-654.639) (-663.509) -- 0:01:13
39500 -- [-666.667] (-659.661) (-655.026) (-656.295) * (-657.526) (-653.771) [-657.407] (-663.450) -- 0:01:12
40000 -- (-661.212) (-667.605) (-655.547) [-654.214] * (-657.555) (-654.749) [-654.665] (-667.664) -- 0:01:12
Average standard deviation of split frequencies: 0.041400
40500 -- (-659.270) (-677.042) (-655.235) [-654.721] * (-659.207) (-656.257) [-653.592] (-660.494) -- 0:01:11
41000 -- (-666.311) (-668.817) (-655.283) [-655.698] * (-654.434) (-652.905) [-652.765] (-670.806) -- 0:01:10
41500 -- (-661.782) (-671.481) [-655.170] (-657.013) * [-653.492] (-653.590) (-657.837) (-662.722) -- 0:01:09
42000 -- (-664.287) [-658.583] (-655.540) (-658.519) * (-658.412) (-655.918) [-655.427] (-660.074) -- 0:01:08
42500 -- (-673.376) (-664.944) [-652.808] (-655.326) * (-656.897) (-660.779) [-656.842] (-663.302) -- 0:01:07
43000 -- (-662.105) [-660.519] (-655.383) (-662.040) * (-655.043) [-656.401] (-657.808) (-664.360) -- 0:01:06
43500 -- (-665.278) (-677.097) (-655.840) [-656.482] * [-656.476] (-657.684) (-655.423) (-664.826) -- 0:01:05
44000 -- (-665.386) [-658.693] (-655.633) (-655.671) * [-653.556] (-659.540) (-657.776) (-662.602) -- 0:01:05
44500 -- (-664.765) (-667.536) (-652.994) [-656.844] * (-655.068) (-654.458) (-653.910) [-662.359] -- 0:01:04
45000 -- [-663.012] (-666.100) (-657.799) (-658.416) * (-654.798) (-655.716) (-654.119) [-663.174] -- 0:01:03
Average standard deviation of split frequencies: 0.039655
45500 -- (-664.494) [-667.128] (-654.213) (-660.373) * (-657.061) (-654.317) (-656.340) [-665.379] -- 0:01:02
46000 -- (-665.945) (-671.414) (-653.873) [-658.866] * (-655.257) (-655.029) [-656.055] (-663.196) -- 0:01:02
46500 -- (-662.794) [-662.690] (-653.986) (-654.578) * (-653.636) [-653.962] (-655.768) (-657.010) -- 0:01:01
47000 -- (-669.133) [-661.245] (-654.586) (-655.321) * [-653.458] (-657.250) (-656.968) (-661.937) -- 0:01:00
47500 -- [-664.134] (-663.348) (-654.547) (-656.720) * (-654.504) (-655.929) (-657.867) [-665.082] -- 0:01:00
48000 -- (-667.716) (-664.595) [-653.184] (-653.680) * (-654.159) (-654.178) [-657.964] (-657.934) -- 0:01:19
48500 -- (-663.346) [-659.043] (-654.211) (-654.261) * (-653.839) (-653.779) (-653.421) [-661.865] -- 0:01:18
49000 -- (-663.924) (-662.876) (-655.077) [-653.628] * (-653.622) (-654.166) (-656.013) [-664.267] -- 0:01:17
49500 -- [-662.703] (-664.600) (-655.718) (-653.714) * (-656.013) (-656.839) (-658.341) [-663.935] -- 0:01:16
50000 -- [-673.669] (-668.980) (-658.283) (-656.411) * (-657.361) (-656.455) [-656.706] (-669.470) -- 0:01:16
Average standard deviation of split frequencies: 0.041204
50500 -- (-660.128) [-658.566] (-655.478) (-659.966) * (-657.823) (-654.223) [-653.961] (-670.612) -- 0:01:15
51000 -- (-664.626) [-675.115] (-656.120) (-656.661) * [-661.701] (-661.047) (-653.137) (-659.970) -- 0:01:14
51500 -- (-671.931) (-663.280) (-661.130) [-654.605] * [-654.388] (-661.162) (-654.428) (-672.640) -- 0:01:13
52000 -- (-668.423) (-668.553) (-661.526) [-657.398] * (-655.560) (-654.804) [-655.678] (-665.839) -- 0:01:12
52500 -- (-665.118) [-659.622] (-657.162) (-654.208) * (-660.266) (-654.879) [-652.983] (-665.174) -- 0:01:12
53000 -- [-665.923] (-657.886) (-655.611) (-653.529) * (-656.680) (-654.127) [-653.711] (-663.387) -- 0:01:11
53500 -- (-666.348) (-663.157) (-653.727) [-655.988] * (-653.007) (-653.778) (-656.359) [-663.171] -- 0:01:10
54000 -- (-668.409) (-664.073) [-653.985] (-655.695) * (-653.168) (-653.563) [-656.384] (-669.127) -- 0:01:10
54500 -- (-669.306) (-662.165) [-654.137] (-654.620) * (-652.725) [-653.893] (-654.767) (-661.735) -- 0:01:09
55000 -- (-669.606) (-662.253) [-653.832] (-653.265) * (-654.422) [-655.921] (-655.587) (-664.925) -- 0:01:08
Average standard deviation of split frequencies: 0.044305
55500 -- (-668.934) (-663.475) (-653.619) [-654.394] * (-653.625) [-654.591] (-655.700) (-663.079) -- 0:01:08
56000 -- (-661.448) [-659.933] (-656.833) (-653.802) * (-654.788) (-653.737) (-655.452) [-673.580] -- 0:01:07
56500 -- (-663.313) [-665.637] (-653.400) (-653.244) * (-655.761) (-656.443) [-652.891] (-663.118) -- 0:01:06
57000 -- [-664.878] (-666.782) (-655.906) (-655.109) * (-655.461) (-655.260) (-656.344) [-663.005] -- 0:01:06
57500 -- [-663.878] (-660.865) (-655.921) (-655.298) * (-653.790) (-653.530) (-655.336) [-661.498] -- 0:01:05
58000 -- (-666.324) (-665.561) (-653.003) [-657.249] * (-655.429) (-654.224) [-654.447] (-663.389) -- 0:01:04
58500 -- (-665.745) (-661.181) (-653.621) [-654.945] * (-656.518) (-653.973) (-655.013) [-662.866] -- 0:01:04
59000 -- (-662.630) [-662.385] (-652.914) (-657.849) * [-654.670] (-653.477) (-654.919) (-673.622) -- 0:01:03
59500 -- (-662.758) (-664.579) (-653.594) [-655.275] * [-654.380] (-652.836) (-653.863) (-660.496) -- 0:01:03
60000 -- (-662.462) (-675.838) (-653.537) [-655.925] * (-653.676) [-652.870] (-653.933) (-666.089) -- 0:01:02
Average standard deviation of split frequencies: 0.042124
60500 -- (-662.149) (-659.133) [-653.625] (-660.045) * [-652.948] (-653.298) (-656.328) (-668.775) -- 0:01:02
61000 -- (-660.244) (-658.718) [-653.615] (-653.395) * (-654.393) (-655.186) [-656.792] (-663.075) -- 0:01:01
61500 -- (-653.363) (-655.936) [-655.357] (-657.694) * [-655.087] (-653.601) (-656.753) (-669.442) -- 0:01:01
62000 -- (-657.076) [-655.933] (-654.370) (-659.888) * (-653.398) [-652.708] (-654.908) (-666.001) -- 0:01:00
62500 -- (-660.367) [-653.107] (-655.964) (-657.135) * (-657.699) (-654.535) [-659.812] (-660.931) -- 0:01:00
63000 -- (-656.003) [-653.308] (-653.014) (-656.567) * (-653.989) (-654.432) (-653.684) [-653.714] -- 0:01:14
63500 -- (-654.034) (-655.797) (-656.802) [-655.369] * (-655.017) [-653.047] (-654.372) (-655.290) -- 0:01:13
64000 -- (-653.638) (-654.369) [-653.920] (-655.150) * (-657.923) (-652.903) (-653.700) [-658.219] -- 0:01:13
64500 -- (-654.405) (-654.717) (-656.543) [-653.913] * [-658.913] (-653.335) (-660.810) (-661.557) -- 0:01:12
65000 -- [-653.955] (-655.447) (-654.365) (-654.073) * (-655.081) (-655.084) [-654.200] (-661.053) -- 0:01:11
Average standard deviation of split frequencies: 0.035063
65500 -- (-656.528) (-657.354) [-655.525] (-660.931) * (-656.734) (-653.869) (-655.591) [-656.533] -- 0:01:11
66000 -- (-655.931) (-656.382) (-653.748) [-654.668] * [-653.382] (-654.264) (-653.939) (-655.114) -- 0:01:10
66500 -- (-658.389) (-654.345) (-653.853) [-655.433] * (-656.529) (-657.083) (-655.977) [-653.300] -- 0:01:10
67000 -- [-653.481] (-653.843) (-653.849) (-655.875) * (-661.221) (-653.304) [-654.452] (-654.432) -- 0:01:09
67500 -- (-659.385) (-659.561) (-652.984) [-657.500] * [-653.196] (-654.964) (-655.196) (-654.699) -- 0:01:09
68000 -- (-659.357) (-657.784) [-653.315] (-655.045) * (-655.061) (-654.457) [-657.501] (-655.359) -- 0:01:08
68500 -- (-656.132) (-654.093) (-658.965) [-655.995] * [-653.725] (-653.763) (-657.681) (-656.046) -- 0:01:07
69000 -- (-654.152) (-659.088) (-657.621) [-656.562] * (-653.620) (-653.961) (-656.179) [-656.891] -- 0:01:07
69500 -- [-656.234] (-657.905) (-653.627) (-653.479) * (-655.579) [-656.241] (-657.845) (-658.515) -- 0:01:06
70000 -- (-654.951) (-656.012) [-654.100] (-654.948) * (-654.739) (-653.758) (-657.143) [-658.416] -- 0:01:06
Average standard deviation of split frequencies: 0.034625
70500 -- (-657.042) [-658.425] (-657.486) (-655.013) * (-655.279) [-653.941] (-654.572) (-652.823) -- 0:01:05
71000 -- [-654.750] (-654.203) (-654.359) (-658.453) * (-654.687) (-655.887) [-657.687] (-655.324) -- 0:01:05
71500 -- (-654.423) (-654.023) (-653.560) [-662.727] * (-660.239) (-654.038) [-654.506] (-653.988) -- 0:01:04
72000 -- (-653.847) (-654.524) [-656.013] (-656.525) * (-658.753) (-653.144) (-654.967) [-654.593] -- 0:01:04
72500 -- (-653.189) (-653.076) [-654.348] (-653.971) * (-662.172) (-653.165) (-653.938) [-653.373] -- 0:01:03
73000 -- (-655.333) (-654.318) [-654.015] (-656.031) * [-655.189] (-652.935) (-653.157) (-656.906) -- 0:01:03
73500 -- (-656.508) [-653.101] (-655.127) (-655.937) * (-653.728) (-656.844) (-653.702) [-655.432] -- 0:01:03
74000 -- (-654.613) [-653.295] (-661.043) (-655.159) * (-653.607) [-654.074] (-655.985) (-656.908) -- 0:01:02
74500 -- [-656.069] (-654.648) (-657.410) (-653.827) * (-654.237) (-655.578) [-656.793] (-654.622) -- 0:01:02
75000 -- (-656.198) (-654.168) [-653.072] (-654.708) * (-654.257) (-655.377) [-654.459] (-655.073) -- 0:01:01
Average standard deviation of split frequencies: 0.033376
75500 -- (-660.431) (-653.581) [-654.965] (-658.500) * (-654.426) (-656.659) [-653.297] (-655.340) -- 0:01:01
76000 -- (-654.079) (-654.471) (-655.529) [-656.913] * (-659.469) (-655.562) [-652.937] (-655.416) -- 0:01:00
76500 -- (-655.995) [-656.459] (-655.537) (-659.482) * (-654.378) (-656.079) [-653.361] (-655.821) -- 0:01:00
77000 -- (-655.566) [-653.354] (-657.750) (-657.325) * [-654.509] (-659.440) (-653.954) (-655.147) -- 0:00:59
77500 -- (-652.691) (-653.502) [-655.563] (-654.871) * (-658.829) (-655.649) [-654.748] (-654.189) -- 0:01:11
78000 -- (-654.368) (-654.672) [-658.964] (-654.926) * [-654.624] (-658.636) (-653.076) (-655.369) -- 0:01:10
78500 -- (-655.661) [-655.273] (-656.449) (-657.743) * (-653.135) (-659.570) (-653.942) [-655.208] -- 0:01:10
79000 -- [-654.722] (-655.100) (-656.212) (-652.648) * (-655.584) (-654.189) (-654.588) [-654.655] -- 0:01:09
79500 -- [-654.917] (-655.895) (-661.128) (-654.202) * (-653.943) (-653.346) [-656.435] (-656.695) -- 0:01:09
80000 -- (-655.600) (-656.914) (-658.895) [-654.824] * (-657.200) (-655.299) (-653.867) [-653.901] -- 0:01:09
Average standard deviation of split frequencies: 0.029804
80500 -- (-653.244) (-654.756) [-657.541] (-656.247) * (-653.683) (-655.151) [-660.482] (-657.357) -- 0:01:08
81000 -- (-652.825) (-659.050) (-657.328) [-655.124] * [-654.626] (-654.786) (-655.336) (-658.860) -- 0:01:08
81500 -- (-654.249) (-654.786) (-656.493) [-655.112] * [-655.541] (-656.067) (-654.616) (-656.969) -- 0:01:07
82000 -- [-653.860] (-656.007) (-653.050) (-653.893) * (-665.671) (-660.333) (-655.022) [-653.635] -- 0:01:07
82500 -- (-654.375) (-654.462) [-654.436] (-654.031) * (-657.616) (-656.501) [-654.453] (-653.673) -- 0:01:06
83000 -- [-654.495] (-662.845) (-653.089) (-656.011) * (-654.163) (-654.022) (-657.587) [-652.976] -- 0:01:06
83500 -- (-655.823) [-654.333] (-655.309) (-653.737) * (-654.238) (-654.732) [-655.395] (-653.979) -- 0:01:05
84000 -- (-654.901) (-654.240) (-654.455) [-654.638] * (-653.780) (-655.836) [-655.677] (-655.598) -- 0:01:05
84500 -- (-655.663) (-655.073) (-654.728) [-653.289] * [-654.283] (-653.936) (-653.889) (-656.321) -- 0:01:05
85000 -- (-654.998) (-655.823) (-655.678) [-654.883] * (-653.468) [-654.796] (-654.852) (-654.393) -- 0:01:04
Average standard deviation of split frequencies: 0.029874
85500 -- (-653.811) (-658.315) (-655.108) [-654.660] * [-655.053] (-655.020) (-653.086) (-654.601) -- 0:01:04
86000 -- (-655.203) [-655.877] (-654.765) (-653.535) * [-655.223] (-654.148) (-654.097) (-655.496) -- 0:01:03
86500 -- (-652.974) [-656.763] (-657.079) (-653.159) * [-654.139] (-653.055) (-654.012) (-654.770) -- 0:01:03
87000 -- (-660.001) [-656.674] (-655.531) (-654.062) * (-655.298) [-653.415] (-656.071) (-654.906) -- 0:01:02
87500 -- (-655.625) [-657.303] (-655.002) (-657.868) * (-654.089) [-654.013] (-653.350) (-656.677) -- 0:01:02
88000 -- (-656.468) (-658.514) (-657.696) [-654.661] * (-652.864) [-656.475] (-653.995) (-655.414) -- 0:01:02
88500 -- (-653.268) [-653.092] (-655.205) (-657.102) * [-654.049] (-658.640) (-657.189) (-653.123) -- 0:01:01
89000 -- (-653.511) (-655.211) [-654.391] (-660.169) * (-655.970) (-657.993) (-656.133) [-653.701] -- 0:01:01
89500 -- [-653.834] (-654.000) (-654.575) (-659.143) * (-655.040) [-654.987] (-654.033) (-655.466) -- 0:01:01
90000 -- (-654.458) (-654.021) [-654.883] (-656.003) * (-654.964) [-659.669] (-658.464) (-656.423) -- 0:01:00
Average standard deviation of split frequencies: 0.028186
90500 -- (-654.878) (-654.410) (-653.670) [-656.894] * (-655.728) (-654.831) [-654.506] (-654.008) -- 0:01:00
91000 -- (-653.433) [-657.235] (-655.840) (-657.704) * (-653.404) [-654.768] (-655.999) (-652.802) -- 0:00:59
91500 -- (-653.134) (-657.341) (-655.158) [-655.473] * (-652.962) (-653.605) [-655.248] (-653.924) -- 0:01:09
92000 -- [-653.759] (-653.965) (-653.751) (-655.273) * [-655.241] (-658.378) (-654.874) (-653.739) -- 0:01:09
92500 -- (-654.063) (-654.331) [-653.845] (-655.733) * (-657.154) (-654.016) (-656.050) [-654.376] -- 0:01:08
93000 -- [-653.554] (-654.827) (-655.609) (-655.335) * (-654.597) [-653.200] (-655.903) (-656.220) -- 0:01:08
93500 -- [-656.081] (-655.822) (-655.355) (-655.233) * (-655.530) [-654.431] (-653.068) (-654.586) -- 0:01:07
94000 -- (-654.362) [-659.504] (-654.453) (-653.917) * (-654.011) [-654.006] (-654.839) (-654.187) -- 0:01:07
94500 -- [-655.365] (-653.707) (-655.531) (-658.049) * (-654.480) (-654.094) [-653.365] (-654.679) -- 0:01:07
95000 -- [-656.291] (-655.570) (-654.561) (-656.854) * (-653.438) [-653.989] (-656.087) (-655.484) -- 0:01:06
Average standard deviation of split frequencies: 0.022743
95500 -- (-653.792) [-657.575] (-655.566) (-654.116) * (-654.707) [-653.922] (-656.187) (-653.067) -- 0:01:06
96000 -- (-654.016) (-658.992) (-654.191) [-657.695] * [-653.661] (-653.515) (-652.819) (-653.010) -- 0:01:05
96500 -- [-655.721] (-663.129) (-653.185) (-655.906) * [-655.531] (-653.704) (-652.698) (-654.006) -- 0:01:05
97000 -- (-653.416) (-660.308) [-652.885] (-659.710) * (-653.478) (-655.813) [-653.158] (-654.463) -- 0:01:05
97500 -- (-653.427) [-658.834] (-654.837) (-659.538) * (-653.972) (-653.315) [-654.203] (-652.920) -- 0:01:04
98000 -- (-656.007) (-656.705) [-653.660] (-658.275) * (-654.303) [-654.200] (-653.221) (-653.615) -- 0:01:04
98500 -- (-655.126) [-654.032] (-654.119) (-655.482) * (-655.077) [-653.334] (-652.877) (-655.061) -- 0:01:04
99000 -- (-654.133) (-653.521) (-653.575) [-653.335] * (-653.960) (-657.680) (-657.912) [-655.798] -- 0:01:03
99500 -- [-654.123] (-655.586) (-653.876) (-654.357) * [-655.260] (-657.574) (-657.064) (-655.441) -- 0:01:03
100000 -- (-655.012) (-658.928) (-653.445) [-653.515] * [-653.422] (-656.058) (-653.849) (-656.702) -- 0:01:02
Average standard deviation of split frequencies: 0.024715
100500 -- [-652.934] (-654.004) (-655.560) (-653.647) * (-653.531) [-655.966] (-653.604) (-655.827) -- 0:01:02
101000 -- (-654.085) [-653.603] (-653.935) (-654.436) * (-654.262) (-654.391) (-655.841) [-655.602] -- 0:01:02
101500 -- [-654.959] (-654.129) (-653.881) (-656.559) * [-659.171] (-653.524) (-656.782) (-653.579) -- 0:01:01
102000 -- (-654.557) [-653.225] (-657.189) (-654.765) * (-658.932) (-653.457) (-655.097) [-653.127] -- 0:01:01
102500 -- (-656.935) (-653.604) [-653.057] (-655.449) * (-657.523) (-658.926) (-656.060) [-654.864] -- 0:01:01
103000 -- (-657.303) [-658.916] (-654.966) (-654.551) * (-656.503) (-653.628) (-658.223) [-653.455] -- 0:01:00
103500 -- (-655.023) [-655.308] (-655.546) (-663.127) * [-654.079] (-656.556) (-656.296) (-653.737) -- 0:01:00
104000 -- (-653.695) [-653.702] (-653.998) (-655.295) * (-653.543) (-654.964) (-654.795) [-654.523] -- 0:01:00
104500 -- [-654.408] (-656.727) (-654.966) (-656.762) * (-655.346) [-653.632] (-653.762) (-655.604) -- 0:00:59
105000 -- (-656.965) (-653.941) (-654.458) [-656.118] * (-654.319) (-657.408) (-654.398) [-656.512] -- 0:00:59
Average standard deviation of split frequencies: 0.025045
105500 -- (-654.254) (-654.381) (-657.498) [-655.306] * (-654.855) (-655.709) [-654.163] (-658.799) -- 0:01:07
106000 -- [-654.165] (-654.978) (-656.373) (-656.028) * (-654.036) (-658.614) (-653.470) [-658.294] -- 0:01:07
106500 -- (-659.313) (-654.896) (-655.289) [-653.012] * (-661.069) (-654.745) (-653.254) [-654.537] -- 0:01:07
107000 -- (-656.250) (-654.978) (-657.296) [-653.573] * [-655.356] (-659.556) (-654.285) (-655.758) -- 0:01:06
107500 -- (-653.872) [-653.353] (-656.605) (-653.689) * (-659.013) (-657.182) [-656.709] (-659.275) -- 0:01:06
108000 -- [-653.714] (-654.823) (-665.844) (-653.459) * (-657.236) (-654.883) [-655.601] (-660.224) -- 0:01:06
108500 -- [-653.948] (-652.861) (-659.442) (-652.741) * (-655.048) [-652.842] (-661.779) (-653.683) -- 0:01:05
109000 -- (-654.186) (-657.128) [-654.857] (-655.220) * (-653.775) (-652.785) [-653.281] (-655.620) -- 0:01:05
109500 -- (-654.824) [-656.187] (-653.887) (-654.740) * [-653.491] (-654.861) (-653.014) (-657.633) -- 0:01:05
110000 -- (-655.056) [-655.710] (-656.447) (-653.567) * (-655.768) [-654.669] (-656.518) (-655.154) -- 0:01:04
Average standard deviation of split frequencies: 0.019808
110500 -- [-655.833] (-654.903) (-654.896) (-659.620) * [-660.066] (-654.662) (-653.437) (-656.615) -- 0:01:04
111000 -- (-653.997) (-655.224) (-656.625) [-654.113] * (-660.753) (-653.786) (-653.632) [-657.175] -- 0:01:04
111500 -- (-655.398) (-658.205) (-655.700) [-654.773] * (-665.737) (-656.427) [-654.036] (-659.735) -- 0:01:03
112000 -- (-655.308) (-656.484) (-652.968) [-654.345] * (-656.225) [-655.681] (-652.873) (-655.048) -- 0:01:03
112500 -- [-653.904] (-654.024) (-656.388) (-657.708) * (-654.091) (-655.245) [-655.439] (-655.754) -- 0:01:03
113000 -- (-657.383) (-657.126) [-653.551] (-655.033) * (-656.931) (-654.774) [-654.191] (-653.917) -- 0:01:02
113500 -- (-655.789) (-659.273) [-652.540] (-655.711) * (-654.844) (-657.806) (-654.123) [-653.678] -- 0:01:02
114000 -- [-653.441] (-655.722) (-655.077) (-656.220) * [-655.836] (-656.552) (-653.987) (-655.555) -- 0:01:02
114500 -- (-654.905) (-657.576) [-654.587] (-658.244) * (-660.628) (-654.479) (-656.839) [-656.276] -- 0:01:01
115000 -- [-654.136] (-654.220) (-654.397) (-653.868) * (-659.766) (-653.421) [-653.936] (-655.690) -- 0:01:01
Average standard deviation of split frequencies: 0.019710
115500 -- (-654.576) [-652.708] (-652.675) (-656.045) * [-660.943] (-655.241) (-654.551) (-661.848) -- 0:01:01
116000 -- (-655.268) [-654.321] (-657.671) (-652.720) * (-653.663) (-655.055) [-653.460] (-659.874) -- 0:01:00
116500 -- (-655.607) (-654.252) (-657.451) [-654.852] * [-657.225] (-653.343) (-657.740) (-658.673) -- 0:01:00
117000 -- [-656.743] (-653.484) (-653.560) (-656.039) * [-653.895] (-654.829) (-654.170) (-657.379) -- 0:01:00
117500 -- (-653.823) [-656.060] (-659.489) (-657.618) * [-653.918] (-656.096) (-656.801) (-656.451) -- 0:01:00
118000 -- (-654.237) (-654.305) [-659.519] (-656.243) * (-654.214) (-653.208) [-653.131] (-653.687) -- 0:00:59
118500 -- (-656.565) (-652.942) [-656.864] (-657.028) * [-655.701] (-657.571) (-656.718) (-657.259) -- 0:00:59
119000 -- (-655.981) (-655.523) [-656.058] (-654.851) * (-656.596) (-654.861) [-657.806] (-654.105) -- 0:00:59
119500 -- (-654.052) (-654.589) [-653.910] (-658.358) * [-657.126] (-655.958) (-657.096) (-653.946) -- 0:00:58
120000 -- (-655.024) (-654.681) (-656.094) [-654.212] * (-656.637) [-654.453] (-654.619) (-656.686) -- 0:00:58
Average standard deviation of split frequencies: 0.018916
120500 -- (-655.114) [-657.883] (-655.238) (-654.161) * (-654.458) (-655.238) (-653.345) [-653.951] -- 0:01:05
121000 -- (-654.391) (-656.712) [-655.677] (-655.144) * (-654.016) [-653.389] (-653.372) (-656.541) -- 0:01:05
121500 -- (-655.967) [-656.266] (-653.158) (-653.528) * (-653.862) (-656.782) (-653.164) [-653.360] -- 0:01:05
122000 -- [-656.122] (-657.167) (-656.050) (-653.489) * [-655.715] (-656.669) (-654.555) (-660.503) -- 0:01:04
122500 -- (-656.029) (-655.479) [-654.457] (-653.665) * (-654.424) (-656.271) [-655.692] (-654.339) -- 0:01:04
123000 -- (-656.597) (-656.824) [-655.731] (-654.711) * (-657.813) (-657.011) [-653.227] (-654.690) -- 0:01:04
123500 -- [-654.899] (-656.957) (-657.843) (-656.902) * (-654.466) (-653.311) (-657.528) [-655.064] -- 0:01:03
124000 -- (-656.555) (-657.760) [-656.636] (-656.833) * (-656.471) (-653.763) (-658.471) [-656.760] -- 0:01:03
124500 -- [-655.021] (-655.640) (-656.864) (-653.738) * (-656.466) (-654.976) [-658.446] (-654.991) -- 0:01:03
125000 -- (-656.336) (-654.406) [-653.693] (-654.488) * (-656.364) (-654.961) [-655.666] (-654.142) -- 0:01:03
Average standard deviation of split frequencies: 0.019455
125500 -- (-659.025) (-655.187) [-655.510] (-656.198) * [-659.310] (-655.077) (-653.428) (-653.614) -- 0:01:02
126000 -- (-654.827) (-657.205) [-654.333] (-657.618) * (-662.372) (-652.840) (-653.997) [-655.334] -- 0:01:02
126500 -- (-655.125) [-653.609] (-657.568) (-656.782) * [-654.600] (-653.203) (-657.102) (-654.297) -- 0:01:02
127000 -- (-654.428) (-655.236) (-658.567) [-654.806] * (-653.090) (-653.745) (-655.543) [-654.970] -- 0:01:01
127500 -- (-653.810) (-653.237) [-654.262] (-654.915) * (-655.977) [-654.868] (-655.516) (-656.159) -- 0:01:01
128000 -- (-653.796) [-655.488] (-653.692) (-654.090) * [-655.457] (-653.000) (-656.842) (-653.941) -- 0:01:01
128500 -- (-656.796) (-654.162) (-657.012) [-655.960] * (-656.725) (-654.465) (-653.877) [-653.421] -- 0:01:01
