--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:47:08 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/6res/ML1362/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1298.59 -1302.21 2 -1298.60 -1302.37 -------------------------------------- TOTAL -1298.60 -1302.30 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.890307 0.086857 0.353797 1.463774 0.860875 1411.34 1456.17 1.000 r(A<->C){all} 0.168782 0.020702 0.000004 0.457504 0.131405 258.05 281.30 1.004 r(A<->G){all} 0.161899 0.018213 0.000023 0.435417 0.126509 313.61 362.39 1.000 r(A<->T){all} 0.167996 0.021641 0.000031 0.469807 0.126515 144.72 210.87 1.016 r(C<->G){all} 0.169573 0.020031 0.000018 0.454038 0.135228 246.29 253.81 1.026 r(C<->T){all} 0.171178 0.020364 0.000001 0.453531 0.136769 112.42 169.54 1.006 r(G<->T){all} 0.160572 0.019233 0.000189 0.443232 0.125355 149.01 169.82 1.000 pi(A){all} 0.194895 0.000168 0.168027 0.218265 0.194667 1230.80 1365.90 1.000 pi(C){all} 0.296325 0.000223 0.265570 0.323945 0.296177 971.08 1074.05 1.000 pi(G){all} 0.308530 0.000224 0.277460 0.335232 0.308663 1313.46 1333.41 1.000 pi(T){all} 0.200249 0.000169 0.173838 0.224891 0.200536 1141.40 1269.16 1.000 alpha{1,2} 0.418368 0.228368 0.000103 1.398596 0.258876 1064.62 1161.81 1.000 alpha{3} 0.457350 0.236499 0.000155 1.396338 0.301567 1084.45 1133.53 1.000 pinvar{all} 0.998405 0.000003 0.994945 0.999998 0.998992 1203.38 1332.76 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1246.502131 Model 2: PositiveSelection -1246.502111 Model 0: one-ratio -1246.502129 Model 7: beta -1246.502201 Model 8: beta&w>1 -1246.502079 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 3.999999989900971E-5 Model 8 vs 7 2.4399999983870657E-4
>C1 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >C2 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >C3 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >C4 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >C5 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >C6 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=317 C1 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG C2 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG C3 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG C4 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG C5 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG C6 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG ************************************************** C1 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA C2 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA C3 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA C4 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA C5 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA C6 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA ************************************************** C1 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK C2 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK C3 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK C4 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK C5 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK C6 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK ************************************************** C1 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY C2 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY C3 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY C4 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY C5 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY C6 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY ************************************************** C1 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR C2 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR C3 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR C4 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR C5 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR C6 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR ************************************************** C1 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH C2 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH C3 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH C4 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH C5 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH C6 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH ************************************************** C1 TGQYGVGHGATSITVPQ C2 TGQYGVGHGATSITVPQ C3 TGQYGVGHGATSITVPQ C4 TGQYGVGHGATSITVPQ C5 TGQYGVGHGATSITVPQ C6 TGQYGVGHGATSITVPQ ***************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 317 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 317 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [9510] Library Relaxation: Multi_proc [96] Relaxation Summary: [9510]--->[9510] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.511 Mb, Max= 30.882 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG C2 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG C3 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG C4 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG C5 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG C6 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG ************************************************** C1 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA C2 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA C3 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA C4 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA C5 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA C6 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA ************************************************** C1 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK C2 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK C3 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK C4 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK C5 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK C6 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK ************************************************** C1 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY C2 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY C3 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY C4 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY C5 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY C6 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY ************************************************** C1 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR C2 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR C3 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR C4 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR C5 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR C6 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR ************************************************** C1 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH C2 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH C3 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH C4 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH C5 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH C6 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH ************************************************** C1 TGQYGVGHGATSITVPQ C2 TGQYGVGHGATSITVPQ C3 TGQYGVGHGATSITVPQ C4 TGQYGVGHGATSITVPQ C5 TGQYGVGHGATSITVPQ C6 TGQYGVGHGATSITVPQ ***************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC C2 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC C3 