129000 -- [-654.679] (-654.753) (-655.197) (-654.023) * (-653.095) [-652.686] (-654.716) (-653.815) -- 0:01:00
129500 -- (-658.441) (-653.561) (-656.286) [-653.190] * [-653.780] (-653.836) (-653.586) (-654.141) -- 0:01:00
130000 -- [-658.962] (-661.706) (-657.017) (-652.894) * (-656.178) [-652.922] (-653.752) (-653.328) -- 0:01:00
Average standard deviation of split frequencies: 0.021266
130500 -- (-657.105) [-656.877] (-654.924) (-654.098) * (-656.400) (-653.992) [-655.192] (-653.785) -- 0:00:59
131000 -- (-660.463) (-653.723) [-653.519] (-653.583) * (-654.420) (-653.500) (-654.364) [-654.952] -- 0:00:59
131500 -- (-654.828) (-654.520) (-652.825) [-655.201] * [-654.644] (-653.347) (-655.944) (-656.391) -- 0:00:59
132000 -- [-657.737] (-654.992) (-653.478) (-654.891) * (-655.159) (-655.747) (-656.214) [-653.505] -- 0:00:59
132500 -- (-654.838) (-656.461) [-654.983] (-655.520) * [-659.948] (-653.453) (-657.238) (-653.564) -- 0:00:58
133000 -- (-660.142) [-659.194] (-654.920) (-656.078) * (-655.199) [-653.440] (-657.524) (-654.574) -- 0:00:58
133500 -- (-654.073) (-654.267) [-656.494] (-657.195) * [-657.521] (-654.633) (-657.120) (-656.970) -- 0:00:58
134000 -- [-653.169] (-655.181) (-654.890) (-653.146) * [-654.408] (-655.873) (-656.259) (-656.830) -- 0:00:58
134500 -- [-655.659] (-654.544) (-655.771) (-653.246) * [-655.795] (-654.197) (-655.357) (-659.436) -- 0:00:57
135000 -- (-653.367) (-655.265) (-655.954) [-655.966] * [-656.236] (-654.091) (-654.431) (-656.631) -- 0:00:57
Average standard deviation of split frequencies: 0.020605
135500 -- (-654.803) (-655.248) (-656.310) [-653.637] * (-657.754) (-654.313) [-653.902] (-655.231) -- 0:00:57
136000 -- (-653.936) (-655.268) (-655.196) [-655.743] * (-657.160) [-653.759] (-654.433) (-654.372) -- 0:00:57
136500 -- (-655.027) (-654.872) (-656.192) [-654.319] * (-655.640) (-655.702) [-655.766] (-655.164) -- 0:01:03
137000 -- (-655.020) (-654.068) (-656.202) [-654.629] * [-661.547] (-658.009) (-655.103) (-657.930) -- 0:01:02
137500 -- [-655.548] (-655.552) (-654.932) (-653.022) * (-654.033) (-659.055) (-653.646) [-656.920] -- 0:01:02
138000 -- (-652.857) [-653.621] (-656.719) (-654.412) * [-653.598] (-656.449) (-653.149) (-655.011) -- 0:01:02
138500 -- (-655.614) [-654.500] (-662.189) (-653.523) * [-656.605] (-655.103) (-652.898) (-654.133) -- 0:01:02
139000 -- (-653.202) [-652.712] (-654.268) (-654.434) * (-660.552) (-654.245) [-656.379] (-654.936) -- 0:01:01
139500 -- (-656.600) [-655.650] (-654.210) (-654.214) * (-657.375) (-654.997) [-654.896] (-653.979) -- 0:01:01
140000 -- (-654.728) [-654.272] (-653.329) (-655.872) * (-655.286) (-655.432) [-652.918] (-655.245) -- 0:01:01
Average standard deviation of split frequencies: 0.020502
140500 -- (-654.845) (-656.963) [-653.908] (-656.260) * (-656.795) (-654.963) [-655.230] (-656.849) -- 0:01:01
141000 -- [-654.875] (-653.638) (-655.454) (-657.666) * (-652.907) (-658.299) [-654.273] (-659.752) -- 0:01:00
141500 -- (-657.623) (-653.984) [-654.005] (-653.986) * (-652.864) (-659.465) (-653.100) [-655.509] -- 0:01:00
142000 -- (-655.459) (-654.238) [-652.993] (-654.755) * (-653.074) (-659.399) [-652.890] (-655.387) -- 0:01:00
142500 -- (-658.135) (-654.808) [-654.503] (-658.398) * (-655.542) (-653.655) (-653.451) [-656.154] -- 0:01:00
143000 -- (-654.940) (-653.857) [-653.223] (-654.352) * (-654.306) [-653.323] (-657.141) (-659.356) -- 0:00:59
143500 -- (-654.080) (-655.797) [-653.320] (-653.682) * (-653.978) [-655.284] (-655.122) (-654.501) -- 0:00:59
144000 -- (-656.367) [-654.190] (-653.398) (-656.954) * (-655.255) (-654.035) [-656.942] (-654.024) -- 0:00:59
144500 -- (-654.114) [-654.971] (-654.109) (-654.400) * (-655.678) (-654.410) [-656.697] (-655.419) -- 0:00:59
145000 -- [-656.734] (-655.023) (-655.336) (-653.484) * (-654.441) (-654.423) (-654.441) [-654.597] -- 0:00:58
Average standard deviation of split frequencies: 0.020503
145500 -- (-653.541) [-653.757] (-653.678) (-656.659) * (-656.258) (-654.321) [-653.554] (-658.330) -- 0:00:58
146000 -- (-653.969) [-654.358] (-653.432) (-653.870) * [-653.581] (-658.299) (-654.959) (-657.198) -- 0:00:58
146500 -- (-654.055) (-654.370) (-659.221) [-654.944] * (-655.764) (-654.457) [-657.541] (-657.946) -- 0:00:58
147000 -- (-653.144) (-654.257) [-654.402] (-656.037) * (-657.091) (-655.668) [-655.875] (-655.783) -- 0:00:58
147500 -- (-654.322) (-653.812) [-654.689] (-653.527) * (-654.449) (-659.190) (-655.782) [-653.309] -- 0:00:57
148000 -- (-654.885) (-659.285) [-653.323] (-655.404) * [-654.631] (-662.349) (-654.744) (-656.970) -- 0:00:57
148500 -- [-654.501] (-657.634) (-654.138) (-654.237) * [-652.817] (-661.812) (-653.214) (-655.555) -- 0:00:57
149000 -- (-654.134) (-656.929) [-653.580] (-654.460) * [-653.923] (-655.625) (-655.501) (-654.852) -- 0:00:57
149500 -- [-654.978] (-652.890) (-655.573) (-654.461) * (-655.882) [-657.194] (-654.228) (-656.617) -- 0:00:56
150000 -- (-656.462) [-653.769] (-654.079) (-657.322) * [-654.705] (-655.953) (-654.422) (-660.022) -- 0:00:56
Average standard deviation of split frequencies: 0.020981
150500 -- [-653.208] (-657.144) (-658.280) (-655.507) * (-653.622) (-654.689) (-653.726) [-656.951] -- 0:00:56
151000 -- (-652.959) (-658.676) (-659.653) [-655.988] * (-652.889) (-657.372) (-654.005) [-654.500] -- 0:00:56
151500 -- (-653.045) [-654.659] (-654.949) (-654.027) * (-657.823) (-661.655) (-653.597) [-653.114] -- 0:00:56
152000 -- (-656.490) (-659.329) [-654.854] (-660.028) * (-658.199) (-654.036) (-654.691) [-653.811] -- 0:01:01
152500 -- (-656.663) (-658.564) (-654.533) [-658.574] * [-657.774] (-653.070) (-653.818) (-654.210) -- 0:01:01
153000 -- (-654.849) (-655.095) [-654.289] (-653.765) * (-660.697) [-655.653] (-655.004) (-654.631) -- 0:01:00
153500 -- [-654.687] (-657.221) (-655.232) (-654.028) * (-661.427) [-657.016] (-656.118) (-665.108) -- 0:01:00
154000 -- (-658.282) (-654.249) (-652.911) [-653.547] * (-658.387) [-653.901] (-655.175) (-657.797) -- 0:01:00
154500 -- [-655.349] (-659.562) (-658.293) (-654.145) * (-658.988) (-655.477) (-654.838) [-663.574] -- 0:01:00
155000 -- (-655.237) (-659.448) (-654.186) [-654.050] * [-656.694] (-654.880) (-656.645) (-664.351) -- 0:00:59
Average standard deviation of split frequencies: 0.019978
155500 -- [-657.645] (-659.370) (-654.196) (-654.465) * (-656.139) (-654.284) (-655.431) [-654.952] -- 0:00:59
156000 -- [-655.715] (-656.317) (-654.069) (-654.761) * [-655.459] (-654.762) (-659.925) (-657.725) -- 0:00:59
156500 -- (-657.410) (-654.327) [-654.424] (-653.653) * (-653.363) (-655.134) (-658.649) [-656.563] -- 0:00:59
157000 -- (-655.004) (-655.194) (-658.317) [-653.973] * (-653.135) (-654.287) [-654.816] (-653.441) -- 0:00:59
157500 -- (-655.974) (-654.031) [-655.666] (-655.794) * [-652.898] (-653.862) (-654.501) (-658.595) -- 0:00:58
158000 -- (-658.783) (-654.408) (-654.539) [-656.152] * (-653.896) (-653.198) (-653.992) [-656.317] -- 0:00:58
158500 -- [-656.567] (-654.654) (-656.356) (-654.854) * (-653.985) (-655.802) (-655.112) [-653.719] -- 0:00:58
159000 -- (-654.717) (-656.044) [-655.188] (-654.656) * [-655.900] (-656.681) (-654.430) (-652.903) -- 0:00:58
159500 -- (-655.676) [-654.217] (-655.845) (-657.066) * (-656.269) [-653.974] (-655.060) (-655.342) -- 0:00:57
160000 -- (-658.573) (-657.007) [-653.851] (-653.007) * (-656.384) [-654.381] (-654.793) (-659.148) -- 0:00:57
Average standard deviation of split frequencies: 0.020538
160500 -- [-657.885] (-654.127) (-654.055) (-655.468) * (-655.697) [-655.235] (-652.891) (-657.272) -- 0:00:57
161000 -- [-659.112] (-656.621) (-653.749) (-658.402) * (-653.830) (-653.927) [-653.704] (-653.369) -- 0:00:57
161500 -- (-657.447) (-657.262) (-654.504) [-654.446] * [-654.981] (-653.655) (-654.106) (-654.179) -- 0:00:57
162000 -- (-656.172) [-655.040] (-657.504) (-654.927) * (-654.386) [-654.277] (-655.677) (-653.910) -- 0:00:56
162500 -- [-657.455] (-655.593) (-654.902) (-653.435) * (-655.185) [-652.755] (-657.444) (-653.300) -- 0:00:56
163000 -- (-657.441) (-654.995) (-654.811) [-654.940] * (-654.279) [-652.786] (-657.453) (-652.923) -- 0:00:56
163500 -- (-653.620) (-655.132) [-653.914] (-654.226) * (-659.536) (-657.303) [-654.880] (-655.496) -- 0:00:56
164000 -- (-654.836) [-655.890] (-653.490) (-654.855) * (-654.029) (-657.535) (-653.604) [-655.176] -- 0:00:56
164500 -- [-654.908] (-656.540) (-654.944) (-657.591) * (-654.721) (-656.455) [-656.251] (-656.005) -- 0:00:55
165000 -- (-658.033) (-655.868) [-653.625] (-655.094) * (-656.585) (-656.636) (-656.891) [-656.109] -- 0:00:55
Average standard deviation of split frequencies: 0.016755
165500 -- (-656.054) (-655.672) (-654.287) [-654.799] * (-656.018) (-661.219) (-656.093) [-654.649] -- 0:00:55
166000 -- (-655.688) (-654.391) (-655.232) [-654.902] * (-656.301) (-654.676) [-658.290] (-654.890) -- 0:00:55
166500 -- (-657.704) (-654.158) [-654.946] (-659.633) * (-653.351) (-653.917) [-655.765] (-654.991) -- 0:00:55
167000 -- (-653.160) [-656.588] (-657.875) (-654.788) * (-654.553) (-654.455) (-655.906) [-654.027] -- 0:00:59
167500 -- (-653.567) (-656.166) (-653.712) [-657.330] * [-655.017] (-654.316) (-652.984) (-657.909) -- 0:00:59
168000 -- (-653.054) (-653.441) [-653.960] (-656.208) * (-654.938) [-656.300] (-655.994) (-655.681) -- 0:00:59
168500 -- (-654.137) [-653.887] (-654.026) (-654.660) * (-657.400) [-655.848] (-654.562) (-653.131) -- 0:00:59
169000 -- (-652.995) [-654.482] (-656.541) (-655.998) * (-656.374) (-656.952) (-653.090) [-652.973] -- 0:00:59
169500 -- (-661.196) [-655.234] (-653.424) (-654.219) * (-654.001) (-655.141) (-654.591) [-653.906] -- 0:00:58
170000 -- (-654.290) (-656.264) [-653.275] (-655.550) * (-653.845) (-653.588) (-654.941) [-653.571] -- 0:00:58
Average standard deviation of split frequencies: 0.015410
170500 -- (-658.617) (-654.415) (-656.960) [-653.343] * (-653.431) (-654.783) (-654.464) [-655.527] -- 0:00:58
171000 -- (-658.434) (-657.258) (-654.413) [-653.289] * (-657.424) [-656.791] (-654.024) (-654.838) -- 0:00:58
171500 -- (-657.864) [-655.089] (-653.799) (-654.855) * [-656.946] (-656.113) (-654.039) (-654.607) -- 0:00:57
172000 -- (-655.060) [-654.002] (-658.967) (-656.498) * (-654.319) (-654.588) [-654.716] (-655.742) -- 0:00:57
172500 -- [-657.907] (-654.334) (-659.211) (-656.291) * (-653.950) [-654.121] (-656.089) (-653.478) -- 0:00:57
173000 -- (-657.772) [-653.908] (-655.463) (-655.087) * (-654.601) (-654.912) [-654.873] (-653.746) -- 0:00:57
173500 -- (-656.408) (-654.084) [-653.405] (-653.415) * (-655.236) (-655.074) (-655.875) [-654.489] -- 0:00:57
174000 -- (-655.135) (-655.274) [-654.680] (-654.820) * [-654.260] (-655.598) (-658.598) (-653.030) -- 0:00:56
174500 -- (-654.497) (-655.387) (-655.820) [-656.217] * [-658.068] (-655.734) (-656.775) (-658.326) -- 0:00:56
175000 -- (-655.118) (-654.005) (-652.884) [-655.441] * (-658.489) (-655.319) (-653.629) [-653.682] -- 0:00:56
Average standard deviation of split frequencies: 0.017016
175500 -- (-653.725) (-653.396) [-653.224] (-654.466) * (-656.229) (-653.834) (-653.167) [-654.298] -- 0:00:56
176000 -- (-655.642) (-656.501) (-654.376) [-657.886] * (-653.915) (-655.414) (-653.156) [-655.996] -- 0:00:56
176500 -- (-653.846) (-653.152) (-654.414) [-657.492] * (-657.258) [-655.394] (-656.272) (-654.996) -- 0:00:55
177000 -- [-655.338] (-654.991) (-655.785) (-660.360) * (-654.711) [-654.899] (-657.230) (-657.984) -- 0:00:55
177500 -- [-654.364] (-656.248) (-659.295) (-655.362) * [-654.962] (-653.365) (-655.677) (-654.182) -- 0:00:55
178000 -- (-656.791) (-656.905) (-656.461) [-653.445] * (-655.365) (-653.524) [-654.945] (-657.148) -- 0:00:55
178500 -- [-655.068] (-655.054) (-654.595) (-653.996) * (-653.668) (-653.249) (-662.159) [-658.502] -- 0:00:55
179000 -- (-653.164) [-654.899] (-654.102) (-655.793) * [-653.362] (-655.957) (-656.414) (-653.480) -- 0:00:55
179500 -- [-655.589] (-654.363) (-654.164) (-653.828) * [-655.325] (-653.853) (-656.817) (-654.335) -- 0:00:54
180000 -- (-653.402) (-654.588) [-653.743] (-653.394) * [-661.132] (-658.376) (-653.660) (-654.773) -- 0:00:54
Average standard deviation of split frequencies: 0.018725
180500 -- (-653.723) (-654.506) (-654.156) [-653.501] * (-655.084) (-656.380) (-657.632) [-654.257] -- 0:00:54
181000 -- (-653.357) [-654.397] (-655.506) (-654.201) * (-654.519) (-654.655) [-657.279] (-654.844) -- 0:00:54
181500 -- (-655.812) (-653.599) [-653.506] (-654.465) * (-653.817) (-658.037) (-655.816) [-658.780] -- 0:00:54
182000 -- [-655.504] (-654.596) (-656.719) (-659.133) * (-654.836) [-654.692] (-654.066) (-660.465) -- 0:00:53
182500 -- (-655.721) [-655.214] (-658.304) (-653.733) * (-656.001) (-656.467) (-654.731) [-656.502] -- 0:00:53
183000 -- (-655.737) (-654.664) (-657.397) [-653.794] * (-653.230) [-653.018] (-653.863) (-658.340) -- 0:00:58
183500 -- (-655.322) [-654.142] (-655.079) (-656.267) * (-656.852) (-653.052) [-653.998] (-656.096) -- 0:00:57
184000 -- (-656.148) (-658.335) [-658.169] (-652.951) * (-654.769) [-653.894] (-655.563) (-654.321) -- 0:00:57
184500 -- (-656.579) (-655.080) (-655.911) [-657.189] * (-654.480) (-655.877) (-654.580) [-656.717] -- 0:00:57
185000 -- (-657.452) [-656.419] (-654.111) (-656.331) * (-658.223) (-657.869) (-654.773) [-655.045] -- 0:00:57
Average standard deviation of split frequencies: 0.018586
185500 -- (-658.201) [-657.537] (-657.629) (-655.016) * [-655.126] (-654.648) (-654.471) (-657.254) -- 0:00:57
186000 -- [-654.235] (-655.452) (-657.375) (-653.846) * [-659.222] (-654.298) (-655.451) (-655.358) -- 0:00:56
186500 -- (-655.820) [-654.655] (-654.878) (-655.002) * [-654.151] (-655.706) (-654.993) (-653.515) -- 0:00:56
187000 -- [-658.359] (-655.481) (-656.273) (-654.336) * [-654.408] (-655.698) (-654.464) (-653.084) -- 0:00:56
187500 -- (-659.264) (-657.183) [-654.403] (-657.761) * [-653.710] (-657.653) (-654.612) (-653.622) -- 0:00:56
188000 -- (-659.729) (-654.741) [-656.621] (-658.512) * [-656.853] (-655.251) (-655.619) (-654.884) -- 0:00:56
188500 -- [-654.161] (-653.575) (-653.082) (-657.164) * [-654.226] (-658.447) (-654.390) (-654.106) -- 0:00:55
189000 -- [-654.882] (-654.543) (-652.962) (-658.328) * (-655.430) (-656.760) (-656.946) [-655.345] -- 0:00:55
189500 -- (-660.578) (-653.769) (-658.147) [-655.169] * (-653.662) (-657.795) [-653.777] (-655.892) -- 0:00:55
190000 -- [-656.245] (-655.056) (-658.096) (-657.051) * (-654.047) [-655.776] (-653.116) (-653.478) -- 0:00:55
Average standard deviation of split frequencies: 0.017161
190500 -- [-656.878] (-656.853) (-654.576) (-657.237) * (-658.302) [-655.538] (-654.044) (-655.624) -- 0:00:55
191000 -- (-652.858) (-655.594) [-652.985] (-657.737) * (-656.067) (-655.383) [-654.446] (-655.339) -- 0:00:55
191500 -- [-653.738] (-654.357) (-654.818) (-654.167) * (-655.270) (-654.806) (-653.806) [-653.683] -- 0:00:54
192000 -- [-653.689] (-654.141) (-653.954) (-653.475) * [-652.897] (-656.949) (-653.922) (-653.651) -- 0:00:54
192500 -- (-658.967) (-652.849) [-654.439] (-654.695) * (-654.519) [-657.607] (-653.223) (-653.120) -- 0:00:54
193000 -- [-656.366] (-653.675) (-654.653) (-655.280) * (-655.353) (-656.089) (-654.671) [-655.284] -- 0:00:54
193500 -- [-657.957] (-654.140) (-653.602) (-654.925) * [-654.267] (-653.207) (-652.951) (-654.057) -- 0:00:54
194000 -- [-654.260] (-660.278) (-655.062) (-653.441) * (-654.717) (-654.161) (-654.325) [-653.797] -- 0:00:54
194500 -- (-655.338) (-658.839) [-652.547] (-655.491) * (-653.586) [-653.321] (-654.156) (-655.578) -- 0:00:53
195000 -- (-653.796) [-653.295] (-653.603) (-654.248) * [-654.934] (-655.448) (-654.376) (-656.017) -- 0:00:53
Average standard deviation of split frequencies: 0.016836
195500 -- (-653.796) (-656.531) [-654.158] (-654.114) * (-658.274) (-657.137) (-655.964) [-656.539] -- 0:00:53
196000 -- (-652.964) [-653.633] (-652.795) (-653.376) * (-655.934) (-655.318) [-654.944] (-655.165) -- 0:00:53
196500 -- (-659.045) (-658.507) [-655.517] (-654.125) * (-654.720) [-654.001] (-654.525) (-654.534) -- 0:00:53
197000 -- (-653.044) (-658.192) [-655.615] (-656.830) * [-654.546] (-654.119) (-661.201) (-654.699) -- 0:00:52
197500 -- (-659.818) (-655.247) (-654.785) [-657.229] * (-656.320) (-655.818) (-659.405) [-653.667] -- 0:00:52
198000 -- [-655.413] (-653.867) (-653.052) (-655.522) * (-659.631) (-653.655) [-653.928] (-654.608) -- 0:00:52
198500 -- (-657.983) [-653.641] (-655.194) (-653.421) * (-657.039) (-653.840) [-653.559] (-654.957) -- 0:00:52
199000 -- (-652.735) (-654.276) [-654.005] (-660.040) * (-656.277) (-654.063) (-654.498) [-653.882] -- 0:00:52
199500 -- (-653.421) (-657.047) [-652.644] (-655.192) * (-655.156) (-655.413) (-654.622) [-652.992] -- 0:00:52
200000 -- (-655.045) (-657.216) [-654.364] (-655.542) * (-655.972) (-655.445) (-656.287) [-655.444] -- 0:00:55
Average standard deviation of split frequencies: 0.017749
200500 -- [-655.220] (-658.000) (-656.859) (-655.216) * (-653.022) (-655.581) [-655.874] (-653.684) -- 0:00:55
201000 -- (-654.812) (-653.210) [-654.001] (-655.943) * [-653.512] (-655.143) (-653.931) (-652.838) -- 0:00:55
201500 -- (-653.848) [-654.683] (-655.533) (-656.204) * (-654.266) (-654.210) (-655.693) [-655.414] -- 0:00:55
202000 -- (-656.010) (-654.650) [-653.379] (-655.144) * (-654.798) (-655.564) [-654.996] (-655.665) -- 0:00:55
202500 -- [-657.354] (-655.401) (-655.586) (-653.752) * (-655.661) (-654.995) [-655.690] (-653.621) -- 0:00:55
203000 -- (-657.250) (-653.547) [-657.462] (-654.605) * (-655.820) (-653.950) [-653.520] (-653.839) -- 0:00:54
203500 -- (-654.928) (-655.105) [-653.351] (-654.302) * (-655.132) (-653.841) [-652.869] (-654.163) -- 0:00:54
204000 -- [-658.637] (-656.995) (-657.144) (-654.818) * (-657.292) (-654.606) (-655.895) [-656.883] -- 0:00:54
204500 -- [-654.673] (-662.037) (-655.194) (-658.803) * (-656.083) (-654.126) [-654.837] (-656.780) -- 0:00:54
205000 -- (-656.085) [-654.437] (-655.215) (-657.052) * (-655.947) [-655.182] (-658.229) (-654.919) -- 0:00:54
Average standard deviation of split frequencies: 0.018066
205500 -- [-654.557] (-655.042) (-655.368) (-656.452) * [-655.430] (-655.241) (-654.413) (-654.282) -- 0:00:54
206000 -- (-657.949) (-654.233) [-654.979] (-658.409) * (-656.901) (-658.703) [-653.960] (-654.144) -- 0:00:53
206500 -- [-656.278] (-658.460) (-653.535) (-658.007) * [-656.206] (-653.442) (-656.291) (-656.747) -- 0:00:53
207000 -- (-655.913) (-654.071) [-653.851] (-653.722) * (-652.932) [-653.860] (-655.528) (-653.362) -- 0:00:53
207500 -- (-653.468) (-654.233) [-655.005] (-657.403) * [-655.443] (-652.587) (-655.087) (-654.936) -- 0:00:53
208000 -- (-654.697) [-653.154] (-655.898) (-654.210) * [-653.797] (-652.885) (-654.289) (-655.447) -- 0:00:53
208500 -- (-655.023) (-654.652) (-655.078) [-654.951] * (-655.627) (-655.319) (-655.035) [-654.877] -- 0:00:53
209000 -- (-655.925) (-655.783) [-653.381] (-656.918) * (-654.841) (-654.666) [-653.596] (-654.358) -- 0:00:52
209500 -- (-658.754) [-653.474] (-655.761) (-654.994) * (-653.318) (-657.714) (-656.373) [-653.057] -- 0:00:52
210000 -- (-654.240) (-653.583) (-655.864) [-654.804] * [-653.016] (-658.200) (-655.678) (-652.877) -- 0:00:52
Average standard deviation of split frequencies: 0.016907
210500 -- (-653.956) (-657.072) [-654.131] (-654.944) * (-657.083) [-654.772] (-655.288) (-654.938) -- 0:00:52
211000 -- (-657.236) (-655.185) (-655.026) [-657.287] * (-655.755) (-654.049) (-654.649) [-653.469] -- 0:00:52
211500 -- (-654.924) [-653.427] (-657.110) (-661.024) * (-656.689) (-655.441) [-655.836] (-654.537) -- 0:00:52
212000 -- (-656.105) [-653.245] (-655.268) (-654.548) * (-654.973) [-653.551] (-658.501) (-657.834) -- 0:00:52
212500 -- (-655.356) (-653.693) (-660.357) [-653.928] * (-653.871) (-654.048) [-659.260] (-653.466) -- 0:00:51
213000 -- [-657.798] (-653.832) (-660.479) (-654.570) * [-654.244] (-658.086) (-653.362) (-653.390) -- 0:00:51
213500 -- (-653.233) (-654.939) (-658.038) [-656.874] * (-653.689) (-654.752) [-653.706] (-653.483) -- 0:00:51
214000 -- (-653.365) [-658.240] (-657.425) (-653.371) * (-654.309) (-656.022) [-653.939] (-653.459) -- 0:00:51
214500 -- (-654.970) [-656.909] (-654.153) (-652.956) * (-653.390) (-653.626) (-653.966) [-655.626] -- 0:00:51
215000 -- [-652.920] (-656.728) (-655.080) (-654.344) * [-653.602] (-654.599) (-654.122) (-653.380) -- 0:00:51
Average standard deviation of split frequencies: 0.017581
215500 -- (-654.364) [-654.901] (-654.543) (-658.559) * (-654.657) [-654.796] (-653.742) (-653.809) -- 0:00:50
216000 -- [-654.168] (-654.442) (-656.053) (-656.803) * (-654.064) (-654.224) (-654.971) [-653.161] -- 0:00:50
216500 -- (-654.468) (-653.325) (-657.145) [-654.023] * (-656.733) (-655.355) [-653.499] (-653.781) -- 0:00:50
217000 -- (-655.845) (-654.577) [-654.566] (-653.755) * (-655.700) (-655.799) [-653.881] (-653.496) -- 0:00:54
217500 -- (-655.853) (-655.417) [-656.228] (-652.896) * (-653.452) (-656.279) (-653.444) [-654.458] -- 0:00:53
218000 -- (-657.440) (-652.987) [-654.160] (-654.837) * (-655.996) [-653.395] (-655.031) (-653.823) -- 0:00:53
218500 -- (-664.590) (-658.926) [-661.208] (-656.373) * [-653.813] (-654.180) (-655.852) (-653.392) -- 0:00:53
219000 -- (-659.111) (-656.718) [-660.523] (-658.821) * (-653.280) (-653.660) (-654.468) [-652.679] -- 0:00:53
219500 -- (-658.220) (-658.450) [-654.287] (-656.602) * [-654.381] (-653.504) (-657.413) (-653.809) -- 0:00:53
220000 -- [-655.454] (-655.901) (-656.731) (-653.698) * (-655.694) (-654.078) [-655.458] (-657.392) -- 0:00:53
Average standard deviation of split frequencies: 0.016734
220500 -- (-655.019) [-655.095] (-654.048) (-655.667) * (-655.179) (-654.205) (-653.539) [-655.072] -- 0:00:53
221000 -- (-654.703) [-655.969] (-654.675) (-655.562) * (-656.207) [-653.661] (-654.683) (-653.876) -- 0:00:52
221500 -- (-654.640) [-654.372] (-654.471) (-660.391) * (-654.353) (-655.032) [-653.150] (-653.995) -- 0:00:52
222000 -- (-658.297) (-657.001) (-660.772) [-655.166] * (-654.710) (-658.495) (-660.663) [-655.046] -- 0:00:52
222500 -- (-656.888) (-653.539) [-654.670] (-654.418) * (-657.004) [-654.326] (-654.321) (-653.775) -- 0:00:52
223000 -- (-654.168) [-654.575] (-656.324) (-653.191) * (-654.130) [-653.762] (-657.081) (-655.886) -- 0:00:52
223500 -- [-655.269] (-653.270) (-659.874) (-656.851) * (-655.390) (-654.526) (-656.297) [-652.974] -- 0:00:52
224000 -- [-654.945] (-653.447) (-653.903) (-654.739) * (-656.404) (-655.386) [-659.987] (-654.522) -- 0:00:51
224500 -- [-653.975] (-655.270) (-655.838) (-658.873) * [-657.971] (-655.840) (-655.938) (-654.617) -- 0:00:51
225000 -- (-653.841) (-655.780) (-654.996) [-654.533] * [-653.579] (-655.192) (-653.571) (-654.537) -- 0:00:51
Average standard deviation of split frequencies: 0.015180
225500 -- (-655.817) (-656.716) [-654.409] (-658.456) * [-653.881] (-657.305) (-656.107) (-658.530) -- 0:00:51
226000 -- (-656.033) (-655.300) (-658.200) [-653.785] * (-654.729) [-654.987] (-655.317) (-656.403) -- 0:00:51
226500 -- (-656.300) (-655.083) [-655.273] (-654.332) * [-656.118] (-656.000) (-656.477) (-654.307) -- 0:00:51
227000 -- [-656.299] (-653.942) (-652.688) (-656.465) * [-653.986] (-655.604) (-659.461) (-654.061) -- 0:00:51
227500 -- (-655.711) (-655.396) [-656.831] (-654.409) * (-653.867) [-653.381] (-655.941) (-655.491) -- 0:00:50
228000 -- (-654.866) (-653.279) [-656.617] (-653.934) * (-653.885) (-653.561) (-661.352) [-654.889] -- 0:00:50
228500 -- [-654.026] (-653.885) (-653.935) (-655.340) * (-653.051) [-653.665] (-654.607) (-654.478) -- 0:00:50
229000 -- (-653.446) (-653.823) [-656.179] (-654.833) * (-653.886) [-653.424] (-655.189) (-652.961) -- 0:00:50
229500 -- [-656.436] (-653.274) (-652.896) (-658.006) * (-653.110) [-653.398] (-655.945) (-655.067) -- 0:00:50
230000 -- (-653.446) [-654.339] (-657.111) (-655.797) * (-654.461) [-653.416] (-656.602) (-656.259) -- 0:00:50
Average standard deviation of split frequencies: 0.016242
230500 -- (-657.076) (-653.642) (-655.726) [-654.786] * (-654.142) (-653.644) (-654.479) [-654.102] -- 0:00:50
231000 -- [-654.903] (-653.209) (-659.678) (-656.225) * (-654.177) (-653.369) (-655.115) [-653.653] -- 0:00:49
231500 -- [-653.493] (-654.127) (-652.940) (-658.903) * (-653.774) (-654.195) [-654.570] (-654.046) -- 0:00:49
232000 -- (-661.043) (-654.684) [-652.829] (-657.830) * (-658.108) [-653.830] (-654.155) (-654.473) -- 0:00:49
232500 -- (-653.886) (-660.798) (-653.796) [-656.454] * (-655.839) [-653.180] (-653.609) (-652.878) -- 0:00:49
233000 -- (-653.781) (-655.912) (-657.772) [-655.917] * (-654.734) [-655.827] (-654.352) (-656.422) -- 0:00:49
233500 -- (-655.461) [-657.220] (-660.104) (-657.345) * (-655.184) [-656.744] (-653.872) (-657.102) -- 0:00:49
234000 -- (-653.089) (-654.635) [-653.617] (-654.347) * (-655.220) (-655.437) (-655.352) [-656.177] -- 0:00:52
234500 -- (-655.042) (-654.130) [-652.999] (-654.379) * (-656.838) (-656.513) [-656.140] (-653.185) -- 0:00:52
235000 -- (-654.861) (-657.315) (-654.015) [-653.638] * (-654.511) (-658.265) [-654.533] (-656.983) -- 0:00:52
Average standard deviation of split frequencies: 0.016085
235500 -- (-654.669) (-659.958) (-655.456) [-660.332] * (-655.672) (-662.784) [-654.735] (-656.767) -- 0:00:51
236000 -- (-655.936) (-658.958) (-655.809) [-654.450] * [-657.075] (-655.811) (-657.819) (-653.617) -- 0:00:51
236500 -- (-659.722) (-653.536) [-657.110] (-657.388) * (-658.113) (-653.811) (-662.374) [-653.919] -- 0:00:51
237000 -- [-655.028] (-655.467) (-654.324) (-660.355) * (-655.255) (-654.813) (-656.919) [-655.174] -- 0:00:51
237500 -- (-654.025) (-655.200) [-654.624] (-655.974) * (-654.760) [-653.070] (-654.952) (-654.815) -- 0:00:51
238000 -- [-654.913] (-654.204) (-655.908) (-654.001) * [-656.085] (-654.676) (-654.814) (-656.709) -- 0:00:51
238500 -- (-653.884) [-658.292] (-657.451) (-657.599) * [-654.055] (-653.646) (-653.896) (-654.455) -- 0:00:51
239000 -- (-655.112) (-655.910) (-653.364) [-656.001] * [-653.603] (-653.945) (-653.874) (-653.418) -- 0:00:50
239500 -- (-654.031) (-654.070) [-657.533] (-656.015) * [-658.090] (-653.629) (-653.780) (-657.550) -- 0:00:50
240000 -- (-655.793) (-655.641) [-655.276] (-655.075) * (-657.458) [-656.946] (-654.014) (-656.971) -- 0:00:50
Average standard deviation of split frequencies: 0.016289
240500 -- (-654.605) (-659.144) [-655.912] (-654.999) * (-655.057) [-656.266] (-657.105) (-653.808) -- 0:00:50
241000 -- [-654.023] (-659.065) (-655.636) (-656.630) * (-655.769) (-655.842) (-658.759) [-653.301] -- 0:00:50
241500 -- [-653.391] (-656.706) (-654.367) (-656.855) * (-655.960) [-656.840] (-654.614) (-654.336) -- 0:00:50
242000 -- (-652.912) (-662.188) [-655.614] (-656.300) * [-660.155] (-655.674) (-655.576) (-655.342) -- 0:00:50
242500 -- (-653.678) (-660.338) (-655.529) [-656.414] * (-653.149) [-653.873] (-658.572) (-653.636) -- 0:00:49
243000 -- (-656.133) (-654.883) (-657.938) [-654.891] * (-653.642) (-657.771) [-658.355] (-659.567) -- 0:00:49
243500 -- (-658.497) [-653.841] (-660.194) (-656.629) * (-653.361) (-658.775) (-655.171) [-656.678] -- 0:00:49
244000 -- (-655.183) (-653.379) (-657.398) [-654.020] * (-654.168) (-661.085) (-654.257) [-656.173] -- 0:00:49
244500 -- (-653.684) (-653.467) [-654.312] (-653.016) * (-657.401) (-655.983) (-654.273) [-657.382] -- 0:00:49
245000 -- (-654.532) (-654.326) (-654.011) [-653.104] * (-655.520) [-653.031] (-654.515) (-654.139) -- 0:00:49
Average standard deviation of split frequencies: 0.016137
245500 -- [-655.514] (-654.764) (-652.843) (-654.653) * (-657.096) (-654.193) [-655.024] (-653.456) -- 0:00:49
246000 -- (-655.676) (-653.868) (-655.388) [-656.023] * (-657.081) (-655.134) [-655.235] (-655.413) -- 0:00:49
246500 -- [-657.313] (-654.102) (-653.702) (-659.830) * [-653.102] (-653.740) (-654.040) (-653.497) -- 0:00:48
247000 -- (-654.301) [-653.567] (-653.431) (-655.971) * (-654.130) [-654.660] (-654.321) (-653.406) -- 0:00:48
247500 -- (-657.105) (-654.320) (-655.170) [-654.311] * (-653.982) [-653.740] (-653.149) (-655.887) -- 0:00:48
248000 -- (-656.103) (-656.310) (-656.267) [-656.011] * [-659.070] (-657.197) (-653.123) (-656.978) -- 0:00:48
248500 -- (-657.049) (-653.602) (-656.573) [-656.081] * (-656.721) (-656.302) (-653.262) [-653.006] -- 0:00:48
249000 -- [-653.899] (-654.628) (-653.489) (-655.355) * (-657.155) (-656.012) [-655.535] (-654.967) -- 0:00:48
249500 -- (-655.334) (-656.000) [-654.633] (-657.548) * [-654.271] (-654.676) (-654.774) (-654.802) -- 0:00:48
250000 -- (-659.249) [-655.476] (-655.930) (-656.873) * (-659.470) (-652.961) (-658.152) [-656.023] -- 0:00:48
Average standard deviation of split frequencies: 0.017222
250500 -- (-662.578) (-656.522) (-656.428) [-655.764] * (-653.617) (-654.052) (-653.603) [-656.606] -- 0:00:50
251000 -- [-652.726] (-654.561) (-654.495) (-652.982) * (-655.983) [-654.857] (-654.661) (-657.088) -- 0:00:50
251500 -- (-653.935) (-655.611) [-653.717] (-652.998) * (-654.673) (-657.133) [-654.296] (-656.748) -- 0:00:50
252000 -- (-654.831) (-661.785) [-652.901] (-654.362) * (-654.392) (-656.284) [-653.375] (-656.659) -- 0:00:50
252500 -- (-655.544) (-654.896) (-652.954) [-653.859] * (-653.400) (-660.227) [-653.196] (-655.417) -- 0:00:50
253000 -- (-656.861) (-654.782) (-653.414) [-653.948] * [-654.502] (-654.906) (-654.529) (-653.474) -- 0:00:50
253500 -- (-654.463) [-654.452] (-655.931) (-654.357) * [-654.566] (-654.890) (-656.554) (-654.289) -- 0:00:50
254000 -- (-653.064) (-656.660) (-658.760) [-653.459] * [-658.388] (-654.694) (-657.385) (-654.007) -- 0:00:49
254500 -- [-657.068] (-652.932) (-658.354) (-653.114) * (-656.944) (-653.992) (-655.394) [-653.599] -- 0:00:49
255000 -- (-652.741) (-654.206) [-657.532] (-653.320) * (-654.438) [-657.288] (-656.273) (-653.753) -- 0:00:49
Average standard deviation of split frequencies: 0.017309
255500 -- (-654.056) (-656.326) (-654.369) [-654.882] * (-654.678) (-656.397) (-661.116) [-657.191] -- 0:00:49
256000 -- (-653.787) (-657.034) (-655.323) [-654.300] * (-653.940) (-657.148) (-657.288) [-655.045] -- 0:00:49
256500 -- (-659.299) (-660.991) (-653.233) [-655.473] * (-654.381) [-654.092] (-653.529) (-653.774) -- 0:00:49
257000 -- (-653.836) (-655.545) (-654.959) [-655.912] * [-653.602] (-662.776) (-654.478) (-655.421) -- 0:00:49
257500 -- (-654.384) (-654.815) (-654.641) [-655.478] * (-654.831) (-662.056) (-658.238) [-653.588] -- 0:00:49
258000 -- (-657.239) (-655.253) (-654.618) [-658.142] * [-656.241] (-654.959) (-655.181) (-653.360) -- 0:00:48
258500 -- (-656.196) (-654.145) [-654.621] (-655.016) * (-657.490) (-655.734) (-656.590) [-653.256] -- 0:00:48
259000 -- [-656.426] (-654.636) (-654.464) (-655.973) * (-655.010) (-654.255) (-655.755) [-656.129] -- 0:00:48
259500 -- (-654.075) (-655.165) [-654.819] (-656.302) * [-653.207] (-657.970) (-655.042) (-654.554) -- 0:00:48
260000 -- [-653.516] (-654.984) (-653.618) (-654.206) * (-653.290) (-658.609) (-655.167) [-653.236] -- 0:00:48
Average standard deviation of split frequencies: 0.017090
260500 -- (-654.216) [-653.720] (-658.341) (-653.890) * (-654.324) (-655.973) [-658.173] (-656.453) -- 0:00:48
261000 -- (-656.132) (-657.476) (-656.406) [-659.077] * (-653.982) [-656.246] (-655.929) (-654.670) -- 0:00:48
261500 -- [-657.686] (-655.214) (-653.287) (-655.866) * (-655.258) (-657.324) (-657.128) [-656.311] -- 0:00:48
262000 -- (-660.055) [-653.730] (-655.264) (-656.088) * [-652.863] (-653.140) (-657.957) (-653.915) -- 0:00:47
262500 -- (-655.811) [-655.552] (-653.774) (-656.235) * (-655.732) [-654.044] (-657.733) (-655.989) -- 0:00:47
263000 -- [-654.308] (-656.478) (-654.667) (-653.688) * (-653.812) [-655.745] (-653.761) (-657.440) -- 0:00:47
263500 -- (-654.383) (-654.965) [-653.465] (-654.981) * [-655.908] (-655.666) (-658.896) (-654.947) -- 0:00:47
264000 -- (-656.966) (-653.065) (-653.717) [-654.105] * (-654.097) (-655.413) [-652.689] (-653.611) -- 0:00:47
264500 -- (-654.590) [-652.844] (-653.096) (-654.415) * (-654.001) (-654.090) (-654.589) [-653.422] -- 0:00:47
265000 -- (-653.525) (-658.404) (-655.161) [-653.168] * (-657.613) (-653.397) (-655.024) [-653.143] -- 0:00:47
Average standard deviation of split frequencies: 0.016924
265500 -- (-656.024) (-653.821) [-656.651] (-655.073) * [-656.871] (-655.239) (-656.392) (-657.487) -- 0:00:47
266000 -- (-654.981) [-655.446] (-658.692) (-656.401) * [-656.248] (-657.718) (-655.701) (-658.402) -- 0:00:46
266500 -- (-660.126) [-655.507] (-655.035) (-655.200) * (-655.659) (-657.066) (-653.440) [-653.331] -- 0:00:46
267000 -- (-660.680) (-653.436) (-654.554) [-654.862] * (-652.973) (-658.839) [-653.240] (-656.175) -- 0:00:46
267500 -- (-658.418) (-660.286) [-655.240] (-653.589) * (-655.596) (-654.829) [-654.522] (-654.054) -- 0:00:49
268000 -- [-655.910] (-660.449) (-657.937) (-653.203) * [-655.178] (-656.899) (-655.426) (-654.038) -- 0:00:49
268500 -- (-654.959) [-654.225] (-655.028) (-653.703) * (-654.252) (-656.247) (-654.774) [-654.046] -- 0:00:49
269000 -- (-659.969) [-657.149] (-655.333) (-655.360) * [-655.350] (-656.500) (-657.651) (-654.549) -- 0:00:48
269500 -- (-655.889) (-658.259) (-660.900) [-654.411] * (-653.530) [-660.176] (-660.785) (-656.527) -- 0:00:48
270000 -- (-657.522) [-654.713] (-655.425) (-653.658) * (-657.696) (-654.363) (-655.008) [-654.623] -- 0:00:48
Average standard deviation of split frequencies: 0.015936
270500 -- (-653.382) (-654.212) (-656.179) [-652.953] * (-654.050) [-653.227] (-658.253) (-654.494) -- 0:00:48
271000 -- (-653.275) [-654.259] (-655.381) (-654.754) * (-657.096) (-656.747) [-652.920] (-654.416) -- 0:00:48
271500 -- (-655.053) (-656.862) (-655.559) [-652.831] * (-653.740) (-656.232) [-652.883] (-655.794) -- 0:00:48
272000 -- (-660.836) (-654.178) [-654.914] (-656.522) * (-654.094) (-653.669) [-652.629] (-656.008) -- 0:00:48
272500 -- [-656.558] (-656.091) (-653.388) (-656.446) * (-654.094) [-654.837] (-654.848) (-658.962) -- 0:00:48
273000 -- (-654.818) [-653.767] (-654.491) (-659.760) * (-655.515) (-655.818) [-655.503] (-655.120) -- 0:00:47
273500 -- [-654.026] (-655.280) (-653.559) (-656.493) * (-656.708) (-653.694) (-653.928) [-656.755] -- 0:00:47
274000 -- [-653.105] (-657.501) (-655.972) (-656.716) * [-653.076] (-653.214) (-654.983) (-656.249) -- 0:00:47
274500 -- (-660.276) [-657.970] (-656.863) (-655.775) * (-653.799) (-653.191) [-654.057] (-658.133) -- 0:00:47
275000 -- [-658.099] (-654.101) (-656.222) (-655.785) * (-661.409) [-652.878] (-653.681) (-659.618) -- 0:00:47
Average standard deviation of split frequencies: 0.015970
275500 -- (-653.020) [-655.353] (-659.137) (-658.522) * [-657.300] (-655.674) (-655.837) (-659.019) -- 0:00:47
276000 -- (-653.971) [-657.886] (-657.215) (-654.957) * (-657.996) (-655.492) [-654.954] (-658.960) -- 0:00:47
276500 -- (-657.436) [-655.200] (-653.087) (-653.498) * (-657.694) (-653.654) [-654.601] (-658.913) -- 0:00:47
277000 -- [-654.216] (-654.365) (-655.804) (-657.578) * (-654.946) (-654.313) (-654.073) [-656.212] -- 0:00:46
277500 -- [-654.212] (-656.792) (-655.297) (-654.885) * (-654.744) (-657.600) [-653.087] (-658.789) -- 0:00:46
278000 -- (-654.476) [-655.381] (-655.109) (-654.928) * (-656.529) (-654.060) (-655.278) [-656.391] -- 0:00:46
278500 -- [-654.455] (-654.844) (-656.023) (-654.371) * [-653.984] (-661.423) (-654.318) (-656.796) -- 0:00:46
279000 -- (-656.407) (-654.612) (-656.561) [-655.279] * [-653.836] (-655.092) (-653.525) (-657.232) -- 0:00:46
279500 -- [-654.167] (-653.095) (-654.799) (-654.428) * (-654.205) [-655.163] (-653.720) (-657.159) -- 0:00:46
280000 -- [-654.240] (-657.610) (-654.263) (-659.923) * (-656.704) [-654.598] (-655.298) (-653.993) -- 0:00:46
Average standard deviation of split frequencies: 0.016460
280500 -- (-654.239) (-655.566) [-656.056] (-654.241) * [-653.932] (-655.301) (-654.767) (-654.084) -- 0:00:46
281000 -- [-655.653] (-656.067) (-653.753) (-655.476) * [-655.267] (-656.868) (-654.157) (-654.503) -- 0:00:46
281500 -- (-659.630) (-655.895) (-654.867) [-653.549] * [-655.435] (-655.603) (-654.061) (-654.626) -- 0:00:48
282000 -- [-659.035] (-654.832) (-655.506) (-652.988) * (-653.991) (-656.340) [-657.058] (-653.016) -- 0:00:48
282500 -- (-656.122) [-657.153] (-655.397) (-653.104) * (-656.428) [-655.399] (-655.078) (-659.523) -- 0:00:48
283000 -- (-655.044) (-657.278) [-654.876] (-657.002) * (-655.412) (-654.336) [-657.553] (-655.122) -- 0:00:48
283500 -- (-654.071) (-659.211) (-654.092) [-655.720] * (-661.274) (-658.044) (-659.892) [-656.150] -- 0:00:48
284000 -- [-655.815] (-658.108) (-655.037) (-656.416) * (-653.682) (-658.124) [-656.340] (-655.966) -- 0:00:47
284500 -- (-655.301) (-660.259) [-654.826] (-656.309) * [-654.923] (-657.773) (-655.480) (-653.722) -- 0:00:47
285000 -- [-653.614] (-656.435) (-654.180) (-656.810) * (-652.907) [-656.452] (-665.085) (-663.410) -- 0:00:47
Average standard deviation of split frequencies: 0.016875
285500 -- (-653.899) (-654.282) [-655.217] (-654.283) * [-654.889] (-655.288) (-658.530) (-656.762) -- 0:00:47
286000 -- (-654.903) [-653.421] (-657.452) (-654.837) * (-656.039) (-656.609) (-654.372) [-654.008] -- 0:00:47
286500 -- (-656.980) [-655.830] (-655.321) (-653.689) * [-656.005] (-655.586) (-657.376) (-652.921) -- 0:00:47
287000 -- (-653.682) (-657.806) (-653.372) [-656.245] * (-655.744) [-653.928] (-654.403) (-654.234) -- 0:00:47
287500 -- [-656.178] (-655.310) (-656.027) (-653.752) * [-656.651] (-656.854) (-657.817) (-655.570) -- 0:00:47
288000 -- (-654.710) [-655.300] (-655.251) (-653.707) * (-654.029) (-653.283) (-655.867) [-655.126] -- 0:00:46
288500 -- (-654.322) (-653.752) (-653.743) [-653.503] * (-654.449) (-653.447) (-658.982) [-653.777] -- 0:00:46
289000 -- (-654.580) (-653.600) [-654.748] (-654.454) * [-652.932] (-654.576) (-656.637) (-654.088) -- 0:00:46
289500 -- (-654.181) [-654.564] (-659.810) (-653.884) * (-656.225) (-655.572) [-655.603] (-653.433) -- 0:00:46
290000 -- (-659.647) [-654.494] (-654.111) (-654.992) * (-656.422) (-655.489) (-658.854) [-654.101] -- 0:00:46
Average standard deviation of split frequencies: 0.016527
290500 -- (-653.840) (-653.231) [-654.775] (-653.892) * (-655.884) [-654.352] (-656.989) (-654.005) -- 0:00:46
291000 -- (-654.054) (-654.200) (-654.675) [-654.005] * (-654.399) [-653.256] (-656.464) (-654.126) -- 0:00:46
291500 -- (-654.768) [-654.129] (-655.146) (-653.667) * (-654.984) (-655.913) (-657.551) [-654.136] -- 0:00:46
292000 -- (-654.118) [-657.243] (-653.000) (-654.121) * (-652.955) (-659.038) [-658.408] (-654.730) -- 0:00:46
292500 -- (-654.058) (-653.362) (-654.198) [-653.813] * [-652.954] (-658.416) (-652.718) (-655.470) -- 0:00:45
293000 -- (-653.927) [-655.306] (-655.833) (-655.644) * [-654.121] (-659.204) (-653.722) (-655.608) -- 0:00:45
293500 -- [-652.838] (-656.669) (-655.684) (-654.706) * [-652.991] (-657.411) (-654.083) (-654.749) -- 0:00:45
294000 -- (-655.193) (-656.838) (-655.358) [-657.897] * (-652.838) [-656.291] (-654.595) (-653.553) -- 0:00:45
294500 -- (-654.029) (-653.093) [-653.685] (-655.968) * (-653.849) (-655.709) [-653.923] (-657.137) -- 0:00:45
295000 -- (-654.950) (-654.517) (-653.311) [-654.685] * [-653.929] (-657.359) (-654.506) (-654.929) -- 0:00:45
Average standard deviation of split frequencies: 0.017367
295500 -- (-655.175) (-655.608) [-656.114] (-653.175) * (-653.936) (-660.111) (-654.048) [-654.556] -- 0:00:45
296000 -- (-654.020) [-654.402] (-657.203) (-654.036) * [-655.307] (-654.066) (-653.791) (-653.394) -- 0:00:45
296500 -- (-654.215) (-654.749) [-653.950] (-654.332) * (-655.404) [-656.937] (-652.892) (-657.560) -- 0:00:45
297000 -- (-653.372) (-653.714) (-661.258) [-655.809] * (-654.239) (-654.399) [-653.528] (-657.549) -- 0:00:44
297500 -- (-653.540) (-656.175) (-653.571) [-657.335] * (-653.531) (-653.479) (-655.909) [-658.393] -- 0:00:44
298000 -- (-655.022) (-653.767) [-655.837] (-656.359) * [-654.474] (-656.217) (-656.257) (-654.416) -- 0:00:44
298500 -- (-654.734) [-653.697] (-656.367) (-654.654) * (-654.643) [-654.007] (-655.219) (-655.367) -- 0:00:47
299000 -- (-653.730) (-660.604) (-656.017) [-654.158] * (-657.829) (-655.191) (-655.895) [-653.566] -- 0:00:46
299500 -- (-654.164) (-655.708) (-658.723) [-653.650] * (-653.079) (-657.733) [-659.786] (-659.411) -- 0:00:46
300000 -- [-653.196] (-655.739) (-659.169) (-652.781) * (-654.230) [-654.437] (-654.097) (-654.439) -- 0:00:46
Average standard deviation of split frequencies: 0.017694
300500 -- (-654.379) [-653.649] (-654.347) (-652.778) * [-654.688] (-654.726) (-653.283) (-659.304) -- 0:00:46
301000 -- (-653.212) [-659.169] (-656.971) (-654.953) * [-653.901] (-655.264) (-654.301) (-655.772) -- 0:00:46
301500 -- (-653.748) (-658.069) [-657.288] (-654.541) * (-660.353) (-655.772) [-654.783] (-659.095) -- 0:00:46
302000 -- [-653.164] (-654.987) (-654.274) (-655.176) * [-653.782] (-655.532) (-657.056) (-653.771) -- 0:00:46
302500 -- (-653.562) [-653.418] (-664.169) (-657.387) * (-654.003) [-653.877] (-659.556) (-653.527) -- 0:00:46
303000 -- (-653.799) (-653.341) [-653.569] (-657.039) * (-657.458) [-654.466] (-654.620) (-654.321) -- 0:00:46
303500 -- [-653.309] (-654.931) (-653.464) (-655.801) * (-659.031) (-655.028) [-655.381] (-655.458) -- 0:00:45
304000 -- [-653.383] (-655.715) (-654.932) (-653.713) * [-653.283] (-658.349) (-653.929) (-659.202) -- 0:00:45
304500 -- [-653.472] (-654.456) (-653.873) (-654.619) * (-655.435) (-659.556) [-654.777] (-653.978) -- 0:00:45
305000 -- (-654.136) [-653.969] (-653.713) (-655.366) * (-654.425) (-655.486) (-656.107) [-656.397] -- 0:00:45
Average standard deviation of split frequencies: 0.017386
305500 -- [-653.464] (-655.067) (-656.770) (-655.857) * (-655.251) (-655.490) [-653.250] (-654.608) -- 0:00:45
306000 -- (-652.936) (-658.021) [-655.518] (-656.497) * (-658.616) (-653.972) [-655.160] (-653.720) -- 0:00:45
306500 -- (-655.084) [-655.288] (-654.430) (-655.606) * (-654.831) (-654.924) (-655.431) [-652.697] -- 0:00:45
307000 -- [-655.233] (-654.981) (-654.812) (-655.997) * (-656.739) [-654.887] (-653.122) (-656.502) -- 0:00:45