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC C4 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC C5 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC C6 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC ************************************************** C1 GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT C2 GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT C3 GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT C4 GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT C5 GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT C6 GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT ************************************************** C1 TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG C2 TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG C3 TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG C4 TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG C5 TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG C6 TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG ************************************************** C1 CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA C2 CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA C3 CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA C4 CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA C5 CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA C6 CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA ************************************************** C1 CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA C2 CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA C3 CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA C4 CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA C5 CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA C6 CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA ************************************************** C1 CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG C2 CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG C3 CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG C4 CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG C5 CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG C6 CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG ************************************************** C1 GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT C2 GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT C3 GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT C4 GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT C5 GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT C6 GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT ************************************************** C1 GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA C2 GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA C3 GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA C4 GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA C5 GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA C6 GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA ************************************************** C1 GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG C2 GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG C3 GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG C4 GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG C5 GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG C6 GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG ************************************************** C1 CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT C2 CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT C3 CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT C4 CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT C5 CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT C6 CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT ************************************************** C1 GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA C2 GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA C3 GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA C4 GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA C5 GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA C6 GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA ************************************************** C1 CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC C2 CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC C3 CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC C4 CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC C5 CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC C6 CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC ************************************************** C1 AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG C2 AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG C3 AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG C4 AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG C5 AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG C6 AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG ************************************************** C1 CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT C2 CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT C3 CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT C4 CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT C5 CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT C6 CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT ************************************************** C1 TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG C2 TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG C3 TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG C4 TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG C5 TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG C6 TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG ************************************************** C1 GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC C2 GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC C3 GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC C4 GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC C5 GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC C6 GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC ************************************************** C1 TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG C2 TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG C3 TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG C4 TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG C5 TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG C6 TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG ************************************************** C1 GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT C2 GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT C3 GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT C4 GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT C5 GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT C6 GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ************************************************** C1 ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA C2 ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA C3 ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA C4 ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA C5 ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA C6 ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA ************************************************** C1 G C2 G C3 G C4 G C5 G C6 G * >C1 