307500 -- (-655.659) (-656.688) [-653.410] (-660.465) * (-657.615) [-653.468] (-653.415) (-656.795) -- 0:00:45
308000 -- [-657.919] (-655.004) (-653.376) (-653.012) * (-657.096) (-652.936) [-653.305] (-655.372) -- 0:00:44
308500 -- (-655.355) [-652.914] (-653.448) (-653.337) * (-655.805) (-655.521) [-655.393] (-657.039) -- 0:00:44
309000 -- (-654.184) (-653.010) [-653.170] (-654.303) * (-657.594) [-653.887] (-655.442) (-656.862) -- 0:00:44
309500 -- (-654.137) [-654.370] (-655.151) (-654.444) * (-654.718) (-658.118) (-655.429) [-654.246] -- 0:00:44
310000 -- (-654.105) (-658.381) (-656.497) [-652.700] * [-653.362] (-657.227) (-656.988) (-659.656) -- 0:00:44
Average standard deviation of split frequencies: 0.017981
310500 -- (-653.551) (-655.098) [-654.590] (-657.450) * (-654.309) (-654.134) (-654.857) [-653.578] -- 0:00:44
311000 -- (-657.422) [-654.339] (-657.462) (-654.695) * (-652.803) (-653.920) [-659.771] (-653.510) -- 0:00:44
311500 -- (-654.783) [-654.525] (-655.608) (-656.473) * [-654.075] (-653.863) (-668.545) (-654.387) -- 0:00:44
312000 -- [-656.849] (-653.284) (-654.311) (-655.933) * [-653.494] (-654.030) (-661.832) (-653.442) -- 0:00:44
312500 -- [-656.237] (-654.285) (-654.594) (-658.201) * (-654.791) (-655.954) [-654.010] (-660.017) -- 0:00:44
313000 -- [-657.614] (-653.426) (-656.991) (-654.399) * (-653.909) (-654.625) (-654.065) [-653.955] -- 0:00:43
313500 -- (-656.356) (-653.988) (-656.143) [-655.809] * [-653.471] (-654.840) (-654.816) (-654.786) -- 0:00:43
314000 -- (-656.800) [-654.224] (-654.242) (-656.645) * (-655.575) (-655.425) [-656.563] (-655.591) -- 0:00:43
314500 -- (-654.156) (-653.587) (-652.629) [-653.409] * [-654.556] (-656.792) (-655.756) (-654.077) -- 0:00:43
315000 -- (-655.743) (-664.046) (-654.192) [-654.015] * (-653.475) [-656.100] (-654.601) (-654.861) -- 0:00:43
Average standard deviation of split frequencies: 0.017305
315500 -- (-656.299) (-655.255) [-653.934] (-653.920) * (-655.061) (-654.802) (-656.163) [-657.566] -- 0:00:45
316000 -- (-655.218) (-656.754) [-660.238] (-655.388) * (-658.351) [-654.816] (-654.204) (-657.727) -- 0:00:45
316500 -- (-655.453) (-656.200) (-654.367) [-654.277] * (-655.654) (-655.841) [-658.165] (-658.164) -- 0:00:45
317000 -- (-657.265) (-654.640) [-657.118] (-653.390) * (-658.866) [-656.769] (-654.972) (-654.974) -- 0:00:45
317500 -- (-656.658) (-653.994) [-653.759] (-652.785) * (-659.278) [-654.377] (-656.211) (-655.924) -- 0:00:45
318000 -- (-661.538) (-655.108) [-655.044] (-654.545) * (-655.533) (-655.503) [-655.829] (-655.757) -- 0:00:45
318500 -- [-658.436] (-656.115) (-655.233) (-655.339) * [-654.013] (-653.267) (-652.948) (-666.869) -- 0:00:44
319000 -- (-655.633) [-655.642] (-654.524) (-655.423) * (-654.052) (-654.168) [-655.910] (-662.957) -- 0:00:44
319500 -- [-654.684] (-657.830) (-654.500) (-654.726) * (-655.334) (-653.836) [-656.393] (-666.036) -- 0:00:44
320000 -- (-654.847) [-653.746] (-653.919) (-654.139) * (-653.904) (-654.070) [-657.319] (-658.520) -- 0:00:44
Average standard deviation of split frequencies: 0.017396
320500 -- (-654.339) (-653.446) (-653.757) [-655.075] * (-655.614) (-656.330) [-655.846] (-656.408) -- 0:00:44
321000 -- (-653.367) (-653.942) (-653.000) [-655.085] * (-657.553) (-655.300) (-655.133) [-654.885] -- 0:00:44
321500 -- [-655.053] (-656.960) (-655.193) (-655.293) * (-654.181) (-655.419) (-655.745) [-655.237] -- 0:00:44
322000 -- [-652.847] (-655.431) (-655.193) (-654.249) * (-655.610) (-653.433) (-655.353) [-653.181] -- 0:00:44
322500 -- (-654.042) (-654.599) [-658.651] (-654.553) * [-654.190] (-655.354) (-655.459) (-654.530) -- 0:00:44
323000 -- (-654.025) (-655.700) [-654.319] (-655.611) * [-657.559] (-654.803) (-654.425) (-656.509) -- 0:00:44
323500 -- (-653.573) (-654.111) (-654.867) [-653.904] * (-655.288) (-657.289) (-654.042) [-653.292] -- 0:00:43
324000 -- (-654.800) (-655.233) [-653.093] (-653.981) * [-654.322] (-653.414) (-656.429) (-656.518) -- 0:00:43
324500 -- [-653.226] (-655.437) (-658.813) (-657.373) * (-653.112) (-655.196) (-654.007) [-654.587] -- 0:00:43
325000 -- (-653.013) (-660.170) [-654.920] (-659.035) * (-656.734) (-655.393) (-654.893) [-655.149] -- 0:00:43
Average standard deviation of split frequencies: 0.016067
325500 -- (-653.461) (-654.389) (-654.724) [-654.349] * (-656.737) (-655.248) [-655.901] (-653.979) -- 0:00:43
326000 -- [-654.718] (-654.342) (-654.061) (-655.890) * (-654.914) (-657.198) [-655.830] (-657.018) -- 0:00:43
326500 -- (-653.634) [-654.298] (-657.458) (-656.195) * [-656.069] (-656.203) (-653.555) (-655.159) -- 0:00:43
327000 -- (-658.227) (-653.297) (-657.714) [-653.828] * (-654.772) [-657.764] (-655.535) (-653.766) -- 0:00:43
327500 -- (-658.215) (-656.896) (-660.285) [-655.075] * (-656.901) [-654.330] (-655.382) (-655.827) -- 0:00:43
328000 -- (-657.431) (-658.652) (-653.739) [-653.085] * [-653.686] (-659.965) (-656.682) (-655.006) -- 0:00:43
328500 -- (-654.504) [-652.858] (-658.081) (-658.454) * [-653.930] (-654.155) (-656.775) (-656.463) -- 0:00:42
329000 -- (-655.793) [-655.982] (-657.818) (-658.996) * (-653.838) (-654.279) (-658.358) [-653.955] -- 0:00:42
329500 -- (-655.436) [-655.703] (-655.726) (-655.488) * (-656.881) [-654.616] (-656.555) (-655.499) -- 0:00:42
330000 -- (-657.516) (-655.288) [-654.705] (-656.232) * (-657.114) [-654.363] (-654.112) (-653.659) -- 0:00:42
Average standard deviation of split frequencies: 0.015907
330500 -- (-654.850) [-655.578] (-657.595) (-654.545) * (-654.215) (-653.418) [-656.465] (-653.725) -- 0:00:42
331000 -- (-654.531) (-655.389) (-653.831) [-654.843] * (-653.297) (-656.847) [-655.925] (-654.671) -- 0:00:42
331500 -- (-653.307) (-653.895) [-655.284] (-655.477) * (-653.136) [-653.231] (-654.881) (-654.681) -- 0:00:42
332000 -- (-654.232) [-655.540] (-655.449) (-653.363) * (-655.114) (-654.799) [-654.135] (-655.809) -- 0:00:44
332500 -- (-655.532) [-656.064] (-653.506) (-654.398) * [-658.923] (-657.235) (-653.676) (-656.757) -- 0:00:44
333000 -- [-654.352] (-655.858) (-662.092) (-653.771) * (-657.322) (-653.387) [-654.251] (-655.003) -- 0:00:44
333500 -- [-655.515] (-659.831) (-654.003) (-653.544) * (-657.107) (-653.368) (-653.713) [-654.179] -- 0:00:43
334000 -- (-655.334) (-654.013) [-654.502] (-654.838) * (-655.499) (-655.140) (-656.525) [-653.317] -- 0:00:43
334500 -- (-659.035) (-654.387) [-656.004] (-654.587) * [-654.104] (-654.088) (-655.631) (-653.447) -- 0:00:43
335000 -- (-654.177) (-653.452) [-653.416] (-656.593) * (-655.316) (-657.538) (-654.252) [-653.381] -- 0:00:43
Average standard deviation of split frequencies: 0.015064
335500 -- (-656.917) (-656.250) (-653.910) [-655.038] * (-654.053) (-654.508) [-653.736] (-653.962) -- 0:00:43
336000 -- [-654.256] (-655.225) (-654.845) (-654.885) * (-654.393) (-655.776) [-656.499] (-653.296) -- 0:00:43
336500 -- (-658.789) (-655.747) (-654.689) [-656.884] * (-655.172) [-655.372] (-659.652) (-654.499) -- 0:00:43
337000 -- (-653.317) [-656.266] (-654.056) (-658.569) * (-655.720) (-653.775) [-656.233] (-655.089) -- 0:00:43
337500 -- (-653.920) (-655.295) [-653.908] (-656.018) * [-656.991] (-653.689) (-656.347) (-656.525) -- 0:00:43
338000 -- (-655.949) (-656.426) [-652.969] (-653.983) * [-654.402] (-652.632) (-654.728) (-655.539) -- 0:00:43
338500 -- (-654.606) (-653.495) [-653.525] (-657.930) * [-652.660] (-654.261) (-653.454) (-653.841) -- 0:00:42
339000 -- [-653.800] (-654.734) (-655.076) (-654.077) * (-654.696) [-656.878] (-656.621) (-653.276) -- 0:00:42
339500 -- [-658.846] (-652.986) (-653.853) (-653.778) * [-656.245] (-655.955) (-654.318) (-654.097) -- 0:00:42
340000 -- (-656.556) (-653.590) [-654.313] (-654.177) * (-652.808) (-658.433) [-655.001] (-656.680) -- 0:00:42
Average standard deviation of split frequencies: 0.014202
340500 -- (-653.820) (-657.307) (-653.941) [-653.751] * [-652.710] (-654.765) (-657.264) (-656.535) -- 0:00:42
341000 -- (-653.176) (-654.471) (-653.640) [-655.334] * [-653.694] (-654.105) (-658.091) (-660.834) -- 0:00:42
341500 -- (-653.580) (-657.416) [-654.929] (-655.964) * (-653.864) (-654.696) [-654.129] (-655.940) -- 0:00:42
342000 -- (-658.088) (-656.007) (-656.785) [-654.950] * [-653.079] (-656.268) (-659.871) (-654.939) -- 0:00:42
342500 -- (-654.663) [-653.663] (-656.450) (-656.813) * [-652.883] (-654.489) (-655.188) (-653.516) -- 0:00:42
343000 -- (-654.651) [-653.663] (-655.183) (-660.854) * (-654.990) (-656.199) [-654.742] (-653.618) -- 0:00:42
343500 -- (-654.536) (-653.986) (-654.924) [-657.905] * (-654.520) (-654.060) [-655.005] (-657.835) -- 0:00:42
344000 -- (-656.966) [-653.887] (-653.752) (-653.649) * (-655.178) (-660.664) [-656.594] (-654.585) -- 0:00:41
344500 -- (-653.544) (-655.397) [-656.744] (-653.355) * [-656.057] (-662.375) (-655.989) (-653.394) -- 0:00:41
345000 -- [-653.508] (-653.480) (-653.764) (-657.457) * (-654.795) (-657.314) [-654.841] (-655.755) -- 0:00:41
Average standard deviation of split frequencies: 0.013553
345500 -- (-654.652) (-654.966) [-658.276] (-656.352) * [-653.393] (-656.966) (-656.617) (-659.882) -- 0:00:41
346000 -- (-653.340) (-654.574) (-659.485) [-653.813] * [-656.802] (-653.508) (-655.672) (-653.923) -- 0:00:41
346500 -- (-653.384) (-655.553) [-656.179] (-654.473) * (-658.577) (-654.086) [-654.774] (-658.219) -- 0:00:41
347000 -- (-653.813) [-657.240] (-653.596) (-654.780) * (-656.272) [-654.033] (-658.263) (-659.377) -- 0:00:41
347500 -- (-653.598) [-654.134] (-657.169) (-652.858) * (-655.117) (-656.342) (-656.976) [-660.040] -- 0:00:41
348000 -- (-653.696) [-652.758] (-654.668) (-653.512) * [-656.523] (-656.393) (-655.701) (-654.857) -- 0:00:41
348500 -- (-657.583) (-654.688) [-655.830] (-656.388) * [-653.737] (-654.393) (-656.288) (-658.974) -- 0:00:41
349000 -- (-656.383) [-658.206] (-653.934) (-655.431) * (-653.582) (-655.050) [-655.830] (-660.424) -- 0:00:42
349500 -- (-655.713) (-652.793) (-654.748) [-655.129] * (-654.089) (-655.903) (-654.737) [-654.519] -- 0:00:42
350000 -- (-655.962) [-654.895] (-654.390) (-653.926) * (-654.149) (-655.377) [-654.930] (-656.373) -- 0:00:42
Average standard deviation of split frequencies: 0.013726
350500 -- (-659.502) (-655.964) (-655.968) [-653.080] * (-654.300) (-654.464) [-654.200] (-655.783) -- 0:00:42
351000 -- (-659.649) [-655.649] (-653.576) (-655.380) * (-655.084) [-654.834] (-654.265) (-657.041) -- 0:00:42
351500 -- (-662.225) (-655.896) (-653.763) [-653.058] * (-661.664) [-659.312] (-654.816) (-659.964) -- 0:00:42
352000 -- (-655.470) (-653.949) [-653.610] (-657.288) * [-656.306] (-660.674) (-655.512) (-661.124) -- 0:00:42
352500 -- (-655.560) (-653.870) (-655.954) [-655.231] * (-654.816) [-654.251] (-655.219) (-656.559) -- 0:00:42
353000 -- (-653.876) [-653.837] (-661.910) (-654.772) * (-656.738) (-653.753) (-654.235) [-654.534] -- 0:00:42
353500 -- (-654.516) (-654.156) (-659.014) [-654.520] * (-654.470) [-653.692] (-659.684) (-660.125) -- 0:00:42
354000 -- [-655.417] (-655.902) (-655.947) (-654.824) * (-656.312) (-654.108) [-661.972] (-653.498) -- 0:00:41
354500 -- [-654.903] (-656.222) (-655.580) (-654.556) * (-656.006) (-654.816) [-658.221] (-657.816) -- 0:00:41
355000 -- (-656.291) [-656.702] (-655.025) (-653.144) * (-655.720) (-654.867) [-654.636] (-656.329) -- 0:00:41
Average standard deviation of split frequencies: 0.012800
355500 -- (-654.546) (-656.580) [-654.479] (-655.041) * (-653.228) (-653.887) (-655.081) [-654.537] -- 0:00:41
356000 -- (-655.993) (-656.209) [-653.881] (-656.250) * (-654.262) [-653.473] (-654.296) (-654.411) -- 0:00:41
356500 -- [-654.337] (-655.220) (-658.408) (-656.323) * [-654.810] (-652.879) (-653.889) (-653.769) -- 0:00:41
357000 -- (-655.438) (-654.950) (-655.547) [-656.819] * (-655.659) (-655.160) [-654.254] (-653.523) -- 0:00:41
357500 -- (-653.063) (-654.120) [-653.559] (-656.664) * (-657.906) (-655.273) [-654.987] (-657.433) -- 0:00:41
358000 -- [-653.530] (-654.333) (-660.869) (-655.727) * (-655.931) (-654.153) (-656.325) [-654.451] -- 0:00:41
358500 -- [-654.870] (-661.910) (-654.323) (-655.812) * (-657.664) (-653.474) (-654.267) [-656.024] -- 0:00:41
359000 -- [-653.557] (-660.544) (-654.659) (-656.414) * [-655.488] (-653.244) (-654.936) (-654.034) -- 0:00:41
359500 -- (-653.656) (-659.876) (-658.935) [-659.125] * [-652.737] (-654.822) (-655.070) (-654.704) -- 0:00:40
360000 -- (-655.485) (-657.906) [-655.022] (-655.875) * (-654.265) (-654.117) (-655.338) [-655.041] -- 0:00:40
Average standard deviation of split frequencies: 0.012302
360500 -- (-655.581) (-655.482) [-654.402] (-655.097) * (-655.763) (-655.024) [-653.886] (-655.153) -- 0:00:40
361000 -- (-657.870) (-654.220) (-654.206) [-654.821] * [-655.811] (-655.020) (-654.293) (-654.683) -- 0:00:40
361500 -- (-652.824) (-654.073) (-653.705) [-653.304] * (-657.350) (-656.607) (-654.992) [-653.585] -- 0:00:40
362000 -- [-655.152] (-654.155) (-654.591) (-656.616) * [-658.455] (-653.769) (-654.300) (-654.269) -- 0:00:40
362500 -- (-654.161) (-654.300) (-654.956) [-653.770] * [-663.951] (-657.972) (-654.207) (-658.970) -- 0:00:40
363000 -- (-655.663) (-654.607) (-656.648) [-653.530] * [-653.872] (-655.487) (-655.639) (-654.773) -- 0:00:40
363500 -- (-658.122) (-654.600) [-654.199] (-655.687) * (-655.616) (-663.259) [-655.075] (-655.289) -- 0:00:40
364000 -- (-660.171) (-655.998) [-655.321] (-653.548) * (-655.074) [-655.489] (-654.390) (-656.844) -- 0:00:40
364500 -- (-655.495) (-653.638) (-656.450) [-654.618] * (-654.549) (-654.181) [-658.322] (-653.199) -- 0:00:40
365000 -- [-659.345] (-653.932) (-657.439) (-654.171) * (-655.085) [-659.126] (-655.124) (-653.293) -- 0:00:40
Average standard deviation of split frequencies: 0.012880
365500 -- (-656.553) [-654.307] (-660.462) (-654.785) * (-657.284) (-656.771) (-654.567) [-660.000] -- 0:00:39
366000 -- (-654.009) (-654.117) (-659.802) [-654.485] * (-653.652) (-654.801) (-656.566) [-659.408] -- 0:00:41
366500 -- (-655.122) [-656.383] (-658.541) (-659.361) * (-653.877) (-654.535) (-655.790) [-654.110] -- 0:00:41
367000 -- (-654.012) (-653.121) (-654.210) [-654.807] * (-656.807) [-654.482] (-655.997) (-654.622) -- 0:00:41
367500 -- (-652.906) (-655.932) (-653.976) [-653.836] * (-660.568) (-655.372) (-654.425) [-653.079] -- 0:00:41
368000 -- (-654.357) (-656.838) [-653.483] (-653.781) * (-658.307) [-657.927] (-655.987) (-653.856) -- 0:00:41
368500 -- [-657.520] (-654.659) (-653.228) (-654.971) * (-654.113) [-654.549] (-653.472) (-653.823) -- 0:00:41
369000 -- (-653.657) [-656.641] (-654.059) (-656.830) * (-654.226) (-654.287) (-652.706) [-655.115] -- 0:00:41
369500 -- (-654.767) [-657.313] (-653.978) (-653.298) * (-663.452) (-653.301) (-652.994) [-657.354] -- 0:00:40
370000 -- [-655.317] (-660.445) (-653.919) (-652.789) * (-658.282) (-653.042) [-653.569] (-657.170) -- 0:00:40
Average standard deviation of split frequencies: 0.012506
370500 -- (-653.118) (-656.319) (-653.295) [-655.314] * (-654.833) (-655.606) [-655.065] (-656.392) -- 0:00:40
371000 -- (-654.159) (-655.609) (-654.519) [-653.554] * [-654.460] (-654.529) (-654.458) (-654.835) -- 0:00:40
371500 -- (-655.202) [-654.577] (-657.098) (-655.019) * (-654.184) (-654.463) [-654.237] (-656.407) -- 0:00:40
372000 -- [-655.795] (-660.304) (-655.257) (-655.488) * (-656.515) (-653.881) [-654.129] (-655.037) -- 0:00:40
372500 -- [-656.975] (-654.359) (-653.518) (-653.960) * (-653.696) (-653.185) [-654.361] (-654.967) -- 0:00:40
373000 -- (-653.675) (-657.583) [-655.290] (-654.886) * (-655.942) (-655.670) (-655.873) [-652.802] -- 0:00:40
373500 -- (-653.277) (-655.105) (-654.877) [-654.907] * (-654.588) (-655.783) (-653.740) [-656.103] -- 0:00:40
374000 -- (-653.890) (-653.525) [-656.044] (-656.089) * (-658.371) [-657.090] (-653.742) (-658.084) -- 0:00:40
374500 -- (-654.265) (-653.933) (-654.728) [-653.477] * (-656.626) (-658.586) (-654.237) [-658.660] -- 0:00:40
375000 -- [-655.741] (-656.265) (-653.170) (-654.510) * (-655.598) (-654.386) [-656.998] (-661.981) -- 0:00:40
Average standard deviation of split frequencies: 0.011874
375500 -- (-655.649) (-654.517) [-654.828] (-655.778) * (-653.842) [-661.654] (-658.952) (-653.511) -- 0:00:39
376000 -- (-654.717) [-653.735] (-655.087) (-653.702) * (-655.812) (-659.236) (-663.584) [-654.024] -- 0:00:39
376500 -- [-654.679] (-654.876) (-654.862) (-653.888) * (-653.043) (-656.756) (-655.963) [-654.207] -- 0:00:39
377000 -- (-654.936) (-653.952) (-654.130) [-655.380] * (-654.908) [-655.069] (-656.025) (-656.130) -- 0:00:39
377500 -- [-654.122] (-656.750) (-655.211) (-655.040) * (-660.740) (-655.648) (-653.572) [-653.569] -- 0:00:39
378000 -- [-653.614] (-656.112) (-655.063) (-652.965) * (-658.641) (-655.701) (-654.477) [-653.418] -- 0:00:39
378500 -- (-655.871) (-655.554) (-655.326) [-654.057] * (-656.007) (-655.745) (-653.438) [-653.465] -- 0:00:39
379000 -- [-653.313] (-654.870) (-656.565) (-653.882) * (-656.092) (-654.872) [-654.018] (-654.148) -- 0:00:39
379500 -- (-654.646) (-656.453) [-653.642] (-655.150) * (-656.237) (-653.631) (-656.516) [-654.823] -- 0:00:39
380000 -- (-656.374) [-655.855] (-654.032) (-653.591) * (-653.497) (-656.431) [-657.058] (-653.226) -- 0:00:39
Average standard deviation of split frequencies: 0.011801
380500 -- (-658.397) [-654.903] (-655.864) (-655.230) * (-654.667) (-655.752) [-655.443] (-653.732) -- 0:00:39
381000 -- [-653.825] (-655.668) (-656.783) (-657.728) * [-655.259] (-658.521) (-657.981) (-654.311) -- 0:00:38
381500 -- (-653.779) (-655.481) [-654.545] (-654.735) * (-656.098) [-657.489] (-657.981) (-654.568) -- 0:00:38
382000 -- (-654.115) (-653.140) (-656.215) [-655.327] * (-654.304) (-654.425) (-657.665) [-656.815] -- 0:00:38
382500 -- [-655.698] (-653.175) (-654.957) (-655.845) * (-653.846) (-655.200) (-659.486) [-653.563] -- 0:00:40
383000 -- (-654.032) (-657.292) [-656.222] (-654.024) * (-653.012) (-654.394) [-654.935] (-654.437) -- 0:00:40
383500 -- (-654.581) [-655.995] (-656.926) (-654.177) * [-653.305] (-658.564) (-652.950) (-655.813) -- 0:00:40
384000 -- (-657.652) (-656.905) [-653.357] (-653.003) * (-654.912) (-653.944) [-654.026] (-655.771) -- 0:00:40
384500 -- (-655.837) [-654.591] (-654.976) (-654.680) * (-653.040) [-654.726] (-653.922) (-655.228) -- 0:00:40
385000 -- (-654.388) (-653.190) (-653.757) [-654.118] * (-658.276) (-654.759) (-653.954) [-654.328] -- 0:00:39
Average standard deviation of split frequencies: 0.010991
385500 -- (-658.136) (-653.981) [-656.835] (-657.775) * (-653.773) (-654.182) (-654.117) [-654.615] -- 0:00:39
386000 -- (-655.590) [-654.178] (-656.436) (-652.789) * (-654.678) (-655.021) (-655.604) [-653.971] -- 0:00:39
386500 -- (-657.392) (-653.799) (-655.633) [-657.955] * (-656.648) (-653.433) (-657.596) [-657.000] -- 0:00:39
387000 -- (-656.941) [-654.694] (-653.616) (-656.208) * [-655.886] (-655.211) (-655.513) (-653.217) -- 0:00:39
387500 -- (-659.170) [-654.840] (-658.683) (-656.670) * (-654.323) [-657.582] (-653.962) (-653.415) -- 0:00:39
388000 -- (-655.652) [-655.523] (-653.224) (-658.454) * (-654.012) [-657.739] (-652.632) (-654.628) -- 0:00:39
388500 -- [-654.686] (-654.435) (-658.212) (-661.637) * [-656.863] (-654.587) (-654.234) (-656.321) -- 0:00:39
389000 -- (-655.777) [-655.065] (-655.334) (-659.583) * [-656.114] (-652.757) (-655.031) (-653.852) -- 0:00:39
389500 -- (-656.107) (-656.098) [-655.330] (-653.478) * (-657.547) (-654.031) (-657.971) [-653.862] -- 0:00:39
390000 -- (-654.034) (-655.595) [-653.861] (-654.754) * (-655.102) (-657.842) [-653.783] (-656.206) -- 0:00:39
Average standard deviation of split frequencies: 0.011530
390500 -- (-657.184) [-653.610] (-654.876) (-660.639) * (-655.117) (-654.172) (-653.817) [-655.066] -- 0:00:39
391000 -- (-653.207) [-654.855] (-655.417) (-660.738) * (-653.980) [-656.391] (-652.646) (-654.193) -- 0:00:38
391500 -- (-656.320) (-653.819) [-654.186] (-657.183) * (-654.466) (-656.689) (-654.282) [-656.309] -- 0:00:38
392000 -- (-654.339) (-657.554) (-657.548) [-653.032] * (-654.697) (-655.660) (-657.092) [-654.193] -- 0:00:38
392500 -- (-656.298) [-655.208] (-658.694) (-653.256) * (-655.481) [-654.807] (-653.820) (-653.209) -- 0:00:38
393000 -- (-655.777) (-658.659) (-652.936) [-653.954] * (-662.214) (-657.104) [-654.307] (-654.038) -- 0:00:38
393500 -- (-654.669) (-655.306) (-653.303) [-653.233] * (-652.988) (-658.449) (-658.862) [-656.010] -- 0:00:38
394000 -- [-653.798] (-655.231) (-653.291) (-653.406) * (-656.496) (-656.328) [-657.452] (-654.928) -- 0:00:38
394500 -- (-653.567) (-653.165) [-657.142] (-654.915) * [-660.557] (-657.429) (-656.091) (-662.363) -- 0:00:38
395000 -- (-655.503) [-655.252] (-657.936) (-655.187) * (-657.830) (-657.091) (-652.689) [-653.645] -- 0:00:38
Average standard deviation of split frequencies: 0.010978
395500 -- [-654.024] (-652.669) (-656.324) (-653.900) * [-656.041] (-656.651) (-653.530) (-658.549) -- 0:00:38
396000 -- (-655.443) (-654.707) (-653.569) [-659.354] * (-658.086) [-656.034] (-654.813) (-654.492) -- 0:00:38
396500 -- (-652.980) (-656.459) [-656.594] (-654.149) * [-655.263] (-657.538) (-656.431) (-653.738) -- 0:00:38