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G >C2 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G >C3 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G >C4 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G >C5 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G >C6 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G >C1 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >C2 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >C3 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >C4 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >C5 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >C6 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 951 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579859143 Setting output file names to "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 379291310 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5273140855 Seed = 1179730744 Swapseed = 1579859143 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2128.383592 -- -24.965149 Chain 2 -- -2128.383469 -- -24.965149 Chain 3 -- -2128.383469 -- -24.965149 Chain 4 -- -2128.383592 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2128.383592 -- -24.965149 Chain 2 -- -2128.383592 -- -24.965149 Chain 3 -- -2128.383469 -- -24.965149 Chain 4 -- -2128.383267 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2128.384] (-2128.383) (-2128.383) (-2128.384) * [-2128.384] (-2128.384) (-2128.383) (-2128.383) 500 -- (-1321.970) (-1303.681) [-1306.398] (-1304.921) * (-1304.056) (-1308.728) (-1313.149) [-1308.493] -- 0:00:00 1000 -- (-1315.120) (-1306.226) (-1311.866) [-1304.916] * (-1308.674) [-1309.587] (-1305.035) (-1313.539) -- 0:00:00 1500 -- [-1312.340] (-1309.541) (-1311.557) (-1310.875) * (-1304.412) (-1309.230) (-1306.730) [-1302.496] -- 0:00:00 2000 -- [-1307.111] (-1312.798) (-1313.190) (-1308.325) * (-1309.402) (-1309.273) [-1304.130] (-1307.931) -- 0:00:00 2500 -- (-1307.904) (-1302.542) [-1307.753] (-1303.991) * (-1308.778) (-1308.158) [-1308.748] (-1308.928) -- 0:00:00 3000 -- (-1302.938) [-1316.747] (-1315.905) (-1310.766) * (-1306.087) (-1306.324) [-1307.589] (-1303.423) -- 0:00:00 3500 -- (-1313.097) [-1312.083] (-1308.793) (-1307.933) * [-1308.542] (-1311.038) (-1304.604) (-1308.392) -- 0:00:00 4000 -- (-1307.654) (-1311.604) [-1308.328] (-1311.155) * [-1303.970] (-1307.223) (-1311.028) (-1302.642) -- 0:00:00 4500 -- (-1307.246) (-1311.885) (-1305.614) [-1306.857] * [-1305.455] (-1303.501) (-1309.219) (-1311.974) -- 0:00:00 5000 -- (-1315.905) (-1310.396) (-1303.277) [-1306.913] * (-1311.177) (-1307.793) (-1317.086) [-1301.964] -- 0:00:00 Average standard deviation of split frequencies: 0.071425 5500 -- (-1310.223) [-1303.696] (-1307.505) (-1305.831) * (-1306.599) [-1306.699] (-1305.776) (-1311.374) -- 0:00:00 6000 -- (-1314.110) (-1304.651) (-1312.135) [-1304.377] * (-1304.193) (-1307.599) [-1310.798] (-1310.765) -- 0:00:00 6500 -- (-1310.988) (-1311.132) (-1314.485) [-1306.835] * (-1304.637) [-1305.695] (-1308.589) (-1309.103) -- 0:00:00 7000 -- (-1319.744) (-1309.727) (-1311.304) [-1301.880] * (-1309.715) (-1311.324) (-1307.991) [-1304.240] -- 0:00:00 7500 -- (-1316.099) [-1304.936] (-1307.815) (-1311.731) * (-1303.688) (-1308.544) (-1306.353) [-1312.148] -- 0:00:00 8000 -- (-1310.618) (-1303.576) [-1306.168] (-1306.883) * (-1305.414) (-1306.901) [-1304.628] (-1312.455) -- 0:02:04 8500 -- (-1305.151) (-1311.496) (-1308.259) [-1304.346] * (-1305.903) [-1305.731] (-1310.358) (-1310.371) -- 0:01:56 9000 -- [-1306.802] (-1306.820) (-1311.911) (-1310.760) * (-1311.187) (-1306.395) (-1314.378) [-1304.734] -- 0:01:50 9500 -- [-1305.152] (-1311.789) (-1311.893) (-1307.274) * (-1308.214) [-1308.093] (-1308.765) (-1312.072) -- 0:01:44 10000 -- (-1311.306) [-1310.780] (-1315.196) (-1316.942) * (-1315.777) [-1305.677] (-1312.798) (-1306.731) -- 0:01:39 Average standard deviation of split frequencies: 0.074432 10500 -- (-1314.747) (-1306.199) [-1306.567] (-1306.948) * (-1314.851) (-1303.170) [-1310.266] (-1314.620) -- 0:01:34 11000 -- (-1304.968) (-1314.694) (-1309.960) [-1308.401] * [-1309.004] (-1312.145) (-1308.381) (-1307.249) -- 0:01:29 11500 -- (-1311.032) [-1304.796] (-1316.332) (-1305.229) * (-1309.599) (-1305.392) (-1315.347) [-1306.125] -- 0:01:25 12000 -- (-1313.128) (-1308.737) (-1312.379) [-1300.583] * (-1306.416) (-1307.069) [-1307.568] (-1310.055) -- 0:01:22 12500 -- (-1310.892) (-1305.430) (-1317.652) [-1307.952] * (-1314.883) (-1309.393) [-1310.563] (-1306.054) -- 0:01:19 13000 -- [-1308.104] (-1304.344) (-1318.472) (-1306.096) * (-1305.726) (-1308.024) (-1310.961) [-1305.625] -- 0:01:15 13500 -- (-1307.365) (-1307.136) (-1311.938) [-1302.454] * (-1309.868) (-1306.807) (-1312.433) [-1305.450] -- 0:01:13 14000 -- (-1304.701) [-1310.678] (-1307.517) (-1307.348) * [-1304.155] (-1308.711) (-1309.172) (-1309.677) -- 0:01:10 14500 -- (-1303.826) [-1304.555] (-1307.717) (-1306.586) * (-1305.691) (-1316.307) [-1303.782] (-1312.861) -- 0:01:07 15000 -- (-1307.977) (-1310.267) (-1309.017) [-1302.908] * [-1303.416] (-1303.190) (-1314.613) (-1310.440) -- 0:01:05 Average standard deviation of split frequencies: 0.065473 15500 -- (-1317.879) (-1313.541) [-1307.326] (-1302.211) * (-1304.155) (-1308.275) [-1307.735] (-1319.994) -- 0:01:03 16000 -- (-1322.111) (-1315.353) (-1315.527) [-1308.314] * (-1304.519) [-1306.942] (-1313.728) (-1311.622) -- 0:01:01 16500 -- (-1305.942) (-1308.522) [-1306.654] (-1314.499) * (-1311.836) [-1304.474] (-1307.266) (-1306.931) -- 0:00:59 17000 -- [-1309.013] (-1301.807) (-1309.769) (-1308.414) * (-1305.440) (-1310.197) [-1302.590] (-1310.169) -- 0:00:57 17500 -- (-1313.161) (-1309.422) (-1303.035) [-1313.020] * (-1303.079) (-1305.448) (-1311.478) [-1307.007] -- 0:00:56 18000 -- (-1305.180) (-1305.600) [-1308.765] (-1308.704) * (-1308.368) [-1308.290] (-1309.270) (-1303.369) -- 0:00:54 18500 -- (-1308.072) [-1305.986] (-1328.901) (-1307.064) * (-1309.593) (-1305.200) [-1305.411] (-1305.048) -- 0:00:53 19000 -- [-1308.957] (-1307.085) (-1310.696) (-1301.797) * [-1311.758] (-1305.786) (-1306.502) (-1308.082) -- 0:00:51 19500 -- (-1312.923) (-1304.990) (-1307.524) [-1309.057] * (-1304.220) (-1314.160) [-1310.464] (-1321.741) -- 0:00:50 20000 -- [-1307.352] (-1311.642) (-1312.593) (-1310.064) * (-1309.655) [-1312.633] (-1312.794) (-1299.768) -- 0:00:49 Average standard deviation of split frequencies: 0.043219 20500 -- [-1309.482] (-1308.552) (-1300.118) (-1306.183) * (-1307.012) (-1313.679) [-1310.123] (-1299.910) -- 0:00:47 21000 -- (-1316.803) (-1309.464) (-1299.742) [-1305.340] * (-1313.030) (-1311.241) [-1306.973] (-1300.861) -- 0:00:46 21500 -- (-1309.811) [-1306.670] (-1300.667) (-1313.446) * (-1310.042) (-1311.287) (-1317.221) [-1298.116] -- 0:00:45 22000 -- (-1311.262) [-1305.024] (-1298.984) (-1309.551) * [-1306.211] (-1310.960) (-1312.734) (-1298.390) -- 0:00:44 22500 -- (-1311.658) [-1307.980] (-1303.252) (-1307.432) * (-1314.405) [-1306.157] (-1314.523) (-1301.231) -- 0:00:43 23000 -- [-1309.072] (-1310.539) (-1302.867) (-1311.232) * (-1318.102) [-1306.700] (-1315.239) (-1298.060) -- 0:00:42 23500 -- (-1316.982) (-1305.080) (-1305.104) [-1303.943] * (-1309.449) (-1314.776) (-1310.848) [-1299.518] -- 0:01:23 24000 -- (-1309.921) (-1312.207) [-1297.889] (-1308.107) * (-1307.046) [-1305.653] (-1311.688) (-1298.475) -- 0:01:21 24500 -- (-1312.505) [-1309.047] (-1301.672) (-1308.077) * (-1310.519) (-1311.800) [-1309.277] (-1297.804) -- 0:01:19 25000 -- [-1303.095] (-1306.511) (-1299.613) (-1310.457) * (-1312.660) [-1307.765] (-1309.576) (-1298.221) -- 0:01:18 Average standard deviation