397000 -- (-658.100) (-658.554) (-655.723) [-655.845] * (-654.023) (-655.904) (-654.989) [-653.571] -- 0:00:37
397500 -- (-653.571) [-656.588] (-653.508) (-652.927) * (-654.540) [-655.528] (-656.797) (-653.743) -- 0:00:37
398000 -- (-654.844) (-654.490) [-653.558] (-657.021) * (-656.961) [-654.074] (-658.695) (-654.316) -- 0:00:37
398500 -- [-656.037] (-656.632) (-653.627) (-654.249) * (-653.436) (-654.537) [-653.016] (-659.559) -- 0:00:37
399000 -- [-654.775] (-655.989) (-654.567) (-655.421) * (-653.886) (-657.818) (-652.983) [-653.387] -- 0:00:37
399500 -- (-653.926) (-652.676) (-653.671) [-655.178] * (-653.112) (-655.370) (-653.621) [-654.602] -- 0:00:39
400000 -- (-654.580) (-654.317) [-653.646] (-656.861) * (-653.627) (-653.437) [-653.854] (-653.706) -- 0:00:39
Average standard deviation of split frequencies: 0.010458
400500 -- (-656.839) [-656.370] (-653.546) (-654.191) * (-662.520) [-653.715] (-654.447) (-653.174) -- 0:00:38
401000 -- (-661.117) (-655.926) [-654.392] (-654.055) * (-653.943) (-653.893) [-654.881] (-655.146) -- 0:00:38
401500 -- (-660.059) [-655.786] (-654.992) (-654.055) * (-656.733) [-655.413] (-658.032) (-656.259) -- 0:00:38
402000 -- [-655.870] (-654.884) (-655.390) (-653.999) * [-655.372] (-654.816) (-659.752) (-655.976) -- 0:00:38
402500 -- (-656.043) (-653.290) (-656.555) [-653.394] * (-655.595) (-655.859) [-658.615] (-656.494) -- 0:00:38
403000 -- (-655.823) (-653.552) [-654.761] (-653.293) * (-655.329) (-656.889) [-656.292] (-655.822) -- 0:00:38
403500 -- (-652.816) [-657.109] (-653.740) (-652.622) * [-656.188] (-654.835) (-656.172) (-658.002) -- 0:00:38
404000 -- (-655.509) [-655.041] (-655.585) (-653.950) * (-657.032) (-653.632) (-654.798) [-656.369] -- 0:00:38
404500 -- [-657.200] (-653.831) (-655.718) (-655.386) * [-653.263] (-653.171) (-653.816) (-652.627) -- 0:00:38
405000 -- (-653.816) (-656.001) [-655.067] (-656.757) * (-653.290) [-654.557] (-654.367) (-655.156) -- 0:00:38
Average standard deviation of split frequencies: 0.011147
405500 -- (-653.715) (-654.301) [-654.947] (-654.346) * (-656.716) (-660.909) (-657.543) [-653.263] -- 0:00:38
406000 -- (-655.039) [-654.125] (-654.543) (-656.092) * (-653.720) (-653.422) (-658.651) [-655.525] -- 0:00:38
406500 -- [-657.207] (-658.541) (-655.913) (-654.211) * (-654.927) [-653.405] (-658.759) (-657.778) -- 0:00:37
407000 -- [-654.525] (-655.024) (-659.284) (-654.286) * [-653.457] (-655.189) (-653.961) (-655.086) -- 0:00:37
407500 -- [-654.913] (-657.007) (-654.224) (-653.721) * (-654.010) (-653.680) [-653.022] (-655.485) -- 0:00:37
408000 -- [-655.931] (-658.193) (-653.812) (-654.393) * (-654.988) (-657.941) [-654.348] (-654.789) -- 0:00:37
408500 -- [-653.377] (-655.396) (-653.511) (-660.763) * [-653.861] (-655.008) (-655.847) (-653.796) -- 0:00:37
409000 -- (-653.377) [-653.676] (-653.963) (-654.120) * [-653.587] (-654.834) (-654.270) (-653.923) -- 0:00:37
409500 -- (-653.365) [-655.882] (-653.294) (-655.985) * (-654.161) [-652.792] (-657.554) (-655.263) -- 0:00:37
410000 -- (-654.031) (-654.659) (-653.089) [-655.671] * (-654.593) [-652.636] (-653.051) (-657.124) -- 0:00:37
Average standard deviation of split frequencies: 0.011177
410500 -- (-660.843) [-656.414] (-653.664) (-656.406) * (-655.223) (-655.510) (-659.269) [-656.104] -- 0:00:37
411000 -- (-658.800) (-654.602) (-655.391) [-654.836] * (-654.697) (-656.755) (-657.521) [-653.341] -- 0:00:37
411500 -- (-655.136) [-654.835] (-654.875) (-656.114) * (-655.228) (-655.659) [-656.236] (-655.686) -- 0:00:37
412000 -- (-653.464) [-653.267] (-657.849) (-655.194) * (-654.825) [-655.028] (-653.289) (-655.030) -- 0:00:37
412500 -- [-654.419] (-652.962) (-653.902) (-653.305) * (-653.521) [-655.123] (-653.161) (-656.616) -- 0:00:37
413000 -- [-654.934] (-655.338) (-656.073) (-656.386) * [-654.577] (-654.163) (-655.253) (-656.688) -- 0:00:36
413500 -- (-656.165) [-654.349] (-653.804) (-656.911) * (-654.551) [-655.467] (-656.989) (-655.661) -- 0:00:36
414000 -- (-657.911) (-654.410) [-653.150] (-655.510) * (-656.178) (-655.033) (-658.045) [-654.769] -- 0:00:36
414500 -- (-654.025) [-654.129] (-655.714) (-654.632) * [-656.418] (-653.283) (-656.360) (-657.964) -- 0:00:36
415000 -- (-654.350) (-655.455) (-660.020) [-654.279] * (-656.991) [-654.800] (-655.362) (-655.450) -- 0:00:36
Average standard deviation of split frequencies: 0.011898
415500 -- (-656.818) (-657.252) [-657.568] (-653.506) * (-656.933) [-654.397] (-658.169) (-654.384) -- 0:00:36
416000 -- (-653.094) (-655.800) [-654.141] (-652.823) * (-654.677) (-653.906) (-655.885) [-653.705] -- 0:00:37
416500 -- (-653.872) (-654.262) [-657.326] (-653.832) * (-657.346) [-654.999] (-654.711) (-654.547) -- 0:00:37
417000 -- (-660.056) (-656.175) (-653.022) [-655.061] * (-658.385) [-653.830] (-658.339) (-655.773) -- 0:00:37
417500 -- [-655.435] (-655.921) (-655.258) (-655.372) * (-656.912) (-655.324) (-654.880) [-655.212] -- 0:00:37
418000 -- (-658.900) (-654.747) (-653.890) [-653.955] * (-654.894) (-656.114) [-653.338] (-657.964) -- 0:00:37
418500 -- (-658.308) (-653.929) [-654.814] (-654.560) * (-656.224) [-658.673] (-653.919) (-652.944) -- 0:00:37
419000 -- (-655.479) (-655.082) (-654.523) [-657.065] * (-654.187) (-656.985) (-655.399) [-652.962] -- 0:00:37
419500 -- [-655.584] (-660.000) (-656.917) (-655.362) * (-654.242) (-656.555) (-655.360) [-657.538] -- 0:00:37
420000 -- (-655.456) [-653.128] (-653.935) (-657.671) * (-654.693) (-655.721) [-654.114] (-658.210) -- 0:00:37
Average standard deviation of split frequencies: 0.011147
420500 -- [-656.767] (-657.215) (-656.230) (-654.952) * (-654.002) [-653.378] (-653.152) (-657.206) -- 0:00:37
421000 -- (-656.143) [-653.444] (-653.590) (-660.934) * (-656.089) (-656.399) [-655.892] (-654.490) -- 0:00:37
421500 -- (-653.318) [-656.924] (-660.619) (-656.132) * [-653.720] (-653.702) (-656.495) (-654.658) -- 0:00:37
422000 -- (-653.883) [-655.110] (-655.929) (-656.477) * (-654.650) [-654.778] (-653.832) (-653.988) -- 0:00:36
422500 -- (-654.983) [-656.712] (-658.832) (-653.302) * [-653.809] (-656.301) (-653.985) (-653.233) -- 0:00:36
423000 -- [-653.662] (-655.387) (-660.923) (-654.208) * (-656.805) (-655.601) (-654.624) [-655.629] -- 0:00:36
423500 -- (-654.255) (-656.638) (-656.965) [-658.180] * (-655.455) (-656.118) (-653.821) [-656.229] -- 0:00:36
424000 -- (-653.418) [-656.351] (-656.012) (-655.308) * [-653.590] (-654.724) (-655.731) (-655.236) -- 0:00:36
424500 -- [-652.844] (-656.551) (-658.367) (-655.395) * (-653.863) (-657.401) [-653.608] (-656.795) -- 0:00:36
425000 -- (-653.953) [-657.428] (-656.685) (-658.832) * (-656.846) (-660.881) [-653.909] (-654.319) -- 0:00:36
Average standard deviation of split frequencies: 0.011066
425500 -- (-656.397) (-653.370) [-655.901] (-652.873) * (-654.884) (-653.321) (-654.461) [-655.102] -- 0:00:36
426000 -- (-655.347) (-652.852) (-654.268) [-652.873] * (-655.735) [-654.344] (-653.596) (-655.948) -- 0:00:36
426500 -- (-655.347) (-653.803) (-655.154) [-653.940] * (-653.039) (-655.062) [-653.184] (-659.894) -- 0:00:36
427000 -- (-656.974) (-655.589) [-653.557] (-655.534) * [-654.381] (-654.585) (-653.344) (-654.661) -- 0:00:36
427500 -- (-657.581) [-655.298] (-654.699) (-653.868) * (-659.685) [-653.874] (-654.002) (-658.128) -- 0:00:36
428000 -- [-653.089] (-653.976) (-654.627) (-654.468) * [-653.413] (-655.681) (-655.221) (-655.248) -- 0:00:36
428500 -- (-654.123) [-654.317] (-654.398) (-654.434) * (-655.284) (-654.154) (-655.739) [-656.142] -- 0:00:36
429000 -- (-655.770) (-655.532) (-655.159) [-655.111] * (-656.678) (-656.585) (-655.025) [-661.990] -- 0:00:35
429500 -- (-654.867) (-655.544) (-656.815) [-654.542] * (-654.472) (-656.223) [-653.738] (-656.508) -- 0:00:35
430000 -- (-654.805) (-656.923) [-655.669] (-658.836) * (-655.947) (-653.601) (-655.039) [-656.567] -- 0:00:35
Average standard deviation of split frequencies: 0.011810
430500 -- (-653.174) (-663.998) (-655.593) [-659.031] * [-654.872] (-655.560) (-655.037) (-655.304) -- 0:00:35
431000 -- (-656.328) [-654.936] (-653.783) (-657.681) * (-655.499) (-655.277) (-655.697) [-656.893] -- 0:00:35
431500 -- (-656.938) (-654.083) [-653.844] (-655.989) * (-654.002) (-656.404) (-656.354) [-657.639] -- 0:00:35
432000 -- (-657.942) (-653.826) [-654.839] (-654.377) * (-655.182) (-655.647) (-654.428) [-654.503] -- 0:00:35
432500 -- (-656.512) (-654.978) (-656.907) [-655.080] * [-652.964] (-657.574) (-653.721) (-653.976) -- 0:00:36
433000 -- [-653.190] (-656.350) (-658.870) (-657.338) * (-654.280) (-654.854) (-656.017) [-654.683] -- 0:00:36
433500 -- (-654.497) (-654.234) (-655.065) [-654.085] * [-656.531] (-655.326) (-653.661) (-657.029) -- 0:00:36
434000 -- (-658.848) (-653.320) (-655.462) [-652.652] * (-653.950) (-657.265) [-654.603] (-655.178) -- 0:00:36
434500 -- (-653.695) [-653.500] (-655.696) (-660.849) * (-653.753) (-654.953) (-655.380) [-653.741] -- 0:00:36
435000 -- (-654.199) (-653.378) (-663.914) [-657.195] * (-660.905) (-655.398) [-655.046] (-655.659) -- 0:00:36
Average standard deviation of split frequencies: 0.011723
435500 -- (-653.494) [-658.840] (-654.247) (-655.321) * (-658.982) (-654.708) (-654.479) [-655.684] -- 0:00:36
436000 -- [-653.700] (-655.044) (-656.709) (-655.071) * (-657.219) (-654.309) [-653.833] (-654.627) -- 0:00:36
436500 -- [-655.199] (-655.697) (-655.598) (-655.916) * [-656.354] (-655.265) (-655.263) (-656.089) -- 0:00:36
437000 -- (-653.603) (-657.005) (-653.681) [-653.293] * (-653.914) (-655.910) (-658.886) [-654.953] -- 0:00:36
437500 -- [-653.579] (-652.754) (-654.646) (-656.115) * (-654.839) (-654.372) (-657.262) [-655.539] -- 0:00:36
438000 -- [-652.881] (-655.120) (-654.446) (-658.559) * (-657.177) [-657.553] (-655.094) (-653.968) -- 0:00:35
438500 -- [-653.003] (-654.107) (-654.601) (-653.995) * (-654.117) [-653.863] (-653.972) (-659.876) -- 0:00:35
439000 -- (-653.853) (-654.771) (-653.644) [-655.487] * (-656.244) (-653.055) [-656.443] (-663.780) -- 0:00:35
439500 -- (-654.207) [-654.118] (-653.610) (-654.288) * (-655.987) (-654.342) (-656.194) [-658.367] -- 0:00:35
440000 -- (-657.430) (-653.706) (-654.439) [-653.436] * (-655.345) [-652.698] (-655.183) (-655.504) -- 0:00:35
Average standard deviation of split frequencies: 0.011148
440500 -- (-658.494) [-653.606] (-656.823) (-653.127) * (-656.181) (-655.886) (-654.933) [-653.712] -- 0:00:35
441000 -- (-653.156) (-653.741) (-654.728) [-655.744] * (-655.483) [-654.437] (-655.182) (-654.116) -- 0:00:35
441500 -- (-655.429) (-657.494) (-652.977) [-655.664] * (-655.135) (-653.228) (-655.643) [-653.687] -- 0:00:35
442000 -- (-653.886) (-656.871) (-655.392) [-654.958] * (-654.308) (-654.609) (-655.191) [-655.171] -- 0:00:35
442500 -- [-653.296] (-659.158) (-657.941) (-652.712) * (-656.904) [-653.887] (-654.998) (-655.577) -- 0:00:35
443000 -- (-654.609) [-654.249] (-656.403) (-655.408) * (-652.934) [-655.106] (-656.694) (-655.420) -- 0:00:35
443500 -- (-654.274) [-654.425] (-653.576) (-655.506) * (-654.326) (-657.193) (-657.753) [-658.255] -- 0:00:35
444000 -- (-660.341) (-652.947) [-654.490] (-654.021) * (-658.105) [-653.547] (-655.641) (-656.804) -- 0:00:35
444500 -- [-656.955] (-656.240) (-654.052) (-653.801) * [-658.869] (-656.013) (-655.603) (-656.590) -- 0:00:34
445000 -- (-657.054) (-656.719) [-657.748] (-658.650) * (-655.879) [-655.038] (-655.393) (-654.460) -- 0:00:34
Average standard deviation of split frequencies: 0.011015
445500 -- (-654.108) (-655.361) [-653.853] (-652.883) * (-653.209) (-654.978) [-654.696] (-657.707) -- 0:00:34
446000 -- (-653.041) [-654.723] (-652.936) (-655.592) * (-652.915) (-655.694) [-653.347] (-656.081) -- 0:00:34
446500 -- [-656.311] (-654.993) (-655.207) (-654.081) * (-655.844) (-653.080) (-658.641) [-653.842] -- 0:00:34
447000 -- [-661.310] (-654.629) (-655.985) (-653.321) * (-654.807) (-654.226) [-659.273] (-655.530) -- 0:00:34
447500 -- (-664.757) (-653.385) [-655.461] (-652.943) * (-654.046) (-653.539) [-657.172] (-655.282) -- 0:00:34
448000 -- (-653.767) [-653.189] (-657.036) (-656.584) * (-653.669) (-654.159) [-655.058] (-655.168) -- 0:00:34
448500 -- (-655.380) (-653.802) [-653.001] (-654.125) * [-654.153] (-653.606) (-653.254) (-654.683) -- 0:00:34
449000 -- (-655.455) [-654.575] (-656.217) (-658.531) * (-653.104) (-653.512) [-655.690] (-654.545) -- 0:00:34
449500 -- (-655.514) (-653.893) (-654.918) [-658.526] * (-654.816) [-653.273] (-655.558) (-657.177) -- 0:00:35
450000 -- (-656.191) (-657.337) (-656.256) [-657.747] * (-656.334) [-654.034] (-656.383) (-656.758) -- 0:00:35
Average standard deviation of split frequencies: 0.010170
450500 -- (-653.497) (-659.424) (-654.051) [-659.884] * (-656.199) (-656.678) (-658.170) [-654.629] -- 0:00:35
451000 -- [-654.158] (-654.068) (-655.446) (-655.543) * (-655.663) [-658.063] (-657.185) (-656.318) -- 0:00:35
451500 -- [-658.715] (-654.514) (-658.680) (-655.352) * [-653.262] (-654.888) (-655.966) (-653.495) -- 0:00:35
452000 -- (-661.851) (-654.606) [-655.596] (-656.369) * (-653.367) (-653.120) [-653.713] (-656.246) -- 0:00:35
452500 -- (-656.900) [-653.460] (-657.481) (-654.284) * (-657.620) [-653.644] (-654.240) (-660.446) -- 0:00:35
453000 -- (-656.136) (-653.370) [-653.432] (-658.611) * (-660.020) (-654.864) [-655.311] (-659.682) -- 0:00:35
453500 -- (-656.874) (-653.516) (-656.169) [-654.549] * (-655.013) (-657.180) [-657.983] (-660.767) -- 0:00:34
454000 -- (-654.238) (-654.133) [-654.092] (-660.763) * (-654.383) (-656.682) [-659.423] (-653.655) -- 0:00:34
454500 -- (-655.819) (-655.426) [-657.018] (-660.062) * (-656.585) (-654.283) [-656.022] (-653.300) -- 0:00:34
455000 -- (-654.543) [-654.382] (-655.903) (-658.322) * (-654.615) (-655.089) [-656.899] (-655.348) -- 0:00:34
Average standard deviation of split frequencies: 0.010568
455500 -- (-655.895) (-657.082) [-655.102] (-654.201) * (-661.208) (-656.758) (-654.522) [-653.191] -- 0:00:34
456000 -- (-656.301) (-652.756) (-654.299) [-654.153] * (-659.302) (-657.232) (-655.906) [-654.437] -- 0:00:34
456500 -- (-657.061) (-654.323) (-654.634) [-654.418] * (-658.126) (-655.257) [-653.650] (-654.748) -- 0:00:34
457000 -- (-655.404) (-656.153) [-656.869] (-655.611) * (-654.458) (-658.150) (-655.504) [-656.229] -- 0:00:34
457500 -- (-658.469) (-654.945) [-656.620] (-655.524) * (-655.847) (-657.196) [-656.863] (-652.894) -- 0:00:34
458000 -- (-653.246) (-656.740) (-656.278) [-655.829] * (-654.266) (-654.800) [-653.940] (-656.061) -- 0:00:34
458500 -- (-653.844) [-653.930] (-656.357) (-655.164) * (-655.270) (-654.339) (-655.808) [-656.887] -- 0:00:34
459000 -- (-655.103) (-655.915) (-658.580) [-653.861] * (-655.331) (-656.575) (-654.678) [-654.358] -- 0:00:34
459500 -- (-655.483) (-654.739) [-655.835] (-655.761) * (-658.213) [-655.401] (-654.838) (-654.310) -- 0:00:34
460000 -- (-653.715) [-654.760] (-654.312) (-656.579) * (-661.782) [-658.954] (-653.196) (-653.747) -- 0:00:34
Average standard deviation of split frequencies: 0.011370
460500 -- [-653.212] (-655.429) (-656.247) (-657.971) * (-654.953) (-655.601) [-654.917] (-654.295) -- 0:00:33
461000 -- (-653.932) (-660.504) [-656.745] (-657.720) * (-653.833) (-654.720) [-653.084] (-655.042) -- 0:00:33
461500 -- (-655.447) [-656.675] (-659.087) (-655.388) * (-656.341) (-655.693) (-653.718) [-656.119] -- 0:00:33
462000 -- (-659.211) (-653.668) (-655.917) [-658.404] * [-656.826] (-654.442) (-654.395) (-653.605) -- 0:00:33
462500 -- [-654.939] (-657.033) (-653.563) (-659.684) * [-653.051] (-656.511) (-655.097) (-658.515) -- 0:00:33
463000 -- (-659.621) (-656.336) [-653.651] (-654.001) * (-659.006) (-658.312) [-654.546] (-655.816) -- 0:00:33
463500 -- (-655.348) [-654.276] (-654.333) (-654.076) * (-655.275) (-656.272) [-654.212] (-653.901) -- 0:00:33
464000 -- (-654.596) (-655.664) [-656.444] (-654.562) * (-653.322) (-655.868) (-655.753) [-655.942] -- 0:00:34
464500 -- [-657.393] (-655.802) (-654.568) (-654.159) * (-653.300) (-655.961) [-661.158] (-655.159) -- 0:00:34
465000 -- (-652.884) (-656.061) (-658.086) [-653.194] * (-653.254) (-654.531) [-655.164] (-653.659) -- 0:00:34
Average standard deviation of split frequencies: 0.011015
465500 -- (-656.063) (-655.324) [-655.513] (-656.014) * (-653.823) (-654.502) [-655.082] (-655.764) -- 0:00:34
466000 -- (-655.853) (-656.276) [-652.599] (-657.313) * [-653.376] (-654.843) (-656.334) (-655.008) -- 0:00:34
466500 -- (-654.176) [-655.088] (-654.018) (-655.708) * (-653.038) (-656.418) (-658.501) [-654.742] -- 0:00:34
467000 -- (-655.034) (-656.023) (-654.899) [-653.882] * (-653.814) (-655.234) (-656.178) [-653.617] -- 0:00:34
467500 -- [-655.631] (-656.944) (-656.142) (-654.423) * (-656.435) (-655.005) [-654.500] (-655.972) -- 0:00:34
468000 -- [-655.618] (-656.814) (-654.528) (-655.049) * (-656.640) [-655.386] (-655.555) (-653.524) -- 0:00:34
468500 -- [-653.700] (-655.599) (-655.529) (-655.295) * (-654.728) (-659.129) [-653.183] (-654.584) -- 0:00:34
469000 -- [-654.876] (-658.193) (-656.025) (-653.460) * (-656.175) (-656.051) (-653.750) [-654.531] -- 0:00:33
469500 -- (-655.614) [-657.518] (-655.404) (-652.655) * (-657.134) [-653.301] (-654.259) (-654.944) -- 0:00:33
470000 -- (-658.284) (-655.487) (-652.774) [-653.156] * (-653.767) (-654.093) (-653.982) [-653.694] -- 0:00:33
Average standard deviation of split frequencies: 0.011295
470500 -- (-657.486) (-655.068) [-654.269] (-653.065) * (-653.089) (-657.157) (-653.294) [-655.233] -- 0:00:33
471000 -- (-659.310) (-655.781) (-654.529) [-653.155] * (-655.622) (-655.747) [-654.261] (-657.422) -- 0:00:33
471500 -- [-655.210] (-662.321) (-654.134) (-653.832) * (-654.524) (-653.652) [-654.298] (-658.426) -- 0:00:33
472000 -- [-658.404] (-658.279) (-653.391) (-654.018) * [-655.092] (-654.319) (-654.396) (-655.938) -- 0:00:33
472500 -- (-655.830) (-656.308) (-655.004) [-653.345] * [-653.626] (-655.503) (-654.728) (-654.056) -- 0:00:33
473000 -- (-655.969) (-659.585) [-653.318] (-656.734) * (-658.365) [-654.258] (-654.870) (-653.748) -- 0:00:33
473500 -- (-654.752) (-655.948) [-658.017] (-653.379) * (-654.470) [-652.987] (-654.659) (-653.294) -- 0:00:33
474000 -- [-654.632] (-655.327) (-654.548) (-654.459) * (-653.819) [-655.638] (-654.843) (-656.684) -- 0:00:33
474500 -- (-653.370) (-653.446) (-653.254) [-655.558] * (-656.088) (-655.240) (-654.106) [-653.611] -- 0:00:33
475000 -- (-653.395) (-656.054) [-653.320] (-655.206) * [-654.182] (-656.392) (-655.177) (-657.638) -- 0:00:33
Average standard deviation of split frequencies: 0.010839
475500 -- [-655.518] (-657.627) (-654.827) (-655.364) * [-655.482] (-654.882) (-655.903) (-657.786) -- 0:00:33
476000 -- (-655.635) (-654.386) [-657.019] (-653.409) * [-656.590] (-655.257) (-656.651) (-655.070) -- 0:00:33
476500 -- (-656.869) (-653.335) [-656.769] (-656.808) * (-660.269) (-653.567) (-656.638) [-653.197] -- 0:00:32
477000 -- (-659.467) [-652.813] (-658.687) (-655.309) * (-654.250) (-655.453) [-655.526] (-654.212) -- 0:00:32
477500 -- (-653.236) (-657.239) [-654.599] (-657.065) * (-656.875) (-659.144) [-654.266] (-654.125) -- 0:00:32
478000 -- (-654.551) [-654.245] (-657.281) (-653.433) * (-655.418) [-659.170] (-656.318) (-655.606) -- 0:00:32
478500 -- (-655.435) [-654.852] (-656.370) (-655.983) * [-654.049] (-655.578) (-655.020) (-653.646) -- 0:00:32
479000 -- [-656.936] (-655.877) (-656.828) (-655.495) * (-653.190) (-656.218) (-656.575) [-653.147] -- 0:00:33
479500 -- (-655.500) [-655.259] (-653.015) (-654.422) * (-654.482) (-656.806) [-654.056] (-656.002) -- 0:00:33
480000 -- (-656.495) (-659.675) (-653.705) [-653.734] * (-656.787) (-654.122) [-659.644] (-653.948) -- 0:00:33
Average standard deviation of split frequencies: 0.010352
480500 -- (-654.706) (-654.641) (-653.570) [-655.547] * (-655.648) (-655.138) [-656.753] (-661.705) -- 0:00:33
481000 -- (-654.384) [-653.396] (-653.238) (-653.705) * (-654.072) (-653.238) [-655.167] (-655.851) -- 0:00:33
481500 -- (-653.391) [-654.015] (-654.310) (-652.966) * (-654.655) [-653.874] (-654.172) (-654.288) -- 0:00:33
482000 -- (-653.775) [-654.975] (-654.542) (-654.730) * (-655.733) [-653.171] (-653.761) (-653.517) -- 0:00:33
482500 -- (-653.064) [-653.069] (-657.656) (-655.625) * (-655.733) (-655.712) [-653.238] (-656.083) -- 0:00:33
483000 -- (-653.477) [-653.212] (-654.604) (-656.142) * (-653.703) [-655.456] (-654.007) (-653.587) -- 0:00:33
483500 -- (-654.181) (-656.060) [-653.663] (-654.094) * (-653.415) (-655.094) (-653.691) [-655.317] -- 0:00:33
484000 -- (-655.012) (-654.555) (-655.080) [-653.943] * (-654.215) [-652.935] (-653.102) (-655.246) -- 0:00:33
484500 -- (-654.416) (-654.445) (-655.112) [-653.845] * (-655.014) (-652.782) (-655.646) [-657.554] -- 0:00:32
485000 -- [-653.902] (-655.633) (-652.551) (-654.705) * (-656.645) (-654.106) [-655.091] (-658.163) -- 0:00:32
Average standard deviation of split frequencies: 0.010400
485500 -- (-655.064) (-653.812) [-655.175] (-655.426) * (-655.551) (-654.272) [-656.385] (-655.572) -- 0:00:32
486000 -- (-653.720) [-655.457] (-653.999) (-654.236) * (-655.990) (-654.302) (-654.985) [-655.404] -- 0:00:32
486500 -- (-653.500) [-654.710] (-655.201) (-654.483) * (-656.885) (-653.455) [-654.040] (-654.978) -- 0:00:32
487000 -- [-652.799] (-654.754) (-655.956) (-656.238) * (-655.160) (-655.783) [-654.241] (-653.753) -- 0:00:32
487500 -- (-655.782) [-655.207] (-655.476) (-653.612) * (-654.376) (-655.813) (-653.173) [-656.578] -- 0:00:32
488000 -- (-653.681) [-654.922] (-655.675) (-655.014) * (-657.592) (-656.942) [-654.376] (-653.450) -- 0:00:32
488500 -- [-655.583] (-658.153) (-655.794) (-653.715) * (-654.869) [-653.756] (-656.819) (-652.735) -- 0:00:32
489000 -- (-654.546) (-654.201) (-655.545) [-658.065] * (-653.792) [-653.977] (-661.771) (-654.537) -- 0:00:32
489500 -- [-654.316] (-656.384) (-654.420) (-655.169) * (-653.855) (-655.352) [-656.602] (-654.358) -- 0:00:32
490000 -- (-655.561) [-653.819] (-655.867) (-653.159) * (-653.195) [-658.343] (-654.844) (-653.280) -- 0:00:32
Average standard deviation of split frequencies: 0.010301
490500 -- (-655.589) [-655.169] (-657.002) (-654.488) * (-655.023) (-655.141) [-655.049] (-653.423) -- 0:00:32
491000 -- (-653.580) (-657.417) (-653.478) [-653.787] * (-657.505) [-655.590] (-655.772) (-660.514) -- 0:00:32
491500 -- (-653.319) (-653.830) [-656.130] (-655.307) * (-655.936) (-656.417) [-653.881] (-654.532) -- 0:00:32
492000 -- (-653.527) [-653.444] (-657.768) (-653.566) * (-655.570) (-659.783) (-655.819) [-655.035] -- 0:00:32
492500 -- (-653.433) (-656.815) (-654.466) [-654.740] * (-654.440) (-653.872) [-655.619] (-655.884) -- 0:00:31
493000 -- (-655.603) (-656.457) (-653.917) [-659.199] * (-653.670) (-656.449) [-655.747] (-652.730) -- 0:00:31
493500 -- [-658.941] (-654.269) (-653.747) (-657.319) * [-653.927] (-654.462) (-659.271) (-653.657) -- 0:00:31
494000 -- (-657.382) (-656.316) (-657.549) [-654.471] * (-661.732) (-654.529) [-659.485] (-654.916) -- 0:00:31
494500 -- (-656.057) [-656.483] (-656.072) (-654.774) * [-656.281] (-653.224) (-654.193) (-656.632) -- 0:00:32
495000 -- (-655.446) (-654.146) (-662.793) [-654.622] * (-657.576) [-653.609] (-654.289) (-656.104) -- 0:00:32
Average standard deviation of split frequencies: 0.009927
495500 -- (-657.268) (-653.091) (-657.233) [-654.268] * (-655.372) (-653.922) (-659.803) [-654.712] -- 0:00:32
496000 -- (-654.228) (-653.751) (-654.276) [-654.684] * (-654.937) (-653.075) (-656.910) [-654.850] -- 0:00:32
496500 -- (-656.097) [-654.690] (-654.787) (-653.637) * (-656.009) (-655.943) (-653.272) [-654.196] -- 0:00:32
497000 -- (-653.916) (-654.270) [-653.248] (-653.309) * (-653.553) (-655.259) [-653.125] (-654.303) -- 0:00:32
497500 -- [-653.416] (-653.474) (-654.221) (-653.385) * (-660.195) (-656.562) (-654.508) [-653.784] -- 0:00:32
498000 -- (-657.951) (-657.629) (-653.406) [-653.349] * (-655.430) (-653.883) (-653.100) [-654.425] -- 0:00:32
498500 -- [-653.166] (-656.127) (-654.460) (-653.870) * [-654.452] (-656.626) (-657.153) (-655.103) -- 0:00:32
499000 -- (-653.007) [-656.362] (-654.154) (-653.729) * (-656.213) (-658.092) (-654.466) [-653.485] -- 0:00:32
499500 -- (-653.327) [-655.021] (-654.615) (-653.946) * (-659.959) (-657.811) [-657.529] (-654.250) -- 0:00:32
500000 -- [-655.852] (-653.206) (-655.409) (-653.453) * (-654.955) [-655.060] (-655.400) (-656.126) -- 0:00:32
Average standard deviation of split frequencies: 0.010409
500500 -- [-657.451] (-655.998) (-654.027) (-654.895) * (-654.368) [-654.413] (-653.945) (-653.860) -- 0:00:31
501000 -- (-659.387) (-655.523) [-656.394] (-656.989) * (-654.748) (-655.375) [-654.554] (-653.797) -- 0:00:31
501500 -- (-653.671) (-655.406) [-655.817] (-654.994) * [-653.724] (-655.079) (-655.130) (-653.497) -- 0:00:31
502000 -- (-653.285) (-653.148) (-655.259) [-653.447] * [-657.362] (-654.168) (-656.787) (-653.987) -- 0:00:31
502500 -- [-652.916] (-654.639) (-653.543) (-655.227) * (-654.380) [-652.959] (-656.812) (-652.942) -- 0:00:31
503000 -- (-655.508) (-660.218) [-654.878] (-654.249) * (-654.904) (-654.393) [-658.859] (-653.893) -- 0:00:31
503500 -- [-655.537] (-653.676) (-654.056) (-654.263) * [-653.427] (-655.956) (-658.647) (-653.694) -- 0:00:31
504000 -- (-656.791) (-655.745) [-656.070] (-653.159) * [-654.727] (-655.700) (-654.283) (-656.036) -- 0:00:31
504500 -- (-655.530) (-656.037) (-653.918) [-657.253] * (-655.836) (-655.149) [-654.774] (-655.771) -- 0:00:31
505000 -- (-656.623) (-660.441) [-654.886] (-661.466) * (-656.565) (-655.644) [-654.075] (-654.719) -- 0:00:31
Average standard deviation of split frequencies: 0.010144
505500 -- (-654.083) (-655.497) [-655.556] (-657.724) * (-653.889) (-657.246) (-656.720) [-656.706] -- 0:00:31
506000 -- (-654.876) (-664.314) (-656.886) [-655.337] * (-655.167) (-659.859) (-657.458) [-654.092] -- 0:00:31
506500 -- [-655.412] (-655.403) (-656.500) (-654.478) * (-653.284) (-660.164) [-656.039] (-654.371) -- 0:00:31
507000 -- [-657.182] (-655.049) (-659.154) (-653.032) * (-652.750) (-656.898) [-657.266] (-655.832) -- 0:00:31
507500 -- [-654.927] (-653.241) (-654.176) (-652.902) * [-653.262] (-656.131) (-659.992) (-655.987) -- 0:00:31
508000 -- (-652.936) (-658.545) (-658.283) [-654.505] * [-655.289] (-654.127) (-657.202) (-653.985) -- 0:00:30
508500 -- (-652.796) [-654.883] (-653.916) (-663.797) * (-655.007) [-654.208] (-653.318) (-657.997) -- 0:00:30
509000 -- [-656.154] (-655.447) (-655.452) (-654.458) * [-654.060] (-661.542) (-653.550) (-654.459) -- 0:00:30
509500 -- (-655.940) [-655.335] (-655.713) (-654.873) * [-655.276] (-657.593) (-653.971) (-655.011) -- 0:00:31
510000 -- [-653.734] (-655.120) (-656.388) (-653.187) * (-654.779) (-653.403) [-654.135] (-659.315) -- 0:00:31
Average standard deviation of split frequencies: 0.009394
510500 -- [-656.050] (-653.104) (-654.816) (-658.699) * (-653.923) [-654.585] (-655.754) (-655.364) -- 0:00:31
511000 -- (-655.253) [-655.421] (-654.816) (-656.006) * (-655.418) (-656.287) (-658.837) [-655.623] -- 0:00:31
511500 -- (-654.632) (-652.742) (-656.359) [-654.376] * [-656.941] (-656.142) (-653.536) (-655.705) -- 0:00:31
512000 -- (-654.165) (-653.231) [-654.221] (-654.929) * (-655.160) (-655.010) (-656.238) [-654.533] -- 0:00:31
512500 -- [-655.271] (-655.809) (-654.123) (-653.411) * [-654.075] (-654.995) (-652.759) (-653.271) -- 0:00:31
513000 -- [-653.171] (-654.197) (-654.245) (-653.350) * [-654.363] (-653.985) (-653.814) (-654.349) -- 0:00:31
513500 -- (-658.244) [-654.196] (-654.355) (-655.409) * (-653.592) (-654.504) [-654.294] (-654.603) -- 0:00:31
514000 -- (-657.091) [-655.858] (-653.112) (-656.453) * (-655.906) [-657.178] (-656.441) (-657.329) -- 0:00:31
514500 -- [-656.882] (-656.028) (-655.091) (-653.775) * (-656.152) (-658.138) (-653.421) [-656.674] -- 0:00:31
515000 -- (-653.030) (-656.337) (-655.216) [-653.660] * (-653.457) [-653.738] (-653.691) (-658.522) -- 0:00:31
Average standard deviation of split frequencies: 0.009512
515500 -- (-654.726) [-656.433] (-653.796) (-656.183) * (-655.321) [-658.587] (-654.381) (-654.026) -- 0:00:31
516000 -- (-655.364) (-656.275) (-654.693) [-656.767] * (-655.000) (-658.948) [-656.461] (-654.846) -- 0:00:30
516500 -- (-654.029) [-652.838] (-654.807) (-653.761) * [-653.678] (-655.084) (-654.877) (-653.440) -- 0:00:30
517000 -- [-654.916] (-652.837) (-658.185) (-654.136) * (-655.626) [-655.920] (-660.250) (-653.614) -- 0:00:30
517500 -- (-653.351) [-655.451] (-656.095) (-653.658) * (-654.512) (-654.502) [-654.756] (-662.557) -- 0:00:30
518000 -- (-654.322) (-655.005) [-653.570] (-653.094) * (-653.382) [-660.484] (-655.337) (-653.682) -- 0:00:30
518500 -- (-660.918) [-654.097] (-656.272) (-654.940) * (-653.841) (-654.244) (-655.522) [-653.946] -- 0:00:30
519000 -- (-657.402) (-653.487) [-654.017] (-658.615) * (-655.189) (-655.093) [-656.695] (-653.174) -- 0:00:30
519500 -- (-659.061) [-654.817] (-653.062) (-656.527) * [-659.116] (-653.480) (-656.555) (-654.366) -- 0:00:30
520000 -- (-656.854) (-653.781) [-653.449] (-653.938) * (-653.990) (-655.059) [-653.844] (-654.972) -- 0:00:30
Average standard deviation of split frequencies: 0.009903
520500 -- (-656.078) (-658.465) [-653.671] (-652.592) * [-653.463] (-656.515) (-660.322) (-655.616) -- 0:00:30
521000 -- (-656.315) [-654.661] (-653.515) (-656.670) * (-655.960) (-653.191) [-654.705] (-655.609) -- 0:00:30
521500 -- [-655.234] (-654.350) (-653.849) (-655.726) * (-658.620) (-653.047) [-654.507] (-655.073) -- 0:00:30
522000 -- (-654.706) (-655.723) [-655.028] (-654.936) * (-654.365) (-658.694) (-653.621) [-653.386] -- 0:00:30
522500 -- (-653.758) (-655.957) (-653.603) [-654.759] * (-658.428) [-657.395] (-653.994) (-655.425) -- 0:00:30
523000 -- (-654.160) (-657.540) (-654.166) [-660.157] * (-660.798) [-655.747] (-656.054) (-655.242) -- 0:00:30
523500 -- (-657.214) (-654.292) (-656.741) [-659.415] * (-661.626) (-654.865) [-653.727] (-654.317) -- 0:00:30
524000 -- (-653.863) (-655.282) [-653.587] (-655.981) * (-657.598) (-654.009) [-655.430] (-654.389) -- 0:00:30
524500 -- (-653.351) (-654.984) [-654.821] (-654.704) * [-658.171] (-657.364) (-653.719) (-653.571) -- 0:00:30
525000 -- (-653.771) [-654.941] (-659.450) (-653.710) * (-653.714) [-653.838] (-655.964) (-654.842) -- 0:00:30
Average standard deviation of split frequencies: 0.009595
525500 -- (-656.822) (-655.910) [-656.791] (-653.634) * (-655.710) [-653.889] (-655.505) (-656.680) -- 0:00:30
526000 -- [-654.283] (-656.039) (-656.211) (-659.369) * (-653.554) (-658.522) [-652.655] (-658.033) -- 0:00:30
526500 -- (-655.818) [-655.063] (-654.085) (-658.211) * (-656.363) (-654.555) (-657.423) [-654.431] -- 0:00:30
527000 -- (-656.955) (-655.718) [-655.256] (-656.239) * (-662.202) (-656.290) [-653.861] (-653.949) -- 0:00:30
527500 -- (-656.431) [-654.550] (-656.755) (-653.323) * (-654.015) (-655.129) (-655.528) [-652.843] -- 0:00:30
528000 -- (-652.644) (-657.476) [-656.030] (-656.949) * (-656.310) [-655.181] (-654.088) (-655.075) -- 0:00:30
528500 -- (-654.094) [-654.753] (-653.406) (-655.924) * (-658.200) [-655.997] (-654.738) (-653.616) -- 0:00:30
529000 -- (-656.380) (-656.245) (-659.475) [-653.976] * (-656.591) (-657.009) (-657.287) [-653.909] -- 0:00:30
529500 -- [-655.283] (-655.626) (-655.361) (-653.881) * (-657.110) [-657.764] (-657.361) (-660.611) -- 0:00:30
530000 -- [-655.848] (-654.772) (-660.112) (-657.139) * (-655.010) [-656.617] (-653.259) (-656.952) -- 0:00:30
Average standard deviation of split frequencies: 0.009667
530500 -- [-654.771] (-654.478) (-660.342) (-654.556) * (-653.362) (-656.196) [-657.743] (-656.966) -- 0:00:30
531000 -- (-653.209) (-653.556) (-657.778) [-657.214] * (-656.004) [-654.462] (-656.040) (-655.219) -- 0:00:30
531500 -- [-656.578] (-655.816) (-656.349) (-654.897) * (-658.664) (-654.578) [-653.259] (-653.396) -- 0:00:29
532000 -- (-655.458) (-658.858) (-655.458) [-653.873] * (-656.953) (-655.341) [-654.240] (-654.600) -- 0:00:29
532500 -- (-655.924) (-655.859) [-657.175] (-658.369) * [-654.748] (-662.751) (-655.268) (-657.715) -- 0:00:29
533000 -- (-655.112) (-655.854) [-654.670] (-657.056) * [-654.859] (-655.371) (-654.318) (-657.314) -- 0:00:29
533500 -- (-655.611) (-654.052) (-653.559) [-655.137] * (-655.310) (-653.645) (-656.128) [-656.646] -- 0:00:29
534000 -- (-661.760) [-653.599] (-655.803) (-655.303) * [-653.541] (-655.898) (-658.641) (-653.355) -- 0:00:29
534500 -- [-656.912] (-653.175) (-657.294) (-656.465) * (-655.127) [-656.373] (-654.048) (-653.512) -- 0:00:29
535000 -- (-653.869) (-654.069) [-656.022] (-654.995) * (-656.715) (-656.174) (-654.156) [-655.201] -- 0:00:29
Average standard deviation of split frequencies: 0.009881
535500 -- (-654.493) (-658.597) (-654.732) [-659.608] * (-655.491) (-654.959) (-654.202) [-655.048] -- 0:00:29
536000 -- (-655.735) (-656.172) [-654.264] (-656.126) * (-653.108) (-653.795) (-656.063) [-653.715] -- 0:00:29
536500 -- [-654.932] (-656.301) (-653.796) (-654.984) * [-655.404] (-660.340) (-656.463) (-655.196) -- 0:00:29
537000 -- [-653.879] (-653.882) (-655.144) (-655.006) * [-654.438] (-652.932) (-658.270) (-654.555) -- 0:00:29
537500 -- (-661.923) (-659.325) [-653.496] (-653.727) * [-653.935] (-655.655) (-653.554) (-655.424) -- 0:00:29
538000 -- [-657.437] (-657.275) (-655.738) (-654.546) * [-653.660] (-655.193) (-652.976) (-653.887) -- 0:00:29
538500 -- (-656.442) [-657.405] (-654.487) (-655.517) * (-657.100) [-655.167] (-655.908) (-652.964) -- 0:00:29
539000 -- (-658.306) (-654.794) (-653.913) [-655.563] * (-656.011) (-654.167) (-655.405) [-655.156] -- 0:00:29
539500 -- [-655.572] (-654.142) (-656.867) (-654.674) * (-655.466) (-653.873) (-655.480) [-656.331] -- 0:00:29
540000 -- (-655.312) (-653.328) (-657.282) [-654.429] * (-655.789) (-656.882) (-655.008) [-655.569] -- 0:00:29
Average standard deviation of split frequencies: 0.010309
540500 -- (-653.488) (-657.763) [-656.821] (-653.178) * (-653.678) [-655.497] (-654.197) (-657.917) -- 0:00:29
541000 -- (-653.766) (-653.434) (-656.097) [-652.647] * (-653.998) (-655.539) (-654.881) [-655.129] -- 0:00:29
541500 -- (-657.496) (-656.143) (-659.687) [-655.119] * (-655.054) (-655.252) (-654.391) [-653.089] -- 0:00:29
542000 -- (-655.120) [-654.303] (-657.452) (-653.760) * (-659.160) (-655.028) [-656.535] (-653.605) -- 0:00:29
542500 -- (-653.231) (-655.778) (-657.246) [-654.453] * (-656.707) (-654.504) (-653.697) [-656.148] -- 0:00:29
543000 -- (-653.231) (-654.596) (-654.658) [-654.346] * (-655.206) (-654.525) [-654.011] (-656.164) -- 0:00:29
543500 -- [-652.977] (-655.664) (-654.372) (-653.994) * (-654.767) (-655.068) (-654.088) [-654.657] -- 0:00:29
544000 -- (-653.207) (-660.293) [-653.251] (-654.120) * [-658.026] (-656.695) (-653.573) (-655.340) -- 0:00:29
544500 -- (-655.249) [-654.126] (-656.537) (-654.674) * (-655.797) [-654.945] (-655.394) (-654.247) -- 0:00:29
545000 -- (-657.135) (-657.121) [-653.377] (-655.161) * (-656.441) (-656.507) [-655.395] (-653.990) -- 0:00:29
Average standard deviation of split frequencies: 0.010310
545500 -- [-655.923] (-654.628) (-653.946) (-653.948) * [-663.256] (-655.429) (-654.404) (-655.835) -- 0:00:29
546000 -- (-653.646) [-654.041] (-653.596) (-655.616) * (-652.911) (-653.748) (-653.588) [-656.505] -- 0:00:29
546500 -- (-654.573) (-653.797) (-654.512) [-654.041] * (-654.256) (-654.063) [-654.187] (-654.057) -- 0:00:29
547000 -- (-653.720) (-654.678) (-652.804) [-655.353] * (-653.556) (-655.497) [-656.575] (-658.759) -- 0:00:28
547500 -- (-656.602) [-653.868] (-653.024) (-655.800) * (-653.005) (-654.979) [-653.507] (-656.867) -- 0:00:28
548000 -- (-655.129) (-654.446) [-653.618] (-655.024) * (-655.728) (-656.029) [-654.180] (-656.132) -- 0:00:28
548500 -- [-653.642] (-654.866) (-653.379) (-654.723) * (-655.742) (-655.138) (-658.194) [-656.107] -- 0:00:28
549000 -- (-653.337) (-655.269) [-654.226] (-654.540) * (-655.895) (-654.344) (-656.058) [-654.332] -- 0:00:28
549500 -- (-653.400) [-653.571] (-656.759) (-657.522) * (-656.127) (-660.470) [-657.791] (-653.914) -- 0:00:28
550000 -- [-654.535] (-655.296) (-653.185) (-654.790) * (-655.782) [-658.404] (-654.954) (-657.064) -- 0:00:28
Average standard deviation of split frequencies: 0.010525
550500 -- [-652.690] (-653.979) (-661.418) (-653.842) * (-654.284) (-654.175) (-656.026) [-656.322] -- 0:00:28
551000 -- (-654.094) [-653.577] (-654.432) (-654.925) * (-656.075) [-653.820] (-654.773) (-657.089) -- 0:00:28
551500 -- (-652.792) [-656.600] (-654.980) (-656.375) * (-655.336) (-653.032) (-656.830) [-652.976] -- 0:00:28
552000 -- (-656.773) (-654.446) [-653.572] (-653.382) * [-654.268] (-653.578) (-655.805) (-653.121) -- 0:00:28
552500 -- (-656.395) [-654.189] (-654.033) (-659.749) * (-653.316) (-656.083) [-655.461] (-655.270) -- 0:00:28
553000 -- (-656.810) (-655.081) [-654.592] (-654.654) * (-653.909) (-655.558) (-654.137) [-654.109] -- 0:00:28
553500 -- (-655.913) (-655.779) (-656.284) [-653.245] * (-656.081) (-654.831) [-653.917] (-655.100) -- 0:00:28
554000 -- [-655.524] (-652.598) (-657.873) (-654.419) * [-654.343] (-654.914) (-653.326) (-653.768) -- 0:00:28
554500 -- (-656.332) (-654.277) [-653.179] (-653.701) * (-656.935) [-659.527] (-654.809) (-654.442) -- 0:00:28
555000 -- (-655.969) (-654.711) (-655.853) [-653.212] * (-653.972) (-654.430) (-654.830) [-655.659] -- 0:00:28
Average standard deviation of split frequencies: 0.010374
555500 -- (-656.917) [-653.264] (-653.210) (-655.679) * (-658.551) [-658.388] (-657.060) (-658.993) -- 0:00:28
556000 -- (-654.363) (-654.974) [-656.727] (-658.296) * (-658.461) (-654.408) [-654.503] (-654.486) -- 0:00:28
556500 -- (-657.551) [-653.018] (-653.943) (-653.689) * [-655.059] (-659.003) (-655.222) (-657.526) -- 0:00:28
557000 -- (-654.246) (-654.432) [-657.030] (-654.871) * (-655.244) [-653.602] (-655.541) (-655.585) -- 0:00:28
557500 -- (-655.680) (-655.332) (-659.028) [-655.193] * (-655.002) (-653.335) [-654.405] (-655.382) -- 0:00:28
558000 -- (-657.560) (-654.903) [-659.181] (-656.626) * (-657.519) (-653.200) [-653.865] (-655.529) -- 0:00:28
558500 -- [-657.753] (-655.376) (-662.642) (-656.241) * (-654.793) [-654.084] (-657.757) (-655.128) -- 0:00:28
559000 -- (-655.521) (-654.855) (-659.442) [-652.821] * (-653.833) [-654.139] (-655.274) (-656.996) -- 0:00:28
559500 -- (-657.197) (-654.786) [-654.651] (-655.767) * [-652.847] (-654.396) (-655.496) (-655.543) -- 0:00:28
560000 -- (-658.103) [-654.699] (-654.526) (-657.257) * [-654.523] (-653.145) (-653.734) (-655.750) -- 0:00:28
Average standard deviation of split frequencies: 0.009743
560500 -- (-656.640) (-654.621) (-656.211) [-656.717] * (-654.528) [-652.736] (-653.264) (-658.820) -- 0:00:28
561000 -- (-657.304) (-652.679) (-654.677) [-655.153] * [-655.900] (-654.083) (-656.575) (-654.332) -- 0:00:28
561500 -- (-657.134) (-653.331) (-656.145) [-656.363] * (-655.504) (-656.307) [-654.930] (-655.310) -- 0:00:28
562000 -- (-655.034) [-653.907] (-655.997) (-659.951) * (-653.509) (-655.170) [-655.527] (-655.363) -- 0:00:28
562500 -- (-656.130) [-655.936] (-654.316) (-654.701) * (-654.968) (-656.424) [-653.655] (-653.869) -- 0:00:28
563000 -- [-654.814] (-657.006) (-653.567) (-653.480) * (-653.517) [-653.359] (-654.166) (-653.198) -- 0:00:27
563500 -- (-656.788) [-655.358] (-652.716) (-653.391) * (-654.286) (-656.947) [-654.839] (-653.022) -- 0:00:27
564000 -- (-659.936) [-655.927] (-656.603) (-658.260) * (-653.693) (-656.300) (-652.748) [-657.154] -- 0:00:27
564500 -- (-653.751) (-656.283) [-655.818] (-655.063) * (-653.561) (-661.032) (-653.230) [-656.248] -- 0:00:27
565000 -- (-653.158) (-654.654) [-655.608] (-654.181) * (-655.218) (-656.271) [-652.890] (-655.166) -- 0:00:27
Average standard deviation of split frequencies: 0.009994
565500 -- (-653.007) (-655.433) [-654.872] (-653.748) * (-653.610) (-653.529) [-653.229] (-653.117) -- 0:00:27
566000 -- (-653.338) (-656.461) [-654.431] (-657.624) * (-655.546) (-652.845) [-654.080] (-653.436) -- 0:00:27
566500 -- [-654.147] (-656.188) (-654.852) (-654.553) * (-661.565) (-653.999) [-652.991] (-654.517) -- 0:00:27
567000 -- (-654.350) [-659.637] (-657.156) (-655.416) * (-656.182) (-656.838) [-653.019] (-654.123) -- 0:00:27
567500 -- (-656.720) [-656.604] (-657.930) (-653.609) * (-654.554) (-653.212) [-656.206] (-655.750) -- 0:00:27
568000 -- (-657.813) [-655.470] (-657.389) (-658.349) * (-655.421) (-656.760) [-654.679] (-656.639) -- 0:00:27
568500 -- (-653.842) [-656.577] (-655.011) (-654.222) * (-656.394) [-656.315] (-656.372) (-659.541) -- 0:00:27
569000 -- [-655.710] (-658.397) (-656.406) (-654.405) * [-654.771] (-654.919) (-657.741) (-654.084) -- 0:00:27
569500 -- (-657.710) [-662.326] (-654.328) (-656.132) * (-655.114) (-657.960) [-653.932] (-653.492) -- 0:00:27
570000 -- [-654.297] (-654.426) (-656.896) (-656.353) * (-656.293) (-658.413) [-653.785] (-653.296) -- 0:00:27
Average standard deviation of split frequencies: 0.010156
570500 -- (-653.991) (-654.696) (-655.000) [-656.278] * (-657.093) (-659.386) [-655.209] (-656.136) -- 0:00:27
571000 -- (-653.869) (-654.138) (-655.873) [-654.952] * (-659.901) [-658.869] (-654.861) (-656.152) -- 0:00:27
571500 -- (-655.861) [-654.523] (-652.823) (-654.656) * (-654.470) (-665.172) [-655.273] (-654.026) -- 0:00:27
572000 -- (-655.838) (-653.560) (-657.407) [-656.131] * (-655.488) (-655.219) (-654.620) [-654.365] -- 0:00:27
572500 -- (-655.251) (-654.442) [-653.489] (-655.358) * [-654.382] (-657.291) (-654.550) (-654.523) -- 0:00:27
573000 -- (-655.496) (-654.553) (-653.443) [-654.384] * (-653.077) (-657.453) [-656.664] (-652.767) -- 0:00:27
573500 -- (-655.797) [-654.869] (-655.424) (-653.571) * (-654.111) (-655.663) (-655.354) [-653.575] -- 0:00:27
574000 -- (-656.867) (-653.833) [-656.436] (-653.063) * (-656.579) (-654.688) [-654.378] (-654.455) -- 0:00:27
574500 -- (-653.475) (-655.042) [-654.011] (-653.148) * (-655.252) (-653.972) (-654.602) [-653.936] -- 0:00:27
575000 -- (-655.011) (-655.211) [-653.409] (-653.325) * (-655.546) [-654.769] (-656.261) (-653.723) -- 0:00:27