of split frequencies: 0.038075 25500 -- (-1305.759) (-1308.786) (-1301.343) [-1302.963] * (-1310.645) (-1307.354) (-1316.513) [-1304.528] -- 0:01:16 26000 -- (-1310.159) [-1311.379] (-1300.887) (-1310.992) * (-1310.395) (-1307.354) [-1310.477] (-1299.475) -- 0:01:14 26500 -- [-1306.885] (-1311.604) (-1304.977) (-1307.092) * (-1308.924) (-1309.036) [-1307.936] (-1299.352) -- 0:01:13 27000 -- (-1314.432) (-1306.667) (-1298.329) [-1302.185] * [-1307.309] (-1312.899) (-1307.285) (-1299.485) -- 0:01:12 27500 -- (-1317.010) (-1306.400) [-1298.117] (-1309.582) * (-1304.820) [-1310.309] (-1310.886) (-1298.927) -- 0:01:10 28000 -- (-1310.505) (-1308.588) (-1301.721) [-1301.345] * (-1309.449) (-1313.278) [-1314.508] (-1299.345) -- 0:01:09 28500 -- (-1300.651) (-1308.030) [-1305.107] (-1311.065) * (-1308.623) (-1316.321) (-1312.034) [-1298.265] -- 0:01:08 29000 -- (-1301.609) (-1315.257) [-1302.319] (-1307.618) * (-1306.119) (-1302.924) (-1311.567) [-1298.526] -- 0:01:06 29500 -- (-1300.753) [-1309.073] (-1304.684) (-1302.791) * [-1311.061] (-1306.388) (-1307.853) (-1298.993) -- 0:01:05 30000 -- (-1301.353) [-1309.053] (-1302.533) (-1306.602) * (-1317.938) (-1311.600) (-1305.172) [-1301.503] -- 0:01:04 Average standard deviation of split frequencies: 0.043920 30500 -- (-1302.652) (-1309.591) (-1301.777) [-1308.563] * (-1304.638) (-1312.667) (-1307.240) [-1299.015] -- 0:01:03 31000 -- (-1300.842) (-1311.209) (-1299.971) [-1307.416] * (-1310.956) (-1308.553) (-1313.671) [-1300.126] -- 0:01:02 31500 -- (-1300.731) [-1313.549] (-1298.236) (-1309.059) * (-1316.786) (-1306.570) [-1309.846] (-1300.284) -- 0:01:01 32000 -- [-1298.803] (-1313.218) (-1298.481) (-1305.967) * (-1310.833) (-1306.077) [-1303.754] (-1304.585) -- 0:01:00 32500 -- (-1301.112) [-1315.150] (-1298.082) (-1303.827) * [-1310.911] (-1314.426) (-1308.698) (-1297.658) -- 0:00:59 33000 -- (-1297.997) [-1305.938] (-1298.335) (-1312.670) * (-1313.121) [-1308.214] (-1303.982) (-1300.303) -- 0:00:58 33500 -- (-1297.692) (-1305.927) (-1298.131) [-1306.702] * (-1310.830) (-1311.130) (-1312.066) [-1298.269] -- 0:00:57 34000 -- (-1299.588) [-1310.173] (-1298.177) (-1316.663) * (-1312.547) [-1311.435] (-1305.513) (-1300.209) -- 0:00:56 34500 -- (-1299.046) [-1304.898] (-1297.735) (-1315.351) * (-1305.639) (-1301.612) [-1309.315] (-1299.845) -- 0:00:55 35000 -- (-1300.215) (-1302.526) [-1297.140] (-1311.886) * (-1304.240) (-1303.013) [-1307.021] (-1297.761) -- 0:00:55 Average standard deviation of split frequencies: 0.043212 35500 -- (-1298.735) [-1304.834] (-1297.490) (-1308.068) * [-1306.076] (-1300.773) (-1311.815) (-1298.521) -- 0:00:54 36000 -- (-1302.440) [-1307.446] (-1299.640) (-1310.785) * (-1311.623) (-1302.293) (-1308.300) [-1300.362] -- 0:00:53 36500 -- (-1299.788) (-1307.702) (-1300.110) [-1309.286] * [-1308.172] (-1303.078) (-1315.819) (-1300.422) -- 0:00:52 37000 -- [-1299.372] (-1317.468) (-1298.916) (-1309.934) * [-1303.985] (-1303.665) (-1309.484) (-1299.594) -- 0:00:52 37500 -- (-1298.526) (-1309.752) [-1299.393] (-1310.540) * (-1304.680) [-1297.767] (-1311.498) (-1299.888) -- 0:00:51 38000 -- [-1298.332] (-1297.687) (-1300.331) (-1308.555) * (-1307.289) (-1298.007) [-1304.284] (-1298.726) -- 0:00:50 38500 -- [-1297.913] (-1297.888) (-1299.828) (-1310.994) * [-1305.027] (-1298.931) (-1308.799) (-1298.369) -- 0:00:49 39000 -- (-1297.052) (-1301.955) (-1300.409) [-1304.717] * [-1304.225] (-1298.938) (-1310.469) (-1299.807) -- 0:01:13 39500 -- (-1297.341) [-1298.688] (-1299.261) (-1310.721) * (-1311.529) [-1298.007] (-1310.248) (-1300.474) -- 0:01:12 40000 -- (-1297.490) (-1297.989) [-1300.347] (-1304.801) * (-1308.275) [-1298.388] (-1317.105) (-1304.434) -- 0:01:12 Average standard deviation of split frequencies: 0.043927 40500 -- (-1297.392) (-1299.514) (-1298.827) [-1306.565] * [-1315.948] (-1298.474) (-1317.562) (-1300.090) -- 0:01:11 41000 -- [-1302.014] (-1301.910) (-1301.126) (-1306.684) * (-1305.421) (-1300.534) [-1302.897] (-1298.867) -- 0:01:10 41500 -- (-1301.216) (-1298.568) [-1297.144] (-1317.744) * (-1307.708) [-1297.989] (-1307.820) (-1299.817) -- 0:01:09 42000 -- (-1301.716) (-1297.758) [-1297.193] (-1319.052) * (-1305.499) [-1299.942] (-1311.095) (-1301.256) -- 0:01:08 42500 -- [-1297.792] (-1298.595) (-1297.849) (-1312.155) * (-1313.828) [-1298.624] (-1313.470) (-1299.305) -- 0:01:07 43000 -- [-1299.434] (-1297.497) (-1301.396) (-1314.268) * (-1316.956) (-1305.362) (-1316.877) [-1299.137] -- 0:01:06 43500 -- (-1300.138) [-1298.063] (-1299.640) (-1307.493) * [-1303.392] (-1299.337) (-1319.695) (-1299.817) -- 0:01:05 44000 -- (-1298.783) (-1299.611) (-1299.615) [-1305.208] * (-1298.603) (-1299.322) (-1312.482) [-1298.804] -- 0:01:05 44500 -- (-1298.298) [-1297.598] (-1301.505) (-1310.331) * [-1297.936] (-1302.774) (-1309.054) (-1299.664) -- 0:01:04 45000 -- [-1298.762] (-1304.379) (-1297.531) (-1317.586) * (-1300.851) (-1305.388) (-1305.048) [-1298.789] -- 0:01:03 Average standard deviation of split frequencies: 0.035868 45500 -- (-1301.070) [-1303.248] (-1298.504) (-1300.912) * (-1298.573) (-1299.818) (-1318.520) [-1298.679] -- 0:01:02 46000 -- (-1300.212) (-1300.362) [-1298.774] (-1301.274) * (-1301.941) (-1298.380) [-1301.158] (-1297.931) -- 0:01:02 46500 -- (-1298.346) (-1298.276) [-1297.410] (-1298.289) * (-1304.411) (-1300.981) [-1306.581] (-1298.350) -- 0:01:01 47000 -- (-1300.961) [-1298.756] (-1297.247) (-1298.468) * [-1299.705] (-1301.713) (-1304.588) (-1299.587) -- 0:01:00 47500 -- (-1301.168) (-1298.882) (-1297.256) [-1298.630] * (-1297.619) (-1299.910) (-1318.508) [-1298.645] -- 0:01:00 48000 -- (-1298.196) (-1298.943) [-1299.021] (-1298.744) * [-1298.332] (-1300.695) (-1302.559) (-1300.061) -- 0:00:59 48500 -- (-1299.229) [-1297.118] (-1298.073) (-1299.518) * (-1299.179) (-1300.675) [-1297.608] (-1301.043) -- 0:00:58 49000 -- (-1301.635) [-1297.136] (-1302.538) (-1300.952) * [-1298.223] (-1298.102) (-1297.970) (-1299.015) -- 0:00:58 49500 -- (-1299.522) (-1297.078) [-1300.027] (-1297.327) * (-1299.930) (-1299.446) [-1298.661] (-1298.749) -- 0:00:57 50000 -- (-1299.882) [-1297.995] (-1299.086) (-1297.957) * (-1301.573) [-1299.604] (-1298.584) (-1297.282) -- 0:00:57 Average standard deviation of split frequencies: 0.030238 50500 -- (-1299.324) (-1298.418) (-1298.490) [-1297.740] * (-1301.524) [-1298.001] (-1298.817) (-1297.594) -- 0:00:56 51000 -- (-1302.474) (-1300.392) (-1298.436) [-1299.887] * [-1298.507] (-1299.034) (-1298.636) (-1297.724) -- 0:00:55 51500 -- (-1299.415) [-1300.192] (-1300.731) (-1300.476) * (-1300.278) (-1301.875) (-1302.889) [-1297.397] -- 0:00:55 52000 -- (-1299.875) (-1302.046) (-1301.349) [-1298.698] * (-1297.652) (-1298.624) (-1299.146) [-1297.934] -- 0:00:54 52500 -- (-1300.410) (-1302.143) (-1299.916) [-1298.309] * [-1298.053] (-1298.824) (-1298.750) (-1297.916) -- 0:00:54 53000 -- [-1301.301] (-1300.026) (-1299.182) (-1299.290) * (-1297.915) [-1300.440] (-1299.108) (-1297.934) -- 0:00:53 53500 -- (-1298.543) (-1302.100) (-1300.510) [-1299.110] * (-1300.656) (-1299.682) (-1301.106) [-1297.453] -- 0:00:53 54000 -- (-1298.838) (-1300.881) (-1298.504) [-1298.758] * (-1299.595) [-1299.407] (-1298.567) (-1303.108) -- 0:01:10 54500 -- (-1298.963) [-1300.253] (-1300.060) (-1300.079) * [-1300.551] (-1300.153) (-1298.431) (-1298.645) -- 0:01:09 55000 -- [-1299.884] (-1300.585) (-1298.797) (-1298.019) * (-1302.231) (-1298.744) [-1298.258] (-1299.665) -- 0:01:08 Average standard deviation of split frequencies: 0.024786 55500 -- (-1299.336) (-1298.902) (-1301.850) [-1301.098] * (-1300.824) (-1302.929) [-1298.258] (-1300.396) -- 0:01:08 56000 -- (-1299.411) [-1299.209] (-1298.187) (-1301.112) * (-1303.517) (-1300.469) (-1298.798) [-1300.230] -- 0:01:07 56500 -- (-1297.856) [-1298.130] (-1298.804) (-1298.113) * [-1302.003] (-1300.614) (-1301.116) (-1299.080) -- 0:01:06 57000 -- (-1296.957) (-1297.502) (-1297.809) [-1298.757] * (-1302.184) (-1300.036) [-1300.603] (-1299.384) -- 0:01:06 57500 -- (-1299.932) (-1298.167) (-1299.439) [-1298.772] * (-1301.082) (-1300.734) (-1298.772) [-1300.014] -- 0:01:05 58000 -- (-1300.986) [-1298.806] (-1300.248) (-1298.688) * (-1305.789) (-1298.449) [-1300.540] (-1298.863) -- 0:01:04 58500 -- (-1299.932) (-1301.275) (-1300.251) [-1300.268] * (-1301.444) (-1298.771) (-1300.414) [-1299.156] -- 0:01:04 59000 -- (-1299.260) [-1299.341] (-1298.655) (-1300.793) * (-1301.645) (-1300.370) [-1298.215] (-1306.776) -- 0:01:03 59500 -- [-1301.006] (-1297.831) (-1297.305) (-1300.737) * [-1298.627] (-1299.269) (-1298.649) (-1300.081) -- 0:01:03 60000 -- (-1300.510) [-1298.476] (-1297.628) (-1297.924) * (-1299.005) (-1299.255) [-1297.448] (-1299.963) -- 0:01:02 Average standard deviation of split frequencies: 0.026174 60500 -- (-1298.885) [-1299.282] (-1300.604) (-1298.863) * (-1298.713) (-1297.167) [-1298.169] (-1301.463) -- 0:01:02 61000 -- (-1298.267) (-1299.397) (-1306.169) [-1299.013] * [-1298.083] (-1297.386) (-1297.811) (-1301.209) -- 0:01:01 61500 -- (-1298.487) [-1298.404] (-1301.974) (-1299.231) * (-1298.023) (-1298.902) (-1304.458) [-1304.514] -- 0:01:01 62000 -- [-1299.045] (-1298.607) (-1306.220) (-1302.128) * (-1299.431) [-1301.180] (-1302.087) (-1304.261) -- 0:01:00 62500 -- [-1298.130] (-1300.496) (-1302.067) (-1299.663) * (-1298.559) (-1300.391) (-1303.582) [-1299.134] -- 0:01:00 63000 -- (-1298.422) (-1301.168) (-1298.462) [-1300.627] * (-1298.438) (-1301.096) (-1304.385) [-1298.570] -- 0:00:59 63500 -- (-1301.151) [-1297.731] (-1300.139) (-1299.822) * (-1305.231) [-1298.466] (-1303.152) (-1298.320) -- 0:00:58 64000 -- (-1298.368) (-1297.896) (-1300.190) [-1297.456] * (-1308.528) (-1303.831) [-1303.097] (-1298.599) -- 0:00:58 64500 -- (-1300.414) (-1298.816) (-1301.551) [-1300.661] * (-1299.556) [-1301.805] (-1299.307) (-1301.686) -- 0:00:58 65000 -- [-1298.616] (-1300.826) (-1299.620) (-1302.055) * [-1301.194] (-1298.477) (-1302.894) (-1302.800) -- 0:00:57 Average standard deviation of split frequencies: 0.026070 65500 -- (-1299.081) (-1299.297) [-1299.382] (-1297.243) * [-1298.932] (-1298.546) (-1297.933) (-1307.190) -- 0:00:57 66000 -- (-1300.641) (-1300.137) (-1298.416) [-1301.444] * [-1298.572] (-1298.307) (-1298.263) (-1298.421) -- 0:00:56 66500 -- (-1299.537) (-1301.665) [-1299.013] (-1301.658) * (-1300.133) (-1297.594) (-1298.155) [-1299.219] -- 0:00:56 67000 -- [-1298.718] (-1299.329) (-1302.318) (-1298.115) * (-1299.849) [-1298.377] (-1299.284) (-1299.714) -- 0:00:55 67500 -- (-1297.044) (-1299.345) (-1300.930) [-1298.113] * (-1298.227) (-1297.251) (-1298.581) [-1303.302] -- 0:00:55 68000 -- [-1297.331] (-1300.151) (-1302.522) (-1300.868) * [-1297.660] (-1298.222) (-1298.706) (-1302.408) -- 0:00:54 68500 -- [-1297.079] (-1299.204) (-1305.863) (-1302.345) * [-1297.742] (-1297.841) (-1300.249) (-1301.342) -- 0:00:54 69000 -- (-1297.272) (-1301.088) [-1305.785] (-1301.338) * [-1297.749] (-1297.535) (-1304.974) (-1300.391) -- 0:00:53 69500 -- (-1297.994) (-1298.844) [-1298.370] (-1302.561) * (-1299.943) (-1298.860) (-1297.906) [-1299.482] -- 0:00:53 70000 -- [-1297.466] (-1301.255) (-1297.877) (-1299.917) * (-1299.925) (-1300.154) (-1298.866) [-1301.481] -- 0:00:53 Average standard deviation of split frequencies: 0.026366 70500 -- (-1297.241) (-1300.740) (-1297.733) [-1300.512] * (-1298.518) (-1299.006) [-1297.868] (-1299.041) -- 0:01:05 71000 -- [-1297.290] (-1300.516) (-1297.779) (-1305.086) * [-1300.770] (-1299.406) (-1301.092) (-1299.265) -- 0:01:05 71500 -- (-1297.845) (-1300.084) [-1299.093] (-1300.257) * (-1300.489) (-1298.142) (-1298.239) [-1298.782] -- 0:01:04 72000 -- (-1297.877) (-1301.252) (-1297.915) [-1298.514] * (-1299.602) (-1300.608) (-1302.700) [-1298.407] -- 0:01:04 72500 -- (-1299.737) (-1297.529) [-1302.609] (-1298.725) * [-1297.935] (-1298.893) (-1299.308) (-1297.987) -- 0:01:03 73000 -- (-1297.401) [-1299.497] (-1298.849) (-1298.724) * (-1299.477) [-1302.842] (-1298.914) (-1302.284) -- 0:01:03 73500 -- (-1297.383) (-1303.692) [-1298.712] (-1298.786) * [-1299.246] (-1301.531) (-1298.078) (-1299.698) -- 0:01:03 74000 -- (-1297.375) (-1299.611) (-1298.827) [-1298.800] * [-1299.482] (-1299.651) (-1299.121) (-1300.287) -- 0:01:02 74500 -- [-1298.294] (-1300.278) (-1298.979) (-1298.111) * [-1298.721] (-1304.444) (-1298.730) (-1299.725) -- 0:01:02 75000 -- (-1298.527) (-1298.866) [-1300.705] (-1299.701) * (-1298.580) (-1298.570) (-1300.055) [-1297.400] -- 0:01:01 Average standard deviation of split frequencies: 0.028532 75500 -- (-1298.762) (-1300.306) (-1302.832) [-1297.539] * (-1301.737) (-1298.246) (-1299.122) [-1297.415] -- 0:01:01 76000 -- (-1302.180) (-1298.024) [-1300.079] (-1297.638) * (-1299.279) (-1303.123) [-1299.286] (-1299.612) -- 0:01:00 76500 -- (-1299.021) (-1299.088) [-1298.731] (-1298.503) * (-1298.412) (-1300.347) [-1298.754] (-1299.924) -- 0:01:00 77000 -- (-1299.037) (-1299.688) [-1299.018] (-1297.741) * (-1300.546) [-1299.602] (-1302.724) (-1300.085) -- 0:00:59 77500 -- (-1297.606) [-1300.598] (-1299.135) (-1299.978) * (-1298.808) (-1298.201) (-1303.310) [-1299.433] -- 0:00:59 78000 -- (-1299.756) (-1299.702) (-1298.512) [-1298.488] * [-1298.973] (-1299.497) (-1299.935) (-1298.429) -- 0:00:59 78500 -- (-1301.676) [-1298.953] (-1302.420) (-1299.238) * [-1299.264] (-1297.943) (-1299.060) (-1300.077) -- 0:00:58 79000 -- [-1298.400] (-1299.208) (-1297.880) (-1299.339) * (-1299.708) (-1297.701) (-1297.765) [-1298.781] -- 0:00:58 79500 -- (-1303.945) (-1298.739) (-1298.659) [-1299.077] * (-1299.304) [-1298.768] (-1297.587) (-1298.156) -- 0:00:57 80000 -- (-1305.290) (-1298.854) (-1298.688) [-1297.780] * (-1299.853) (-1298.603) [-1297.542] (-1298.135) -- 0:00:57 Average standard deviation of split frequencies: 0.026451 80500 -- (-1302.509) [-1298.215] (-1297.782) (-1303.018) * (-1301.848) (-1298.013) (-1299.141) [-1297.767] -- 0:00:57 81000 -- (-1297.475) (-1299.921) [-1299.874] (-1299.597) * (-1299.120) (-1298.113) (-1298.235) [-1297.357] -- 0:00:56 81500 -- [-1298.272] (-1299.554) (-1306.243) (-1300.631) * (-1298.919) [-1299.546] (-1301.505) (-1299.448) -- 0:00:56 82000 -- [-1298.618] (-1298.215) (-1304.811) (-1300.005) * [-1299.541] (-1300.575) (-1301.194) (-1300.142) -- 0:00:55 82500 -- (-1298.814) (-1299.029) (-1300.726) [-1299.297] * (-1298.991) (-1300.409) [-1299.457] (-1299.778) -- 0:00:55 83000 -- [-1297.690] (-1299.326) (-1300.597) (-1303.117) * [-1297.336] (-1300.144) (-1299.762) (-1301.677) -- 0:00:55 83500 -- [-1297.088] (-1300.825) (-1301.796) (-1298.725) * (-1298.440) (-1299.592) (-1299.799) [-1302.956] -- 0:00:54 84000 -- (-1297.088) (-1300.196) [-1299.314] (-1298.932) * [-1298.022] (-1298.378) (-1298.470) (-1298.346) -- 0:00:54 84500 -- (-1297.822) [-1299.329] (-1301.731) (-1299.721) * (-1297.939) (-1299.968) (-1298.470) [-1298.070] -- 0:00:54 85000 -- [-1297.928] (-1300.070) (-1301.996) (-1302.303) * (-1301.248) (-1299.940) (-1300.448) [-1298.210] -- 0:00:53 Average standard deviation of split frequencies: 0.026859 85500 -- [-1297.320] (-1298.591) (-1304.672) (-1298.144) * (-1301.185) [-1299.208] (-1300.038) (-1298.392) -- 0:00:53 86000 -- (-1298.081) [-1301.507] (-1298.332) (-1300.090) * (-1300.233) (-1305.048) (-1300.141) [-1299.840] -- 0:00:53 86500 -- [-1299.351] (-1297.753) (-1298.348) (-1300.136) * (-1298.997) (-1301.474) [-1298.293] (-1299.901) -- 0:01:03 87000 -- (-1299.043) [-1300.110] (-1299.241) (-1300.295) * (-1300.653) (-1299.053) [-1299.841] (-1299.453) -- 0:01:02 87500 -- (-1299.561) (-1297.990) (-1298.005) [-1299.577] * (-1299.593) (-1297.812) (-1301.902) [-1298.100] -- 0:01:02 88000 -- (-1298.899) (-1297.932) [-1300.502] (-1298.036) * [-1298.305] (-1300.473) (-1302.780) (-1301.125) -- 0:01:02 88500 -- (-1298.238) (-1297.669) [-1301.070] (-1297.548) * (-1299.666) (-1299.808) [-1297.871] (-1298.574) -- 0:01:01 89000 -- [-1300.825] (-1300.557) (-1297.368) (-1299.276) * (-1297.932) (-1299.089) [-1297.871] (-1299.629) -- 0:01:01 89500 -- [-1297.082] (-1297.507) (-1297.323) (-1299.987) * (-1299.160) (-1300.758) (-1297.862) [-1300.983] -- 0:01:01 90000 -- [-1297.711] (-1298.176) (-1297.460) (-1298.876) * [-1297.035] (-1298.408) (-1299.922) (-1298.768) -- 0:01:00 Average standard deviation of split frequencies: 0.028733 90500 -- [-1297.946] (-1299.172) (-1299.008) (-1299.089) * (-1297.052) [-1298.407] (-1304.314) (-1301.187) -- 0:01:00 91000 -- (-1298.079) [-1299.484] (-1297.733) (-1300.458) * (-1298.523) (-1297.838) [-1303.044] (-1302.629) -- 0:00:59 91500 -- (-1298.222) (-1298.132) [-1297.397] (-1298.530) * [-1297.259] (-1298.121) (-1299.925) (-1300.634) -- 0:00:59 92000 -- [-1297.376] (-1298.464) (-1297.646) (-1299.084) * (-1299.976) [-1301.917] (-1299.945) (-1300.911) -- 0:00:59 92500 -- (-1299.499) (-1300.183) [-1297.356] (-1299.745) * (-1298.686) (-1298.244) [-1299.246] (-1299.993) -- 0:00:58 93000 -- (-1300.653) (-1303.023) (-1300.935) [-1299.977] * [-1299.539] (-1298.874) (-1302.635) (-1300.410) -- 0:00:58 93500 -- (-1298.752) (-1297.603) (-1301.737) [-1298.102] * (-1299.534) (-1299.696) [-1300.844] (-1300.106) -- 0:00:58 94000 -- (-1298.822) [-1298.722] (-1299.259) (-1301.566) * (-1300.769) (-1299.026) [-1298.673] (-1299.844) -- 0:00:57 94500 -- [-1298.292] (-1301.050) (-1299.977) (-1297.887) * [-1302.222] (-1298.723) (-1303.363) (-1299.198) -- 0:00:57 95000 -- (-1298.120) (-1297.783) (-1301.364) [-1297.760] * (-1301.804) (-1299.336) (-1299.974) [-1299.984] -- 0:00:57 Average standard deviation of split frequencies: 0.026025 95500 -- [-1297.987] (-1299.447) (-1300.747) (-1297.819) * [-1301.970] (-1298.080) (-1299.445) (-1300.228) -- 0:00:56 96000 -- (-1303.098) [-1299.149] (-1297.838) (-1297.907) * (-1300.745) (-1297.509) [-1298.178] (-1299.285) -- 0:00:56 96500 -- [-1306.823] (-1302.702) (-1298.584) (-1297.275) * (-1301.326) (-1297.330) [-1297.643] (-1298.075) -- 0:00:56 97000 -- (-1298.739) (-1297.736) [-1298.925] (-1298.307) * (-1300.171) (-1298.416) [-1299.796] (-1298.089) -- 0:00:55 97500 -- (-1299.974) [-1298.594] (-1303.571) (-1298.675) * (-1298.087) (-1299.947) (-1297.640) [-1296.948] -- 0:00:55 98000 -- (-1301.151) [-1298.775] (-1299.107) (-1301.434) * (-1301.359) (-1298.658) (-1299.493) [-1297.789] -- 0:00:55 98500 -- (-1300.373) [-1298.734] (-1300.021) (-1299.822) * (-1301.054) [-1297.063] (-1298.865) (-1297.730) -- 0:00:54 99000 -- (-1299.994) [-1299.098] (-1301.681) (-1297.918) * (-1303.142) (-1297.249) [-1297.896] (-1297.378) -- 0:00:54 99500 -- (-1302.265) [-1297.987] (-1303.059) (-1300.006) * [-1298.150] (-1302.884) (-1299.080) (-1300.216) -- 0:00:54 100000 -- (-1302.310) [-1298.695] (-1302.978) (-1301.168) * [-1298.059] (-1299.482) (-1298.906) (-1301.921) -- 0:00:54 Average standard deviation of split frequencies: 0.024819 100500 -- (-1299.500) [-1300.003] (-1299.582) (-1298.525) * (-1298.937) (-1299.630) (-1298.021) [-1301.636] -- 0:00:53 101000 -- (-1298.374) (-1298.905) [-1298.495] (-1300.195) * [-1299.908] (-1299.330) (-1297.955) (-1302.913) -- 0:00:53 101500 -- (-1300.749) (-1299.779) [-1302.848] (-1306.338) * [-1297.369] (-1301.074) (-1300.084) (-1304.219) -- 0:00:53 102000 -- (-1300.881) (-1298.803) [-1301.872] (-1298.886) * (-1297.360) (-1302.374) [-1301.708] (-1307.452) -- 0:00:52 102500 -- (-1299.681) (-1299.501) [-1302.002] (-1298.091) * (-1297.078) [-1300.159] (-1297.682) (-1307.888) -- 0:01:01 103000 -- (-1302.332) [-1300.925] (-1299.410) (-1299.006) * (-1297.677) (-1298.716) (-1297.342) [-1300.951] -- 0:01:00 103500 -- (-1306.348) (-1302.772) (-1298.168) [-1300.462] * (-1299.652) (-1297.180) (-1298.290) [-1297.817] -- 0:01:00 104000 -- (-1304.296) (-1300.329) [-1298.169] (-1297.120) * (-1298.428) (-1301.405) (-1301.869) [-1299.707] -- 0:01:00 104500 -- (-1302.293) (-1301.835) (-1299.355) [-1298.561] * [-1298.000] (-1301.126) (-1299.848) (-1301.488) -- 0:00:59 105000 -- (-1303.604) (-1302.476) (-1299.917) [-1297.882] * [-1298.235] (-1301.257) (-1298.312) (-1299.895) -- 0:00:59 Average standard deviation of split frequencies: 0.024460 105500 -- [-1299.071] (-1300.102) (-1298.817) (-1297.388) * (-1303.148) (-1301.936) [-1297.800] (-1300.298) -- 0:00:59 106000 -- [-1298.364] (-1301.188) (-1299.272) (-1297.531) * (-1300.355) [-1299.909] (-1299.479) (-1300.453) -- 0:00:59 106500 -- (-1297.728) (-1302.841) (-1302.861) [-1299.472] * (-1299.544) [-1301.260] (-1299.510) (-1298.942) -- 0:00:58 107000 -- (-1299.523) (-1300.982) [-1299.507] (-1300.771) * (-1299.266) (-1301.344) [-1298.181] (-1298.573) -- 0:00:58 107500 -- [-1302.162] (-1299.280) (-1298.543) (-1297.927) * (-1299.419) (-1299.978) [-1298.944] (-1300.918) -- 0:00:58 108000 -- (-1301.358) [-1297.808] (-1301.479) (-1297.615) * (-1300.642) (-1305.861) (-1298.427) [-1300.351] -- 0:00:57 108500 -- (-1301.166) (-1297.522) [-1296.931] (-1300.647) * (-1298.465) [-1301.495] (-1300.435) (-1299.179) -- 0:00:57 109000 -- (-1299.125) (-1297.093) [-1297.529] (-1300.176) * (-1297.498) (-1301.261) [-1299.977] (-1299.185) -- 0:00:57 109500 -- [-1299.405] (-1297.121) (-1297.825) (-1300.941) * (-1297.498) [-1302.217] (-1298.313) (-1298.506) -- 0:00:56 110000 -- (-1298.659) [-1304.817] (-1299.783) (-1299.248) * [-1297.206] (-1303.410) (-1300.970) (-1298.249) -- 0:00:56 Average standard deviation of split frequencies: 0.022576 110500 -- (-1302.722) (-1297.242) (-1299.979) [-1304.231] * (-1298.334) (-1302.220) (-1302.956) [-1298.897] -- 0:00:56 111000 -- (-1306.215) (-1297.231) [-1299.543] (-1300.477) * [-1299.389] (-1301.694) (-1301.803) (-1299.086) -- 0:00:56 111500 -- [-1301.275] (-1298.314) (-1300.217) (-1300.659) * (-1299.189) (-1300.239) (-1302.780) [-1298.398] -- 0:00:55 112000 -- (-1304.134) [-1298.999] (-1300.203) (-1302.060) * (-1298.442) [-1303.156] (-1301.666) (-1299.620) -- 0:00:55 112500 -- (-1301.036) (-1298.745) (-1302.266) [-1299.701] * (-1311.921) [-1300.205] (-1298.494) (-1299.954) -- 0:00:55 113000 -- (-1298.684) [-1298.981] (-1299.181) (-1304.057) * (-1306.874) (-1301.373) (-1297.905) [-1301.616] -- 0:00:54 113500 -- (-1298.746) (-1302.358) (-1300.032) [-1298.545] * (-1304.038) (-1301.349) (-1300.406) [-1300.194] -- 0:00:54 114000 -- (-1298.634) (-1299.875) (-1299.400) [-1297.537] * (-1297.980) [-1301.412] (-1299.468) (-1299.374) -- 0:00:54 114500 -- [-1298.578] (-1299.885) (-1298.863) (-1301.082) * (-1297.648) (-1305.515) (-1299.005) [-1302.061] -- 0:00:54 115000 -- (-1298.930) (-1298.941) (-1297.799) [-1298.054] * (-1297.654) (-1302.713) (-1300.426) [-1304.547] -- 0:00:53 Average standard deviation of split frequencies: 0.023164 115500 -- [-1301.180] (-1297.926) (-1298.149) (-1300.252) * [-1298.493] (-1302.231) (-1300.364) (-1308.088) -- 0:00:53 116000 -- [-1297.703] (-1298.310) (-1298.284) (-1300.263) * [-1297.401] (-1298.568) (-1298.406) (-1303.276) -- 0:00:53 116500 -- (-1299.306) (-1297.483) (-1300.637) [-1299.891] * (-1302.176) (-1298.681) (-1297.518) [-1300.056] -- 0:00:53 117000 -- (-1301.628) [-1299.179] (-1300.237) (-1302.095) * (-1304.921) (-1298.665) [-1299.286] (-1305.605) -- 