Average standard deviation of split frequencies: 0.009917
575500 -- (-655.965) (-653.646) [-657.528] (-656.236) * (-653.382) [-654.080] (-654.787) (-654.931) -- 0:00:27
576000 -- (-654.240) [-653.417] (-656.927) (-655.032) * [-652.930] (-655.302) (-654.689) (-654.271) -- 0:00:27
576500 -- (-660.434) [-655.550] (-654.341) (-655.453) * [-653.780] (-654.752) (-657.311) (-654.605) -- 0:00:27
577000 -- (-658.182) (-653.991) [-655.304] (-657.680) * (-655.761) (-656.921) (-656.384) [-654.791] -- 0:00:27
577500 -- (-654.113) [-657.970] (-654.177) (-655.579) * (-656.563) (-654.777) (-653.210) [-653.669] -- 0:00:27
578000 -- (-653.397) [-657.823] (-653.075) (-654.398) * (-653.630) (-656.845) [-653.899] (-655.373) -- 0:00:27
578500 -- (-657.258) (-655.403) (-653.477) [-653.129] * (-656.085) (-655.801) [-656.589] (-654.472) -- 0:00:26
579000 -- [-653.604] (-654.572) (-657.788) (-657.646) * (-656.113) [-654.510] (-653.814) (-657.522) -- 0:00:26
579500 -- (-653.761) (-653.262) (-657.187) [-655.917] * (-654.526) [-653.671] (-654.754) (-656.138) -- 0:00:26
580000 -- (-654.591) (-654.454) (-658.926) [-652.942] * (-655.390) (-654.482) [-653.099] (-653.920) -- 0:00:26
Average standard deviation of split frequencies: 0.009885
580500 -- (-653.346) (-653.722) [-654.817] (-652.947) * (-656.235) (-655.174) (-654.397) [-653.206] -- 0:00:26
581000 -- [-656.020] (-654.688) (-656.123) (-654.476) * [-654.644] (-656.694) (-654.160) (-657.495) -- 0:00:26
581500 -- (-655.110) (-654.848) (-655.425) [-655.617] * (-655.278) (-654.904) (-654.234) [-656.722] -- 0:00:26
582000 -- (-654.321) [-655.950] (-654.595) (-659.114) * (-654.085) (-654.447) [-654.401] (-655.665) -- 0:00:26
582500 -- [-654.622] (-656.618) (-654.100) (-666.036) * (-656.661) (-654.462) [-654.430] (-655.066) -- 0:00:26
583000 -- (-655.078) (-653.152) (-655.068) [-655.644] * (-654.168) (-653.171) (-658.871) [-654.176] -- 0:00:26
583500 -- (-654.456) (-653.506) [-654.677] (-654.661) * (-654.594) (-655.023) [-656.568] (-654.470) -- 0:00:26
584000 -- [-653.503] (-654.346) (-655.745) (-654.984) * (-657.709) (-653.499) (-656.741) [-652.983] -- 0:00:26
584500 -- (-653.287) (-654.549) [-655.972] (-652.790) * (-653.220) [-655.559] (-658.015) (-654.431) -- 0:00:27
585000 -- (-654.571) [-654.753] (-656.697) (-654.289) * (-654.198) (-653.740) [-653.936] (-654.121) -- 0:00:26
Average standard deviation of split frequencies: 0.009653
585500 -- [-655.143] (-657.236) (-658.949) (-657.135) * (-655.222) (-653.434) (-657.709) [-653.659] -- 0:00:26
586000 -- (-655.190) (-655.262) (-659.009) [-654.456] * (-655.614) [-652.832] (-656.056) (-653.964) -- 0:00:26
586500 -- (-654.625) (-655.529) (-654.062) [-655.834] * (-653.633) (-653.351) [-653.626] (-653.818) -- 0:00:26
587000 -- (-654.517) [-654.174] (-652.648) (-657.279) * [-652.935] (-653.203) (-654.632) (-655.107) -- 0:00:26
587500 -- (-656.142) (-655.563) (-652.743) [-653.698] * (-654.714) [-654.527] (-658.948) (-654.592) -- 0:00:26
588000 -- (-655.699) (-653.470) (-654.411) [-655.805] * (-654.847) (-654.691) (-655.546) [-656.594] -- 0:00:26
588500 -- (-656.040) [-655.139] (-654.115) (-656.626) * (-655.790) (-653.612) [-655.530] (-661.656) -- 0:00:26
589000 -- (-654.350) (-654.150) (-657.373) [-654.196] * (-655.613) [-653.399] (-654.542) (-656.537) -- 0:00:26
589500 -- [-654.289] (-654.290) (-653.011) (-655.290) * (-656.693) (-656.350) [-656.417] (-654.907) -- 0:00:26
590000 -- (-654.400) (-654.806) (-655.813) [-656.378] * (-655.042) (-654.782) [-654.957] (-654.949) -- 0:00:26
Average standard deviation of split frequencies: 0.009887
590500 -- (-656.840) [-654.261] (-654.141) (-657.587) * [-655.523] (-655.755) (-655.166) (-657.026) -- 0:00:26
591000 -- [-654.611] (-660.706) (-655.526) (-656.633) * [-655.838] (-655.066) (-654.810) (-656.887) -- 0:00:26
591500 -- (-653.825) (-655.906) [-656.944] (-656.124) * [-654.124] (-654.019) (-654.800) (-658.990) -- 0:00:26
592000 -- (-654.942) [-655.340] (-656.048) (-657.421) * (-653.560) (-653.665) (-656.686) [-655.546] -- 0:00:26
592500 -- (-652.811) [-657.140] (-656.945) (-653.442) * [-653.581] (-654.735) (-658.502) (-654.807) -- 0:00:26
593000 -- [-659.566] (-653.803) (-659.246) (-655.270) * (-653.939) (-654.442) [-656.345] (-659.060) -- 0:00:26
593500 -- (-653.988) (-654.393) [-656.121] (-657.159) * (-653.638) (-655.651) (-654.835) [-656.886] -- 0:00:26
594000 -- [-653.300] (-655.624) (-659.469) (-659.716) * (-654.056) (-653.082) (-654.760) [-655.526] -- 0:00:25
594500 -- (-657.296) (-657.605) [-656.371] (-657.574) * [-655.288] (-656.998) (-654.282) (-655.260) -- 0:00:25
595000 -- (-653.192) (-653.459) (-654.831) [-654.789] * (-656.483) (-655.072) (-653.457) [-654.009] -- 0:00:25
Average standard deviation of split frequencies: 0.010194
595500 -- (-653.188) [-654.873] (-657.464) (-657.156) * (-654.947) [-655.783] (-653.718) (-653.692) -- 0:00:25
596000 -- (-653.252) [-656.552] (-654.673) (-660.496) * (-657.345) (-655.189) (-654.090) [-653.340] -- 0:00:25
596500 -- [-655.029] (-654.119) (-654.412) (-659.790) * (-653.404) (-655.014) (-654.476) [-654.485] -- 0:00:25
597000 -- (-656.178) (-654.612) [-656.919] (-655.325) * (-653.206) (-657.326) [-653.717] (-656.163) -- 0:00:25
597500 -- (-655.855) (-654.345) (-653.579) [-657.390] * [-652.856] (-656.905) (-653.764) (-654.232) -- 0:00:25
598000 -- (-657.180) (-653.373) [-654.174] (-655.482) * (-653.366) [-656.636] (-656.280) (-654.162) -- 0:00:25
598500 -- [-658.641] (-655.319) (-655.943) (-655.031) * (-654.808) (-655.190) (-655.346) [-655.739] -- 0:00:25
599000 -- [-657.627] (-655.079) (-653.663) (-655.606) * (-654.469) (-654.951) [-656.700] (-658.908) -- 0:00:25
599500 -- (-654.421) (-656.582) (-654.756) [-652.964] * (-652.995) [-657.300] (-657.826) (-657.273) -- 0:00:26
600000 -- [-655.445] (-656.485) (-654.242) (-658.061) * (-654.734) [-654.152] (-655.836) (-655.006) -- 0:00:25
Average standard deviation of split frequencies: 0.010333
600500 -- (-653.938) (-657.832) (-656.904) [-654.740] * (-658.380) (-655.043) [-655.071] (-656.216) -- 0:00:25
601000 -- (-653.201) [-656.052] (-655.968) (-656.105) * (-653.058) [-654.083] (-656.015) (-653.492) -- 0:00:25
601500 -- [-653.250] (-655.817) (-654.557) (-654.779) * (-654.918) [-653.551] (-654.412) (-654.720) -- 0:00:25
602000 -- (-654.102) [-657.213] (-654.143) (-657.140) * (-654.275) (-655.068) [-654.818] (-653.337) -- 0:00:25
602500 -- (-654.535) [-655.799] (-653.799) (-657.701) * (-655.467) (-655.247) (-654.853) [-654.105] -- 0:00:25
603000 -- (-654.345) [-654.199] (-654.941) (-654.603) * (-657.950) (-654.212) (-654.170) [-653.294] -- 0:00:25
603500 -- [-657.934] (-657.737) (-655.452) (-654.408) * (-655.736) [-656.077] (-655.786) (-655.088) -- 0:00:25
604000 -- [-653.268] (-658.283) (-655.574) (-653.484) * (-653.329) [-654.158] (-653.998) (-657.078) -- 0:00:25
604500 -- [-654.208] (-654.386) (-656.321) (-653.384) * (-653.859) (-660.952) [-654.630] (-658.513) -- 0:00:25
605000 -- (-657.829) (-653.321) [-657.308] (-653.140) * (-656.941) (-655.399) (-654.969) [-652.722] -- 0:00:25
Average standard deviation of split frequencies: 0.009853
605500 -- [-655.026] (-653.932) (-653.143) (-653.873) * (-657.287) [-655.344] (-656.501) (-656.166) -- 0:00:25
606000 -- (-658.078) (-654.018) (-654.620) [-657.935] * [-653.004] (-657.666) (-653.827) (-656.363) -- 0:00:25
606500 -- (-652.755) (-655.931) (-654.086) [-657.407] * (-655.234) (-657.978) [-653.527] (-657.569) -- 0:00:25
607000 -- (-655.707) (-654.774) [-656.323] (-654.310) * (-655.333) (-653.132) [-653.588] (-657.107) -- 0:00:25
607500 -- (-655.827) [-658.103] (-653.579) (-657.026) * (-660.188) [-654.994] (-653.338) (-656.042) -- 0:00:25
608000 -- (-652.912) [-656.393] (-654.507) (-654.822) * (-654.148) (-654.660) [-654.839] (-655.014) -- 0:00:25
608500 -- [-653.510] (-653.798) (-655.775) (-655.573) * (-656.271) (-654.260) (-657.237) [-653.529] -- 0:00:25
609000 -- (-655.132) [-653.754] (-654.240) (-654.273) * [-654.673] (-655.825) (-661.399) (-653.098) -- 0:00:25
609500 -- (-654.663) [-653.530] (-655.296) (-653.467) * [-655.232] (-655.281) (-661.907) (-655.808) -- 0:00:24
610000 -- (-654.252) [-653.260] (-653.946) (-654.934) * (-658.052) [-654.613] (-657.406) (-655.562) -- 0:00:24
Average standard deviation of split frequencies: 0.009521
610500 -- (-654.384) [-653.417] (-655.390) (-654.922) * (-653.523) [-654.621] (-653.419) (-655.721) -- 0:00:24
611000 -- (-659.553) [-653.749] (-655.357) (-655.758) * [-654.600] (-660.080) (-653.749) (-656.780) -- 0:00:24
611500 -- (-658.305) (-655.321) [-655.941] (-658.280) * (-653.460) (-660.088) [-654.498] (-655.105) -- 0:00:24
612000 -- (-655.371) (-653.960) (-659.570) [-656.484] * (-655.074) (-657.465) [-653.490] (-655.020) -- 0:00:24
612500 -- (-653.735) (-654.176) [-654.360] (-652.809) * (-656.751) (-657.895) (-653.440) [-655.073] -- 0:00:24
613000 -- (-659.887) (-653.852) [-653.194] (-658.051) * (-654.960) [-658.234] (-654.143) (-653.269) -- 0:00:24
613500 -- [-653.869] (-654.044) (-655.160) (-658.463) * (-652.565) [-653.401] (-656.611) (-654.298) -- 0:00:24
614000 -- (-654.056) (-653.432) [-654.858] (-653.681) * (-652.679) [-656.841] (-655.030) (-655.015) -- 0:00:25
614500 -- (-654.879) (-661.308) [-654.270] (-653.306) * (-652.955) (-654.828) [-655.510] (-656.057) -- 0:00:25
615000 -- [-655.491] (-657.726) (-657.452) (-653.955) * [-656.724] (-656.565) (-654.319) (-653.993) -- 0:00:25
Average standard deviation of split frequencies: 0.009438
615500 -- (-656.440) [-656.946] (-655.049) (-657.415) * (-653.861) (-655.592) [-656.794] (-657.225) -- 0:00:24
616000 -- (-653.351) (-654.214) (-654.551) [-653.655] * [-654.979] (-658.922) (-653.621) (-655.544) -- 0:00:24
616500 -- (-654.164) [-656.529] (-655.188) (-655.656) * (-657.632) (-654.692) (-654.349) [-653.238] -- 0:00:24
617000 -- (-655.651) (-656.776) (-657.482) [-656.250] * (-657.619) [-653.033] (-655.653) (-655.784) -- 0:00:24
617500 -- (-656.425) (-653.546) (-654.871) [-655.201] * (-654.595) (-653.832) [-655.076] (-656.798) -- 0:00:24
618000 -- (-654.227) [-656.374] (-653.709) (-654.577) * [-659.283] (-653.403) (-652.853) (-655.950) -- 0:00:24
618500 -- (-655.319) (-655.295) [-654.343] (-653.211) * (-653.772) [-654.447] (-653.701) (-656.172) -- 0:00:24
619000 -- [-654.873] (-656.528) (-654.333) (-655.863) * (-656.377) (-655.638) (-655.868) [-654.647] -- 0:00:24
619500 -- (-656.023) (-655.377) (-657.722) [-653.739] * [-653.963] (-656.739) (-656.645) (-658.576) -- 0:00:24
620000 -- (-658.280) (-653.649) [-661.247] (-656.808) * (-656.254) (-653.926) (-655.292) [-657.723] -- 0:00:24
Average standard deviation of split frequencies: 0.008444
620500 -- (-653.821) [-653.375] (-654.310) (-657.242) * (-654.174) (-653.507) [-656.796] (-655.307) -- 0:00:24
621000 -- (-653.219) (-659.191) (-653.197) [-654.483] * (-654.967) [-653.791] (-654.764) (-652.686) -- 0:00:24
621500 -- (-653.989) (-656.966) (-658.033) [-655.114] * (-655.016) [-653.973] (-655.658) (-657.086) -- 0:00:24
622000 -- (-653.791) (-655.786) [-660.887] (-659.891) * [-654.153] (-655.477) (-653.783) (-654.665) -- 0:00:24
622500 -- (-654.685) (-656.398) [-661.191] (-654.205) * (-653.740) (-658.011) [-654.419] (-655.279) -- 0:00:24
623000 -- (-653.121) (-655.169) [-661.744] (-657.817) * (-656.584) (-658.582) (-654.817) [-654.915] -- 0:00:24
623500 -- (-655.427) (-656.008) (-655.052) [-655.759] * (-657.253) [-654.764] (-661.022) (-660.730) -- 0:00:24
624000 -- (-654.807) (-657.895) (-654.738) [-654.039] * (-653.866) (-655.519) (-657.875) [-654.907] -- 0:00:24
624500 -- (-656.401) (-656.102) [-653.268] (-653.605) * (-654.245) [-655.779] (-654.447) (-655.787) -- 0:00:24
625000 -- (-654.175) (-653.120) (-654.964) [-653.815] * (-653.997) [-655.701] (-657.026) (-654.211) -- 0:00:24
Average standard deviation of split frequencies: 0.009120
625500 -- (-655.085) [-654.904] (-653.265) (-655.391) * (-654.525) (-654.073) (-657.438) [-653.701] -- 0:00:23
626000 -- (-654.875) (-658.408) (-653.436) [-655.590] * (-654.714) [-655.421] (-654.281) (-655.971) -- 0:00:23
626500 -- (-654.826) [-654.090] (-652.881) (-652.952) * (-655.042) (-654.377) (-656.860) [-653.172] -- 0:00:23
627000 -- (-655.144) (-655.758) (-655.320) [-653.194] * (-653.821) (-656.176) [-658.333] (-654.681) -- 0:00:23
627500 -- [-653.830] (-655.043) (-656.411) (-654.983) * (-653.975) (-655.932) [-654.642] (-656.178) -- 0:00:23
628000 -- (-656.171) [-656.699] (-655.144) (-653.677) * [-653.213] (-657.392) (-654.972) (-658.479) -- 0:00:23
628500 -- (-656.248) (-655.918) [-653.972] (-654.767) * [-653.706] (-655.920) (-657.004) (-655.074) -- 0:00:23
629000 -- (-654.456) (-655.178) (-659.056) [-654.407] * (-657.933) (-654.647) [-654.986] (-656.924) -- 0:00:23
629500 -- [-652.926] (-653.388) (-656.906) (-652.910) * (-658.038) (-654.168) (-654.692) [-654.516] -- 0:00:24
630000 -- [-653.877] (-657.878) (-657.508) (-654.101) * [-654.330] (-655.293) (-658.193) (-653.194) -- 0:00:24
Average standard deviation of split frequencies: 0.008887
630500 -- (-656.663) [-656.175] (-655.910) (-653.121) * [-654.745] (-660.616) (-660.014) (-654.373) -- 0:00:24
631000 -- (-665.382) (-653.108) (-655.605) [-655.181] * [-653.803] (-656.888) (-654.768) (-654.164) -- 0:00:23
631500 -- (-658.331) (-656.981) [-655.423] (-655.753) * (-656.357) [-653.693] (-654.059) (-655.361) -- 0:00:23
632000 -- (-654.360) [-660.226] (-656.607) (-655.056) * (-662.777) [-653.454] (-655.979) (-656.269) -- 0:00:23
632500 -- (-653.868) (-655.825) [-655.232] (-655.648) * (-659.907) (-672.469) [-655.755] (-656.218) -- 0:00:23
633000 -- (-657.485) (-656.722) [-654.562] (-654.986) * (-653.442) [-655.871] (-655.197) (-660.962) -- 0:00:23
633500 -- [-654.121] (-655.967) (-655.442) (-657.671) * (-654.340) [-654.235] (-653.400) (-654.354) -- 0:00:23
634000 -- (-654.111) [-656.130] (-653.474) (-655.421) * (-655.028) (-655.376) [-654.542] (-663.474) -- 0:00:23
634500 -- [-653.001] (-655.032) (-653.666) (-654.780) * (-654.762) [-656.003] (-654.328) (-662.759) -- 0:00:23
635000 -- (-655.879) [-654.096] (-654.071) (-656.232) * (-652.843) (-654.024) (-658.534) [-654.007] -- 0:00:23
Average standard deviation of split frequencies: 0.008894
635500 -- [-654.345] (-656.864) (-654.223) (-652.768) * (-653.711) (-652.780) [-654.434] (-654.633) -- 0:00:23
636000 -- (-654.331) (-657.731) (-654.881) [-654.077] * (-654.167) (-654.616) [-654.296] (-654.424) -- 0:00:23
636500 -- (-655.269) (-655.812) (-657.290) [-655.512] * (-655.242) (-654.178) (-655.414) [-654.518] -- 0:00:23
637000 -- (-656.492) (-656.465) (-659.956) [-657.685] * (-658.294) (-653.536) [-655.105] (-653.603) -- 0:00:23
637500 -- (-657.186) [-654.839] (-654.554) (-654.919) * [-660.786] (-654.099) (-655.940) (-654.530) -- 0:00:23
638000 -- (-655.824) [-652.996] (-655.352) (-653.707) * (-654.404) (-656.984) [-655.026] (-654.322) -- 0:00:23
638500 -- (-654.832) [-653.352] (-654.954) (-655.163) * (-654.637) (-656.109) [-654.495] (-653.229) -- 0:00:23
639000 -- (-656.113) (-655.041) [-653.938] (-654.035) * [-656.644] (-656.214) (-654.275) (-654.228) -- 0:00:23
639500 -- (-655.935) [-654.643] (-653.164) (-653.747) * (-655.426) (-656.749) [-654.953] (-666.111) -- 0:00:23
640000 -- [-655.647] (-661.652) (-652.764) (-655.093) * (-654.918) [-653.707] (-654.913) (-656.174) -- 0:00:23
Average standard deviation of split frequencies: 0.008483
640500 -- (-654.244) (-655.704) [-653.557] (-655.359) * (-655.379) (-657.494) [-653.534] (-655.589) -- 0:00:23
641000 -- (-654.907) (-653.871) (-652.941) [-655.622] * (-654.009) [-655.740] (-653.892) (-660.401) -- 0:00:22
641500 -- (-655.748) (-654.131) [-654.817] (-655.193) * [-654.580] (-654.655) (-653.331) (-656.494) -- 0:00:22
642000 -- [-655.221] (-655.331) (-657.664) (-656.620) * (-654.079) (-658.070) [-653.931] (-656.062) -- 0:00:22
642500 -- (-655.649) [-655.514] (-655.901) (-654.400) * [-653.088] (-653.050) (-653.806) (-656.509) -- 0:00:23
643000 -- (-657.022) (-653.541) (-656.803) [-654.473] * (-652.743) (-652.854) [-657.810] (-656.765) -- 0:00:23
643500 -- (-656.048) (-653.581) [-654.333] (-654.201) * [-657.676] (-653.633) (-658.536) (-658.744) -- 0:00:23
644000 -- (-654.089) (-654.807) (-653.707) [-653.983] * [-654.857] (-658.566) (-653.827) (-653.121) -- 0:00:23
644500 -- (-656.678) (-654.747) (-654.019) [-655.503] * (-656.659) (-656.742) [-653.046] (-655.149) -- 0:00:23
645000 -- (-656.713) [-656.534] (-653.980) (-654.680) * [-660.853] (-654.553) (-657.931) (-653.247) -- 0:00:23
Average standard deviation of split frequencies: 0.008370
645500 -- (-653.781) [-653.460] (-658.835) (-655.723) * (-656.354) [-657.329] (-655.962) (-654.967) -- 0:00:23
646000 -- (-655.218) (-653.744) [-654.451] (-657.897) * (-655.047) (-655.463) (-656.866) [-654.584] -- 0:00:23
646500 -- (-656.599) [-654.462] (-660.014) (-656.502) * (-656.626) (-656.043) (-658.517) [-658.099] -- 0:00:22
647000 -- (-656.286) (-656.202) [-653.873] (-654.768) * (-653.794) (-657.462) (-659.943) [-653.760] -- 0:00:22
647500 -- [-655.167] (-656.357) (-654.609) (-653.456) * (-657.818) (-655.609) [-655.155] (-653.384) -- 0:00:22
648000 -- [-656.143] (-654.873) (-656.277) (-659.719) * (-657.698) (-654.821) (-654.768) [-653.550] -- 0:00:22
648500 -- (-654.276) (-656.487) (-657.272) [-653.701] * (-656.003) (-656.723) [-652.773] (-654.735) -- 0:00:22
649000 -- [-654.147] (-654.141) (-653.936) (-653.985) * [-654.015] (-655.426) (-659.718) (-653.756) -- 0:00:22
649500 -- (-654.039) (-654.913) [-653.445] (-653.971) * (-655.947) (-659.395) [-653.701] (-654.275) -- 0:00:22
650000 -- (-654.496) (-654.090) [-654.004] (-654.565) * (-655.718) (-654.157) [-655.072] (-657.064) -- 0:00:22
Average standard deviation of split frequencies: 0.008183
650500 -- (-655.877) (-654.747) [-654.864] (-653.667) * [-656.514] (-654.680) (-653.296) (-655.796) -- 0:00:22
651000 -- (-657.167) (-654.406) (-655.924) [-654.972] * [-655.317] (-654.190) (-654.386) (-654.075) -- 0:00:22
651500 -- (-656.113) (-655.731) (-655.277) [-654.559] * (-654.877) (-655.256) (-656.162) [-654.434] -- 0:00:22
652000 -- (-654.617) (-655.643) [-654.602] (-655.047) * [-653.476] (-654.255) (-655.771) (-653.346) -- 0:00:22
652500 -- (-653.964) (-655.820) (-656.101) [-656.971] * [-652.972] (-654.364) (-654.686) (-655.400) -- 0:00:22
653000 -- (-656.862) [-653.826] (-656.383) (-658.432) * (-654.280) [-654.219] (-653.992) (-655.741) -- 0:00:22
653500 -- (-655.490) (-658.249) [-653.974] (-655.879) * (-655.357) (-655.220) [-654.580] (-654.976) -- 0:00:22
654000 -- (-655.475) (-655.960) [-653.674] (-653.970) * [-659.785] (-652.838) (-653.174) (-653.900) -- 0:00:22
654500 -- (-652.970) [-653.520] (-654.735) (-657.907) * (-654.584) (-652.938) (-655.133) [-656.003] -- 0:00:22
655000 -- (-653.028) (-654.625) [-656.616] (-655.761) * (-654.054) [-656.095] (-655.654) (-653.056) -- 0:00:22
Average standard deviation of split frequencies: 0.008370
655500 -- (-653.083) [-654.247] (-657.109) (-653.865) * (-656.133) (-655.450) [-653.663] (-656.614) -- 0:00:22
656000 -- (-654.845) [-652.922] (-657.922) (-653.337) * (-653.587) (-654.909) (-653.633) [-654.136] -- 0:00:22
656500 -- (-654.525) [-653.231] (-657.035) (-654.683) * (-656.842) (-656.284) [-653.685] (-656.312) -- 0:00:22
657000 -- (-653.529) (-654.721) [-656.081] (-655.005) * (-657.083) [-653.304] (-655.185) (-655.906) -- 0:00:22
657500 -- [-652.833] (-657.243) (-657.608) (-656.879) * (-653.952) (-653.137) [-654.289] (-654.550) -- 0:00:22
658000 -- (-653.211) (-654.891) [-653.213] (-654.663) * (-658.549) [-656.808] (-653.923) (-653.279) -- 0:00:22
658500 -- (-653.213) (-654.925) [-653.455] (-654.335) * (-653.382) (-655.819) [-653.329] (-653.512) -- 0:00:22
659000 -- (-652.511) (-653.980) [-654.505] (-654.500) * [-658.807] (-655.788) (-653.255) (-658.005) -- 0:00:22
659500 -- (-655.632) [-654.626] (-652.803) (-656.065) * [-657.178] (-655.959) (-653.404) (-656.520) -- 0:00:22
660000 -- (-657.593) [-654.501] (-653.830) (-655.466) * (-658.187) [-655.968] (-653.663) (-656.437) -- 0:00:22
Average standard deviation of split frequencies: 0.008520
660500 -- (-657.019) (-652.996) (-654.771) [-659.846] * (-659.301) [-655.422] (-654.940) (-655.071) -- 0:00:22
661000 -- (-654.739) (-653.335) (-654.933) [-657.507] * (-654.720) [-657.063] (-658.956) (-655.038) -- 0:00:22
661500 -- [-652.857] (-659.844) (-656.184) (-660.194) * (-656.628) [-654.730] (-656.858) (-655.382) -- 0:00:22
662000 -- [-654.501] (-657.011) (-656.437) (-655.744) * (-655.593) (-655.185) [-653.528] (-655.560) -- 0:00:21
662500 -- [-656.239] (-653.408) (-653.305) (-660.990) * (-654.107) (-654.588) (-655.036) [-655.509] -- 0:00:21
663000 -- (-654.332) (-656.634) (-656.964) [-654.599] * [-654.928] (-652.917) (-654.910) (-656.345) -- 0:00:21
663500 -- (-654.042) (-654.812) [-656.940] (-655.494) * [-654.421] (-655.434) (-655.517) (-656.382) -- 0:00:21
664000 -- (-653.377) (-658.693) [-655.088] (-655.503) * (-657.024) [-653.338] (-658.136) (-660.155) -- 0:00:21
664500 -- [-655.077] (-659.948) (-654.361) (-656.532) * [-654.147] (-655.568) (-654.571) (-657.396) -- 0:00:21
665000 -- (-656.862) (-654.519) [-654.375] (-659.419) * (-654.662) (-659.624) [-655.978] (-654.665) -- 0:00:21
Average standard deviation of split frequencies: 0.008993
665500 -- (-653.179) [-654.480] (-655.978) (-656.104) * [-654.250] (-656.381) (-655.086) (-654.312) -- 0:00:21
666000 -- (-656.896) (-656.072) (-655.420) [-656.964] * [-653.168] (-655.797) (-654.190) (-654.614) -- 0:00:21
666500 -- (-654.779) [-652.852] (-653.208) (-655.918) * (-653.141) (-658.150) [-654.426] (-653.460) -- 0:00:21
667000 -- (-655.526) (-653.340) (-656.762) [-654.529] * [-653.236] (-654.431) (-655.695) (-655.290) -- 0:00:21
667500 -- (-655.014) (-655.478) [-655.529] (-654.334) * (-654.658) [-655.754] (-654.205) (-655.361) -- 0:00:21
668000 -- (-655.971) (-653.397) (-654.229) [-654.211] * (-654.258) [-655.669] (-654.824) (-655.409) -- 0:00:21
668500 -- (-657.533) (-654.866) [-653.876] (-654.135) * (-654.069) [-653.444] (-655.313) (-652.969) -- 0:00:21
669000 -- (-655.313) (-658.420) [-654.790] (-655.144) * (-654.371) [-654.618] (-654.914) (-653.118) -- 0:00:21
669500 -- (-655.701) (-655.634) [-656.018] (-653.814) * (-655.167) (-653.886) [-654.267] (-653.856) -- 0:00:21
670000 -- (-657.026) (-655.420) (-658.351) [-654.564] * [-657.941] (-655.190) (-654.764) (-653.857) -- 0:00:21
Average standard deviation of split frequencies: 0.008931
670500 -- (-654.034) (-657.703) [-653.319] (-653.786) * (-653.451) [-657.272] (-654.463) (-655.067) -- 0:00:21
671000 -- (-654.860) (-653.287) (-653.175) [-654.188] * (-655.747) (-652.717) (-655.909) [-653.623] -- 0:00:21
671500 -- (-654.271) [-656.669] (-656.535) (-654.404) * (-660.343) (-652.629) [-654.501] (-656.483) -- 0:00:21
672000 -- (-653.804) [-653.975] (-661.989) (-657.208) * (-655.571) [-658.273] (-654.314) (-659.020) -- 0:00:21
672500 -- (-653.983) (-655.855) (-656.635) [-655.877] * [-654.795] (-659.460) (-654.049) (-656.491) -- 0:00:21
673000 -- [-653.884] (-657.890) (-653.590) (-655.399) * [-656.482] (-664.458) (-653.946) (-653.670) -- 0:00:21
673500 -- [-654.294] (-657.103) (-653.145) (-653.583) * (-657.548) (-656.068) [-655.734] (-656.652) -- 0:00:21
674000 -- [-655.044] (-654.165) (-654.951) (-656.170) * [-655.884] (-655.814) (-655.275) (-655.163) -- 0:00:21
674500 -- (-656.215) [-654.992] (-655.516) (-653.602) * (-659.077) (-653.631) (-654.595) [-653.365] -- 0:00:21
675000 -- [-654.411] (-659.304) (-654.670) (-654.420) * (-656.487) (-654.902) [-656.811] (-657.684) -- 0:00:21
Average standard deviation of split frequencies: 0.008860
675500 -- (-654.930) (-659.947) (-657.262) [-655.948] * (-654.917) (-656.662) [-654.908] (-653.601) -- 0:00:21
676000 -- (-657.070) [-653.793] (-655.045) (-658.575) * (-655.044) (-653.785) [-655.718] (-653.774) -- 0:00:21
676500 -- (-653.159) [-653.659] (-654.200) (-653.781) * (-654.284) [-653.233] (-656.502) (-656.756) -- 0:00:21
677000 -- (-655.980) [-655.028] (-655.065) (-657.694) * [-656.925] (-655.875) (-652.876) (-655.785) -- 0:00:20
677500 -- (-657.372) (-659.389) (-655.797) [-656.365] * (-653.678) (-660.148) [-658.660] (-655.972) -- 0:00:20
678000 -- (-654.927) [-654.239] (-653.384) (-653.147) * (-655.726) (-655.938) (-666.476) [-657.401] -- 0:00:20
678500 -- (-656.225) [-655.554] (-655.304) (-658.524) * (-656.231) [-655.084] (-654.729) (-656.222) -- 0:00:20
679000 -- [-657.116] (-653.153) (-656.642) (-654.505) * (-659.636) (-653.500) [-653.621] (-655.494) -- 0:00:20
679500 -- [-653.646] (-652.867) (-654.446) (-658.517) * (-659.668) (-656.567) [-653.162] (-654.448) -- 0:00:20
680000 -- [-653.655] (-655.323) (-654.397) (-654.551) * (-654.334) (-655.298) (-653.275) [-656.177] -- 0:00:20
Average standard deviation of split frequencies: 0.009003
680500 -- (-656.391) (-652.965) [-653.534] (-654.041) * [-653.200] (-656.842) (-654.052) (-654.316) -- 0:00:20
681000 -- (-653.069) [-652.882] (-654.071) (-653.982) * (-657.076) (-655.466) [-657.782] (-654.592) -- 0:00:20
681500 -- (-654.095) [-655.089] (-653.460) (-654.395) * (-659.768) (-654.748) (-655.695) [-655.635] -- 0:00:20
682000 -- (-654.891) (-656.489) (-653.167) [-652.882] * [-654.284] (-654.169) (-654.583) (-653.626) -- 0:00:20
682500 -- (-656.349) (-652.858) [-655.075] (-656.873) * (-658.124) (-652.909) (-654.526) [-656.123] -- 0:00:20
683000 -- (-656.475) [-653.913] (-653.872) (-655.118) * (-653.326) (-653.138) (-654.497) [-653.933] -- 0:00:20
683500 -- (-656.426) (-653.212) (-656.272) [-654.806] * (-655.550) (-657.155) [-653.945] (-654.465) -- 0:00:20
684000 -- (-653.204) (-658.444) (-652.920) [-655.034] * (-655.370) (-660.235) [-655.342] (-654.532) -- 0:00:20
684500 -- [-653.844] (-657.185) (-660.723) (-655.925) * (-656.616) (-658.805) (-660.051) [-653.721] -- 0:00:20
685000 -- (-653.443) (-655.144) [-653.397] (-653.411) * [-654.055] (-653.630) (-658.698) (-654.086) -- 0:00:20
Average standard deviation of split frequencies: 0.009257
685500 -- (-654.818) [-654.456] (-653.009) (-656.308) * [-654.565] (-654.053) (-656.112) (-655.244) -- 0:00:20
686000 -- (-654.534) [-653.942] (-655.090) (-657.424) * [-656.208] (-654.208) (-653.690) (-654.373) -- 0:00:20
686500 -- (-657.109) (-655.185) [-654.299] (-654.669) * (-654.146) (-653.648) (-655.714) [-655.428] -- 0:00:20
687000 -- (-653.561) (-654.296) (-659.466) [-653.246] * (-655.330) (-655.460) [-654.308] (-656.510) -- 0:00:20
687500 -- [-655.897] (-657.448) (-661.228) (-653.057) * [-653.504] (-654.529) (-653.862) (-652.925) -- 0:00:20
688000 -- [-654.058] (-653.511) (-653.415) (-655.157) * (-654.504) [-653.772] (-655.845) (-655.060) -- 0:00:20
688500 -- (-657.672) [-653.625] (-653.555) (-654.147) * (-657.122) (-653.692) [-653.521] (-654.459) -- 0:00:20
689000 -- (-654.815) [-655.183] (-657.004) (-657.559) * (-660.968) (-655.158) [-654.760] (-654.307) -- 0:00:20
689500 -- [-656.003] (-656.206) (-653.486) (-656.235) * [-655.987] (-658.343) (-655.397) (-654.956) -- 0:00:20
690000 -- [-653.059] (-655.341) (-655.915) (-659.132) * (-653.783) (-656.870) [-654.758] (-654.125) -- 0:00:20
Average standard deviation of split frequencies: 0.009796
690500 -- (-653.297) (-655.299) [-656.588] (-663.461) * (-653.516) (-656.789) [-655.767] (-653.198) -- 0:00:20
691000 -- (-655.825) (-656.887) [-654.434] (-657.322) * [-657.789] (-654.936) (-658.005) (-655.150) -- 0:00:20
691500 -- (-658.287) (-657.281) [-658.612] (-654.473) * (-654.506) [-653.916] (-653.818) (-654.973) -- 0:00:20
692000 -- (-654.248) [-654.681] (-658.561) (-655.015) * (-653.052) (-658.033) [-655.391] (-654.733) -- 0:00:20
692500 -- (-654.511) (-659.016) [-656.916] (-654.999) * (-659.445) (-655.796) (-656.643) [-654.596] -- 0:00:19
693000 -- (-657.727) [-655.853] (-655.801) (-661.166) * [-653.808] (-655.652) (-654.551) (-656.249) -- 0:00:19
693500 -- (-656.296) (-660.649) [-655.728] (-654.758) * (-653.454) [-655.263] (-656.042) (-655.026) -- 0:00:19
694000 -- [-655.213] (-654.841) (-655.608) (-655.310) * [-655.100] (-659.017) (-661.333) (-653.745) -- 0:00:19
694500 -- (-653.719) (-653.952) [-654.951] (-656.448) * (-655.402) (-660.313) (-657.652) [-657.559] -- 0:00:19
695000 -- (-654.923) [-654.454] (-655.763) (-655.037) * [-655.819] (-655.186) (-656.223) (-653.596) -- 0:00:19
Average standard deviation of split frequencies: 0.009084
695500 -- (-653.941) [-653.128] (-655.630) (-656.431) * [-655.793] (-655.991) (-656.797) (-653.192) -- 0:00:19
696000 -- (-654.731) (-658.265) [-657.420] (-655.072) * [-654.097] (-655.744) (-659.619) (-654.302) -- 0:00:19
696500 -- (-654.910) (-655.492) [-654.704] (-654.093) * (-653.896) [-654.962] (-655.197) (-656.118) -- 0:00:19
697000 -- (-658.489) (-654.157) [-657.990] (-653.903) * (-653.487) (-655.883) (-653.619) [-653.206] -- 0:00:19
697500 -- (-658.958) (-655.939) [-654.580] (-653.644) * (-655.919) (-660.610) (-653.410) [-655.225] -- 0:00:19
698000 -- [-655.024] (-655.593) (-655.275) (-653.441) * (-656.743) (-661.937) [-657.535] (-655.875) -- 0:00:19
698500 -- (-656.091) (-654.974) [-653.746] (-654.637) * (-658.814) (-653.986) [-655.909] (-654.413) -- 0:00:19
699000 -- [-653.312] (-655.766) (-656.330) (-656.877) * [-653.910] (-658.616) (-653.211) (-655.984) -- 0:00:19
699500 -- (-654.919) (-654.941) (-656.312) [-653.688] * (-656.024) [-657.441] (-655.254) (-655.727) -- 0:00:19
700000 -- (-654.053) [-654.200] (-654.725) (-655.832) * (-653.360) [-657.414] (-653.962) (-655.484) -- 0:00:19
Average standard deviation of split frequencies: 0.008430
700500 -- [-653.757] (-656.282) (-654.021) (-656.456) * [-653.100] (-659.429) (-656.844) (-654.329) -- 0:00:19
701000 -- [-654.099] (-656.758) (-654.766) (-654.528) * (-656.591) [-653.443] (-652.693) (-655.075) -- 0:00:19
701500 -- (-656.060) (-654.956) (-655.430) [-655.871] * (-659.442) (-653.550) (-653.651) [-655.233] -- 0:00:19
702000 -- (-655.523) (-657.987) (-653.705) [-655.530] * (-659.864) (-652.832) (-653.994) [-653.581] -- 0:00:19
702500 -- [-655.625] (-656.711) (-655.363) (-656.604) * [-655.891] (-652.746) (-657.189) (-653.543) -- 0:00:19
703000 -- (-655.502) (-653.026) [-654.899] (-654.275) * (-653.745) (-653.988) (-653.301) [-653.775] -- 0:00:19
703500 -- (-654.777) (-656.695) [-654.505] (-653.048) * (-655.936) (-653.826) [-654.313] (-653.859) -- 0:00:19
704000 -- (-660.166) (-656.107) [-653.409] (-657.481) * [-653.618] (-654.196) (-654.819) (-655.414) -- 0:00:19
704500 -- [-655.031] (-653.808) (-655.348) (-655.254) * (-654.537) (-655.399) [-655.423] (-654.742) -- 0:00:19
705000 -- (-657.129) (-654.517) [-657.444] (-654.911) * (-653.933) [-657.136] (-653.153) (-655.506) -- 0:00:19
Average standard deviation of split frequencies: 0.008903
705500 -- (-656.219) (-655.661) [-653.496] (-657.634) * (-659.362) (-655.149) [-654.399] (-659.014) -- 0:00:19
706000 -- [-653.443] (-655.381) (-655.170) (-656.136) * (-653.127) (-656.694) (-657.586) [-653.222] -- 0:00:19
706500 -- (-658.508) [-655.239] (-655.436) (-656.070) * (-653.844) (-654.239) (-654.981) [-655.317] -- 0:00:19
707000 -- (-656.478) (-655.189) [-655.064] (-653.898) * [-654.905] (-653.042) (-655.104) (-655.857) -- 0:00:19
707500 -- (-657.787) [-653.747] (-654.387) (-653.355) * (-654.472) [-653.043] (-653.706) (-655.402) -- 0:00:19
708000 -- [-657.072] (-655.503) (-656.329) (-657.268) * (-655.943) (-653.227) [-653.361] (-657.830) -- 0:00:18
708500 -- (-655.363) (-653.628) (-657.715) [-655.633] * (-656.619) (-656.299) (-652.909) [-656.799] -- 0:00:18
709000 -- (-658.942) [-654.403] (-656.668) (-659.474) * (-655.188) (-655.766) [-652.932] (-655.350) -- 0:00:18
709500 -- [-654.289] (-655.984) (-655.400) (-657.884) * [-654.004] (-654.784) (-659.386) (-653.178) -- 0:00:18
710000 -- [-654.776] (-653.357) (-656.093) (-655.330) * (-653.660) (-657.729) [-660.285] (-654.871) -- 0:00:18
Average standard deviation of split frequencies: 0.009029
710500 -- (-656.636) [-658.510] (-655.763) (-661.184) * (-655.987) [-654.355] (-654.887) (-653.422) -- 0:00:18
711000 -- (-655.174) (-657.382) [-654.742] (-653.360) * [-657.219] (-654.414) (-653.842) (-654.077) -- 0:00:18
711500 -- (-653.665) (-658.514) [-658.221] (-660.325) * (-659.935) [-653.823] (-653.148) (-655.049) -- 0:00:18
712000 -- (-657.207) [-655.310] (-654.842) (-661.722) * (-658.946) (-653.538) (-655.515) [-656.126] -- 0:00:18
712500 -- (-655.256) [-653.253] (-658.829) (-655.911) * (-653.297) [-656.779] (-654.277) (-653.301) -- 0:00:18
713000 -- (-656.817) (-654.976) (-653.565) [-655.964] * (-656.389) [-656.244] (-653.477) (-653.637) -- 0:00:18
713500 -- (-654.545) (-654.015) (-659.573) [-657.585] * (-658.517) (-656.421) [-654.257] (-655.002) -- 0:00:18
714000 -- (-659.413) (-653.313) (-656.682) [-653.950] * (-654.133) (-653.883) [-653.529] (-653.992) -- 0:00:18
714500 -- (-657.700) [-653.616] (-655.243) (-654.033) * (-657.298) (-658.012) [-653.790] (-655.075) -- 0:00:18
715000 -- (-654.132) (-656.338) (-654.565) [-653.213] * (-655.619) (-656.705) [-654.430] (-655.330) -- 0:00:18
Average standard deviation of split frequencies: 0.008888
715500 -- (-655.764) (-655.795) (-656.343) [-654.710] * (-653.758) [-654.269] (-654.978) (-658.443) -- 0:00:18
716000 -- (-656.690) (-654.076) [-658.142] (-656.367) * (-655.028) (-654.572) [-653.157] (-657.458) -- 0:00:18
716500 -- (-657.518) (-652.619) (-659.076) [-653.631] * [-653.456] (-656.490) (-655.061) (-653.725) -- 0:00:18
717000 -- (-656.184) (-658.420) [-658.642] (-654.626) * (-655.800) (-655.905) (-653.726) [-657.239] -- 0:00:18
717500 -- (-655.262) (-656.908) [-657.751] (-654.614) * (-653.854) [-655.970] (-655.507) (-653.918) -- 0:00:18
718000 -- [-653.195] (-659.994) (-655.164) (-652.921) * (-657.406) (-654.445) (-654.535) [-653.780] -- 0:00:18
718500 -- (-653.121) [-656.852] (-654.445) (-652.887) * (-655.187) (-657.930) [-654.249] (-655.808) -- 0:00:18
719000 -- (-654.315) (-653.848) [-654.643] (-657.997) * (-653.016) [-653.280] (-653.700) (-653.225) -- 0:00:18
719500 -- (-653.092) (-654.541) [-653.580] (-653.519) * [-654.458] (-654.806) (-655.214) (-656.733) -- 0:00:18
720000 -- (-654.477) (-655.988) [-653.495] (-653.227) * (-657.187) [-655.286] (-656.891) (-656.029) -- 0:00:18
Average standard deviation of split frequencies: 0.008273
720500 -- [-654.200] (-653.827) (-655.912) (-656.453) * (-653.329) (-654.774) (-657.212) [-656.256] -- 0:00:18
721000 -- (-654.613) [-655.749] (-653.179) (-655.345) * (-654.406) [-656.325] (-656.305) (-654.218) -- 0:00:18
721500 -- (-654.475) (-655.919) [-656.239] (-658.958) * (-655.123) (-658.673) (-655.917) [-656.762] -- 0:00:18
722000 -- (-655.757) (-656.521) [-653.451] (-653.331) * [-655.612] (-658.459) (-654.637) (-654.248) -- 0:00:18
722500 -- [-656.865] (-657.341) (-653.066) (-654.820) * (-655.176) (-657.962) [-654.371] (-653.758) -- 0:00:18
723000 -- (-659.682) (-657.843) (-654.804) [-653.627] * (-654.787) (-654.699) (-653.871) [-657.503] -- 0:00:18
723500 -- (-654.353) [-656.723] (-656.331) (-655.822) * (-656.966) (-655.403) [-654.790] (-659.139) -- 0:00:17
724000 -- (-660.291) [-655.802] (-656.749) (-656.760) * (-654.734) (-655.956) [-653.032] (-656.117) -- 0:00:17
724500 -- (-657.759) (-655.121) (-655.622) [-655.208] * (-654.565) [-655.048] (-653.576) (-656.550) -- 0:00:17
725000 -- (-655.540) (-654.574) [-658.682] (-654.264) * (-654.837) (-654.932) (-656.753) [-653.812] -- 0:00:17
Average standard deviation of split frequencies: 0.008982
725500 -- (-655.850) (-653.286) [-653.733] (-653.354) * (-657.203) (-660.412) [-653.184] (-655.547) -- 0:00:17
726000 -- (-656.623) (-653.642) [-653.386] (-654.446) * (-653.788) (-658.017) (-658.174) [-654.358] -- 0:00:17
726500 -- [-653.810] (-655.307) (-656.039) (-654.059) * (-655.389) (-661.454) (-655.637) [-657.034] -- 0:00:17
727000 -- [-654.079] (-655.984) (-656.331) (-655.065) * (-654.277) (-652.758) [-654.169] (-658.587) -- 0:00:17
727500 -- [-654.064] (-657.560) (-655.427) (-655.260) * (-653.947) (-655.394) [-653.246] (-657.459) -- 0:00:17
728000 -- (-660.138) (-654.809) [-656.300] (-656.880) * (-654.245) (-653.545) [-655.821] (-654.553) -- 0:00:17
728500 -- (-657.688) [-652.824] (-655.584) (-657.022) * (-658.905) (-654.973) (-657.891) [-655.515] -- 0:00:17
729000 -- [-653.161] (-653.952) (-655.064) (-654.691) * [-655.414] (-653.175) (-656.770) (-654.612) -- 0:00:17
729500 -- (-654.204) (-653.503) (-654.606) [-656.511] * [-653.256] (-653.644) (-656.686) (-655.660) -- 0:00:17
730000 -- (-655.470) [-655.238] (-657.320) (-654.461) * (-655.444) (-652.883) (-654.731) [-654.059] -- 0:00:17
Average standard deviation of split frequencies: 0.009068
730500 -- (-654.843) (-655.840) (-653.287) [-654.711] * (-653.660) (-653.492) [-656.027] (-655.678) -- 0:00:17
731000 -- (-654.918) (-653.288) (-654.986) [-653.861] * (-654.106) [-655.885] (-656.136) (-653.865) -- 0:00:17
731500 -- [-656.399] (-654.408) (-658.335) (-654.032) * (-655.324) (-654.554) (-655.041) [-654.962] -- 0:00:17
732000 -- (-654.437) [-654.107] (-655.822) (-653.927) * (-652.740) [-653.589] (-655.180) (-654.126) -- 0:00:17
732500 -- (-654.246) (-657.386) [-655.730] (-653.923) * (-654.587) (-654.298) (-656.084) [-653.382] -- 0:00:17
733000 -- (-655.033) [-655.477] (-655.259) (-652.811) * (-653.355) (-656.812) (-654.176) [-657.154] -- 0:00:17
733500 -- [-653.508] (-653.179) (-655.458) (-655.061) * (-653.775) [-655.747] (-653.170) (-659.151) -- 0:00:17
734000 -- (-655.293) [-653.618] (-655.150) (-655.579) * (-654.457) (-654.562) (-656.775) [-654.361] -- 0:00:17
734500 -- [-656.928] (-655.601) (-653.594) (-653.788) * [-653.735] (-657.646) (-655.861) (-655.073) -- 0:00:17
735000 -- (-656.393) [-656.000] (-653.578) (-653.444) * [-653.909] (-655.135) (-652.960) (-658.395) -- 0:00:17
Average standard deviation of split frequencies: 0.009430
735500 -- (-654.011) (-658.264) (-659.335) [-654.078] * (-654.819) (-655.353) (-653.365) [-655.035] -- 0:00:17
736000 -- (-655.432) (-655.120) (-657.202) [-653.194] * (-655.930) [-656.851] (-655.516) (-653.881) -- 0:00:17
736500 -- (-655.560) (-656.007) (-659.888) [-655.411] * (-655.128) (-655.072) (-656.498) [-654.029] -- 0:00:17
737000 -- (-654.657) [-653.816] (-655.516) (-656.961) * (-655.758) [-654.979] (-653.857) (-654.416) -- 0:00:17
737500 -- (-655.578) (-654.124) [-657.532] (-653.051) * [-654.139] (-655.527) (-653.329) (-653.532) -- 0:00:17
738000 -- (-655.082) [-653.523] (-659.544) (-654.705) * (-654.429) (-659.351) [-655.144] (-656.104) -- 0:00:17
738500 -- (-656.219) (-658.491) [-656.015] (-656.672) * (-658.839) (-653.594) [-654.311] (-652.567) -- 0:00:16
739000 -- [-656.501] (-656.917) (-654.575) (-654.389) * [-654.605] (-654.346) (-653.420) (-655.014) -- 0:00:16
739500 -- (-656.190) (-653.958) (-653.582) [-655.650] * (-657.072) (-654.162) [-653.322] (-655.385) -- 0:00:16
740000 -- (-656.013) (-655.366) (-653.887) [-654.668] * (-656.289) (-657.661) [-653.188] (-654.054) -- 0:00:16
Average standard deviation of split frequencies: 0.009547
740500 -- (-655.288) [-653.462] (-653.896) (-655.908) * (-656.368) (-657.388) (-653.779) [-655.515] -- 0:00:16
741000 -- (-656.136) (-654.130) [-654.792] (-657.081) * (-656.466) (-653.380) [-652.916] (-657.050) -- 0:00:16
741500 -- (-653.700) (-654.073) (-654.873) [-655.810] * (-656.557) [-653.346] (-653.136) (-658.465) -- 0:00:16
742000 -- [-654.283] (-657.207) (-653.358) (-653.969) * (-655.524) [-654.761] (-653.531) (-654.858) -- 0:00:16
742500 -- (-654.854) (-657.161) (-654.998) [-653.399] * (-655.108) (-654.271) (-660.428) [-655.862] -- 0:00:16
743000 -- [-653.432] (-657.914) (-659.864) (-658.209) * [-654.919] (-661.861) (-656.711) (-656.168) -- 0:00:16
743500 -- [-655.618] (-663.005) (-656.247) (-657.958) * (-655.722) (-660.358) (-658.840) [-653.186] -- 0:00:16
744000 -- (-653.731) (-655.631) (-656.125) [-654.593] * (-657.105) (-655.382) [-654.934] (-654.667) -- 0:00:16
744500 -- (-654.745) (-657.223) (-656.304) [-654.593] * (-652.697) [-654.059] (-653.654) (-655.113) -- 0:00:16
745000 -- (-654.154) [-660.622] (-657.604) (-655.196) * [-653.371] (-654.870) (-653.640) (-655.636) -- 0:00:16
Average standard deviation of split frequencies: 0.009830
745500 -- (-655.198) [-653.854] (-654.192) (-653.792) * [-655.066] (-655.621) (-655.811) (-659.333) -- 0:00:16
746000 -- (-654.361) [-655.105] (-653.849) (-658.013) * (-655.108) [-658.002] (-656.608) (-656.776) -- 0:00:16
746500 -- (-653.470) [-655.896] (-655.110) (-653.339) * (-655.163) (-657.611) [-655.736] (-655.134) -- 0:00:16
747000 -- (-655.000) [-654.286] (-654.432) (-656.022) * [-656.196] (-655.071) (-658.388) (-656.917) -- 0:00:16
747500 -- [-655.061] (-653.873) (-654.507) (-653.387) * (-654.059) (-657.607) (-654.688) [-655.755] -- 0:00:16
748000 -- [-656.774] (-655.295) (-655.791) (-653.025) * [-654.024] (-655.948) (-654.191) (-654.310) -- 0:00:16
748500 -- (-657.100) (-653.236) [-654.262] (-654.822) * (-654.187) [-654.197] (-653.920) (-657.398) -- 0:00:16
749000 -- (-657.483) (-654.301) (-654.334) [-653.571] * (-653.424) (-654.068) (-654.947) [-654.106] -- 0:00:16
749500 -- [-658.585] (-652.784) (-653.706) (-657.787) * (-656.156) (-656.133) (-653.240) [-653.230] -- 0:00:16
750000 -- (-655.510) (-653.203) (-656.796) [-653.226] * (-656.986) [-654.647] (-655.311) (-654.849) -- 0:00:16
Average standard deviation of split frequencies: 0.009908
750500 -- (-656.002) [-653.740] (-656.111) (-656.353) * (-655.976) (-653.945) [-653.907] (-657.572) -- 0:00:16
751000 -- (-654.745) [-655.845] (-657.075) (-657.074) * (-653.910) (-654.120) [-655.539] (-655.087) -- 0:00:16
751500 -- (-655.189) (-653.116) (-655.060) [-653.856] * (-652.839) (-653.405) [-654.491] (-655.348) -- 0:00:16
752000 -- (-653.299) (-658.795) (-655.275) [-653.948] * (-656.007) (-658.006) (-655.826) [-655.289] -- 0:00:16
752500 -- (-655.438) (-656.517) (-653.407) [-655.582] * (-655.567) [-655.400] (-655.080) (-656.326) -- 0:00:16
753000 -- (-654.905) (-657.234) [-654.661] (-653.855) * (-657.214) (-655.109) (-655.403) [-655.971] -- 0:00:16
753500 -- (-653.197) [-652.903] (-657.258) (-652.943) * (-657.769) [-654.370] (-655.456) (-653.214) -- 0:00:16
754000 -- (-654.562) 