0:00:52 117500 -- (-1299.205) (-1297.906) (-1300.116) [-1307.954] * (-1306.044) [-1301.700] (-1299.521) (-1302.639) -- 0:00:52 118000 -- (-1301.292) (-1299.232) (-1299.151) [-1301.958] * (-1298.617) (-1299.154) (-1298.355) [-1300.682] -- 0:00:52 118500 -- (-1298.131) (-1301.227) (-1298.513) [-1298.007] * (-1299.876) (-1301.001) [-1299.502] (-1298.830) -- 0:00:59 119000 -- [-1298.107] (-1303.257) (-1300.614) (-1298.882) * (-1297.912) [-1303.006] (-1299.053) (-1303.576) -- 0:00:59 119500 -- (-1301.355) (-1298.965) [-1304.482] (-1299.750) * [-1298.253] (-1300.500) (-1297.248) (-1300.151) -- 0:00:58 120000 -- (-1302.204) [-1297.921] (-1299.954) (-1299.021) * (-1297.745) [-1299.623] (-1298.065) (-1302.427) -- 0:00:58 Average standard deviation of split frequencies: 0.020150 120500 -- (-1301.940) [-1297.558] (-1299.659) (-1298.381) * [-1299.710] (-1304.315) (-1298.295) (-1300.493) -- 0:00:58 121000 -- (-1298.054) (-1300.044) [-1297.307] (-1297.688) * (-1297.744) [-1302.433] (-1298.963) (-1300.103) -- 0:00:58 121500 -- [-1297.569] (-1298.473) (-1298.117) (-1298.211) * (-1300.094) [-1297.872] (-1300.359) (-1300.716) -- 0:00:57 122000 -- (-1298.603) (-1298.879) [-1298.928] (-1298.452) * (-1300.094) (-1298.580) [-1301.351] (-1297.364) -- 0:00:57 122500 -- (-1297.789) [-1298.051] (-1297.838) (-1300.597) * (-1299.856) [-1298.648] (-1297.613) (-1298.280) -- 0:00:57 123000 -- (-1297.725) [-1299.508] (-1299.160) (-1298.002) * [-1300.474] (-1298.694) (-1297.565) (-1298.796) -- 0:00:57 123500 -- [-1298.313] (-1298.844) (-1302.129) (-1300.090) * [-1301.874] (-1297.508) (-1297.557) (-1300.463) -- 0:00:56 124000 -- (-1298.126) (-1299.970) [-1299.101] (-1298.560) * (-1298.502) (-1299.353) [-1299.591] (-1299.653) -- 0:00:56 124500 -- (-1298.331) (-1303.390) [-1298.408] (-1297.789) * (-1298.215) (-1299.396) [-1298.139] (-1300.484) -- 0:00:56 125000 -- (-1298.541) (-1299.981) [-1298.794] (-1297.789) * [-1297.644] (-1300.903) (-1299.571) (-1304.620) -- 0:00:56 Average standard deviation of split frequencies: 0.020577 125500 -- [-1298.332] (-1298.727) (-1302.730) (-1300.888) * (-1298.153) [-1298.403] (-1302.797) (-1300.740) -- 0:00:55 126000 -- (-1299.622) [-1298.625] (-1299.336) (-1303.973) * [-1299.390] (-1298.928) (-1297.336) (-1299.908) -- 0:00:55 126500 -- (-1299.622) (-1297.685) [-1300.512] (-1305.711) * (-1300.083) [-1300.458] (-1300.440) (-1298.552) -- 0:00:55 127000 -- (-1298.608) [-1298.830] (-1300.498) (-1301.378) * [-1299.377] (-1298.687) (-1300.397) (-1300.465) -- 0:00:54 127500 -- (-1297.656) [-1298.444] (-1298.929) (-1298.608) * [-1298.329] (-1297.490) (-1300.763) (-1298.445) -- 0:00:54 128000 -- (-1298.372) (-1298.271) [-1297.595] (-1297.439) * [-1299.793] (-1298.088) (-1301.594) (-1300.008) -- 0:00:54 128500 -- (-1297.831) [-1299.046] (-1300.033) (-1297.810) * (-1300.851) (-1300.107) (-1301.139) [-1302.009] -- 0:00:54 129000 -- (-1301.367) [-1299.235] (-1300.672) (-1297.198) * (-1299.675) [-1302.262] (-1297.439) (-1300.939) -- 0:00:54 129500 -- (-1299.088) (-1301.834) [-1298.633] (-1297.336) * (-1303.416) (-1301.919) [-1299.908] (-1300.962) -- 0:00:53 130000 -- [-1298.435] (-1302.427) (-1298.610) (-1298.244) * [-1298.520] (-1303.872) (-1300.815) (-1300.151) -- 0:00:53 Average standard deviation of split frequencies: 0.019482 130500 -- (-1298.698) (-1300.041) [-1298.725] (-1299.616) * [-1299.160] (-1298.768) (-1299.351) (-1300.782) -- 0:00:53 131000 -- (-1300.359) [-1298.283] (-1304.146) (-1300.095) * (-1299.850) (-1297.625) (-1301.726) [-1297.698] -- 0:00:53 131500 -- (-1299.346) (-1298.532) (-1300.117) [-1297.781] * (-1303.074) (-1299.341) (-1301.657) [-1297.826] -- 0:00:52 132000 -- (-1299.409) (-1298.666) (-1298.450) [-1298.575] * (-1305.612) [-1297.953] (-1298.333) (-1298.951) -- 0:00:52 132500 -- (-1299.304) (-1299.805) [-1298.179] (-1298.606) * (-1300.074) (-1298.252) [-1298.299] (-1298.925) -- 0:00:52 133000 -- [-1300.502] (-1302.540) (-1298.901) (-1298.228) * (-1297.861) [-1299.244] (-1299.100) (-1303.292) -- 0:00:52 133500 -- (-1298.199) (-1298.712) (-1299.694) [-1297.409] * (-1297.531) (-1300.169) (-1299.777) [-1298.711] -- 0:00:51 134000 -- (-1297.511) [-1300.257] (-1298.672) (-1297.847) * [-1297.786] (-1298.965) (-1302.039) (-1298.863) -- 0:00:51 134500 -- (-1297.544) [-1297.515] (-1298.049) (-1297.472) * (-1296.948) (-1301.017) [-1300.045] (-1299.228) -- 0:00:51 135000 -- (-1299.505) [-1297.515] (-1301.223) (-1297.977) * (-1297.442) (-1301.107) [-1298.626] (-1297.766) -- 0:00:57 Average standard deviation of split frequencies: 0.019064 135500 -- [-1299.795] (-1297.650) (-1301.034) (-1300.533) * (-1298.014) (-1300.065) [-1299.381] (-1298.345) -- 0:00:57 136000 -- (-1297.966) [-1298.175] (-1301.697) (-1299.748) * [-1297.194] (-1300.728) (-1299.424) (-1297.113) -- 0:00:57 136500 -- [-1297.960] (-1298.870) (-1301.630) (-1299.739) * (-1297.292) (-1298.572) [-1300.601] (-1298.536) -- 0:00:56 137000 -- (-1297.850) (-1300.958) (-1298.148) [-1300.059] * (-1299.674) (-1297.668) [-1299.062] (-1301.183) -- 0:00:56 137500 -- (-1297.779) [-1300.378] (-1302.900) (-1303.058) * (-1299.963) (-1298.282) (-1298.356) [-1299.824] -- 0:00:56 138000 -- [-1297.057] (-1301.576) (-1298.516) (-1304.189) * [-1300.175] (-1299.311) (-1297.640) (-1298.053) -- 0:00:56 138500 -- (-1299.189) (-1299.465) [-1300.339] (-1298.860) * (-1297.551) [-1299.929] (-1301.298) (-1301.098) -- 0:00:55 139000 -- (-1299.196) [-1298.053] (-1297.980) (-1300.205) * (-1300.798) (-1298.595) [-1302.125] (-1298.661) -- 0:00:55 139500 -- (-1300.684) [-1298.110] (-1297.690) (-1300.054) * (-1297.624) (-1297.641) [-1299.046] (-1300.126) -- 0:00:55 140000 -- (-1300.459) (-1298.764) [-1297.513] (-1300.254) * (-1299.858) (-1297.474) [-1300.263] (-1302.193) -- 0:00:55 Average standard deviation of split frequencies: 0.016756 140500 -- (-1298.025) [-1300.288] (-1298.787) (-1298.156) * (-1300.475) (-1298.493) [-1302.169] (-1299.004) -- 0:00:55 141000 -- (-1299.581) [-1299.820] (-1297.245) (-1299.136) * [-1299.488] (-1298.574) (-1300.421) (-1300.496) -- 0:00:54 141500 -- (-1302.029) (-1302.002) (-1297.885) [-1298.057] * (-1298.987) [-1298.570] (-1298.780) (-1300.762) -- 0:00:54 142000 -- (-1303.101) [-1299.462] (-1297.836) (-1298.126) * [-1297.834] (-1299.999) (-1302.202) (-1303.006) -- 0:00:54 142500 -- (-1298.065) (-1301.066) [-1297.849] (-1298.605) * (-1300.233) (-1297.321) [-1297.207] (-1300.343) -- 0:00:54 143000 -- [-1298.044] (-1301.145) (-1301.397) (-1298.448) * [-1298.957] (-1298.202) (-1305.811) (-1302.049) -- 0:00:53 143500 -- [-1298.190] (-1298.686) (-1297.200) (-1303.023) * (-1298.828) [-1298.693] (-1299.655) (-1301.317) -- 0:00:53 144000 -- (-1298.101) (-1300.224) (-1299.664) [-1298.833] * [-1298.791] (-1299.219) (-1299.856) (-1301.213) -- 0:00:53 144500 -- (-1298.540) (-1301.658) (-1300.983) [-1299.623] * (-1299.956) [-1299.007] (-1300.460) (-1298.122) -- 0:00:53 145000 -- (-1299.625) [-1299.360] (-1301.462) (-1300.655) * (-1297.794) (-1298.279) [-1299.495] (-1298.303) -- 0:00:53 Average standard deviation of split frequencies: 0.017597 145500 -- [-1299.262] (-1297.823) (-1300.116) (-1302.278) * (-1299.044) (-1297.820) (-1302.572) [-1298.719] -- 0:00:52 146000 -- (-1302.911) (-1297.856) [-1298.779] (-1302.891) * (-1298.195) (-1297.817) (-1299.992) [-1298.576] -- 0:00:52 146500 -- (-1300.334) [-1300.434] (-1300.419) (-1299.799) * [-1297.916] (-1297.820) (-1300.839) (-1301.424) -- 0:00:52 147000 -- [-1299.405] (-1298.663) (-1302.283) (-1298.609) * (-1297.916) (-1302.034) [-1299.741] (-1299.948) -- 0:00:52 147500 -- (-1301.791) [-1299.149] (-1301.113) (-1299.292) * (-1299.279) (-1297.825) [-1297.428] (-1300.203) -- 0:00:52 148000 -- (-1299.986) (-1297.878) (-1302.524) [-1299.221] * (-1300.922) (-1298.478) (-1299.282) [-1298.503] -- 0:00:51 148500 -- [-1300.590] (-1299.314) (-1300.520) (-1297.620) * (-1301.692) (-1297.508) (-1298.412) [-1298.104] -- 0:00:51 149000 -- (-1297.418) [-1303.087] (-1299.809) (-1297.877) * (-1310.163) (-1298.451) [-1299.200] (-1299.938) -- 0:00:51 149500 -- (-1298.163) [-1302.728] (-1299.377) (-1298.137) * (-1303.038) (-1297.886) [-1299.238] (-1305.384) -- 0:00:51 150000 -- (-1298.550) (-1302.238) [-1298.853] (-1297.331) * [-1297.537] (-1300.155) (-1296.943) (-1305.700) -- 0:00:51 Average standard deviation of split frequencies: 0.018303 150500 -- [-1297.814] (-1299.555) (-1300.090) (-1297.644) * [-1303.009] (-1298.287) (-1297.189) (-1302.394) -- 0:00:50 151000 -- [-1298.105] (-1297.946) (-1300.162) (-1298.790) * [-1299.132] (-1299.166) (-1297.787) (-1300.914) -- 0:00:56 151500 -- [-1297.104] (-1297.302) (-1301.680) (-1297.175) * (-1299.752) (-1300.035) [-1297.993] (-1301.493) -- 0:00:56 152000 -- (-1297.036) (-1300.693) [-1301.689] (-1302.430) * (-1298.154) (-1298.050) (-1299.214) [-1299.881] -- 0:00:55 152500 -- (-1299.491) (-1300.133) (-1302.659) [-1302.630] * (-1299.069) (-1298.168) (-1298.680) [-1298.683] -- 0:00:55 153000 -- [-1303.001] (-1299.042) (-1301.158) (-1301.206) * (-1299.722) (-1301.758) (-1298.877) [-1300.723] -- 0:00:55 153500 -- [-1301.876] (-1299.044) (-1301.753) (-1298.016) * [-1298.908] (-1299.627) (-1299.469) (-1302.087) -- 0:00:55 154000 -- [-1298.300] (-1298.400) (-1297.866) (-1298.033) * (-1300.468) (-1299.571) [-1297.673] (-1302.253) -- 0:00:54 154500 -- (-1300.493) [-1298.772] (-1298.508) (-1298.038) * [-1301.473] (-1298.261) (-1298.316) (-1299.755) -- 0:00:54 155000 -- (-1299.436) (-1301.231) [-1297.381] (-1298.029) * [-1299.829] (-1298.843) (-1299.204) (-1298.722) -- 0:00:54 Average standard deviation of split frequencies: 0.018735 155500 -- (-1298.827) [-1300.682] (-1297.174) (-1299.926) * (-1299.525) (-1302.060) (-1298.581) [-1302.371] -- 0:00:54 156000 -- (-1298.827) [-1303.391] (-1297.063) (-1298.830) * (-1299.132) (-1300.269) [-1299.443] (-1300.031) -- 0:00:54 156500 -- (-1299.431) (-1298.693) [-1301.554] (-1299.093) * (-1301.489) (-1297.927) (-1299.935) [-1299.575] -- 0:00:53 157000 -- (-1298.274) [-1298.811] (-1301.154) (-1301.547) * (-1299.964) (-1298.801) (-1300.340) [-1298.962] -- 0:00:53 157500 -- (-1298.790) (-1299.131) (-1298.770) [-1297.638] * (-1305.639) (-1299.025) [-1302.241] (-1298.405) -- 0:00:53 158000 -- [-1297.283] (-1299.118) (-1297.626) (-1300.482) * [-1299.606] (-1297.861) (-1300.483) (-1298.519) -- 0:00:53 158500 -- (-1297.558) [-1299.330] (-1298.265) (-1301.198) * [-1298.048] (-1297.495) (-1300.733) (-1300.077) -- 0:00:53 159000 -- (-1298.682) [-1303.582] (-1299.000) (-1300.733) * (-1300.407) [-1298.379] (-1298.484) (-1300.088) -- 0:00:52 159500 -- (-1298.945) (-1298.816) [-1297.807] (-1304.500) * (-1300.735) (-1299.960) (-1299.644) [-1301.897] -- 0:00:52 160000 -- [-1298.816] (-1300.816) (-1299.101) (-1299.478) * (-1298.289) (-1300.880) [-1298.091] (-1301.695) -- 0:00:52 Average standard deviation of split frequencies: 0.018531 160500 -- [-1300.518] (-1297.492) (-1301.505) (-1298.066) * [-1298.904] (-1298.626) (-1298.104) (-1298.634) -- 0:00:52 161000 -- (-1300.274) [-1300.444] (-1300.674) (-1298.136) * (-1300.023) (-1299.051) [-1300.678] (-1298.579) -- 0:00:52 161500 -- [-1298.564] (-1297.622) (-1300.229) (-1299.498) * (-1299.517) [-1299.349] (-1298.966) (-1298.603) -- 0:00:51 162000 -- (-1298.522) (-1299.411) (-1300.816) [-1298.972] * (-1301.819) (-1300.196) (-1299.842) [-1297.732] -- 0:00:51 162500 -- (-1298.418) (-1297.934) [-1300.706] (-1298.417) * (-1299.422) [-1300.636] (-1299.715) (-1297.994) -- 0:00:51 163000 -- (-1297.124) [-1298.196] (-1300.072) (-1298.607) * (-1300.057) (-1297.393) (-1304.105) [-1299.979] -- 0:00:51 163500 -- (-1297.482) (-1297.390) (-1299.245) [-1299.524] * [-1299.081] (-1304.322) (-1304.137) (-1298.478) -- 0:00:51 164000 -- (-1297.480) (-1296.944) [-1300.322] (-1301.287) * (-1298.980) (-1303.630) [-1297.892] (-1297.519) -- 0:00:50 164500 -- (-1297.123) (-1298.561) (-1299.546) [-1298.694] * (-1297.815) [-1301.006] (-1298.754) (-1297.833) -- 0:00:50 165000 -- [-1297.923] (-1297.413) (-1300.660) (-1297.989) * [-1297.332] (-1300.533) (-1298.867) (-1299.710) -- 0:00:50 Average standard deviation of split frequencies: 0.017607 165500 -- (-1297.833) (-1297.759) [-1298.202] (-1297.613) * [-1297.467] (-1303.869) (-1298.039) (-1299.133) -- 0:00:50 166000 -- (-1299.715) (-1297.024) [-1299.221] (-1299.670) * [-1299.134] (-1298.920) (-1298.087) (-1299.524) -- 0:00:50 166500 -- (-1298.483) (-1297.243) [-1299.221] (-1298.777) * [-1297.831] (-1300.819) (-1297.749) (-1299.764) -- 0:00:50 167000 -- (-1299.700) (-1300.182) (-1303.737) [-1299.176] * [-1298.752] (-1298.096) (-1299.017) (-1299.856) -- 0:00:49 167500 -- (-1301.059) (-1298.057) [-1299.435] (-1299.091) * (-1299.232) (-1298.252) [-1298.636] (-1300.117) -- 0:00:54 168000 -- (-1302.401) (-1297.663) (-1300.764) [-1297.669] * (-1298.260) (-1298.966) [-1299.769] (-1298.834) -- 0:00:54 168500 -- [-1301.876] (-1298.861) (-1303.887) (-1297.687) * (-1297.330) (-1299.019) (-1299.903) [-1298.531] -- 0:00:54 169000 -- (-1297.446) [-1299.454] (-1298.408) (-1297.464) * [-1297.696] (-1299.014) (-1300.593) (-1299.203) -- 0:00:54 169500 -- (-1304.366) (-1298.626) (-1298.726) [-1298.148] * (-1298.357) [-1298.934] (-1298.010) (-1298.339) -- 0:00:53 170000 -- (-1299.784) (-1303.467) (-1298.365) [-1297.916] * (-1298.726) (-1297.537) [-1298.590] (-1298.527) -- 0:00:53 Average standard deviation of split frequencies: 0.016137 170500 -- (-1301.638) (-1301.235) [-1298.595] (-1298.984) * (-1300.168) [-1299.740] (-1299.129) (-1299.975) -- 0:00:53 171000 -- (-1303.009) [-1298.171] (-1297.801) (-1299.644) * [-1298.815] (-1300.541) (-1300.268) (-1301.351) -- 0:00:53 171500 -- (-1300.645) (-1302.589) (-1303.414) [-1300.750] * [-1298.272] (-1301.478) (-1300.104) (-1300.646) -- 0:00:53 172000 -- (-1299.041) (-1301.853) (-1298.634) [-1298.716] * [-1300.493] (-1302.682) (-1299.951) (-1298.531) -- 0:00:52 172500 -- (-1299.305) (-1300.666) [-1298.661] (-1298.385) * [-1298.681] (-1304.069) (-1298.506) (-1298.604) -- 0:00:52 173000 -- (-1299.510) (-1298.052) (-1299.802) [-1300.109] * [-1299.156] (-1305.147) (-1299.238) (-1299.271) -- 0:00:52 173500 -- (-1298.283) (-1298.734) [-1299.395] (-1299.361) * [-1297.890] (-1304.734) (-1299.872) (-1299.423) -- 0:00:52 174000 -- (-1301.759) (-1302.256) [-1301.369] (-1299.778) * [-1297.487] (-1298.607) (-1298.383) (-1300.412) -- 0:00:52 174500 -- (-1301.134) (-1300.599) (-1298.668) [-1302.285] * (-1297.946) (-1297.825) (-1298.418) [-1300.160] -- 0:00:52 175000 -- [-1298.865] (-1298.958) (-1299.452) (-1299.422) * (-1297.948) (-1311.436) [-1302.840] (-1300.508) -- 0:00:51 Average standard deviation of split frequencies: 0.016353 175500 -- [-1298.612] (-1298.924) (-1302.242) (-1298.992) * (-1297.572) (-1303.695) (-1299.147) [-1301.890] -- 0:00:51 176000 -- (-1298.479) [-1299.376] (-1305.690) (-1297.976) * [-1299.806] (-1298.465) (-1299.335) (-1302.407) -- 0:00:51 176500 -- (-1297.200) (-1299.365) (-1300.708) [-1297.836] * (-1301.712) [-1299.720] (-1302.114) (-1298.588) -- 0:00:51 177000 -- (-1299.063) [-1299.402] (-1306.802) (-1297.904) * [-1298.733] (-1299.885) (-1298.244) (-1298.235) -- 0:00:51 177500 -- [-1300.046] (-1299.295) (-1302.806) (-1303.575) * (-1298.832) [-1303.511] (-1302.103) (-1298.479) -- 0:00:50 178000 -- [-1299.511] (-1299.929) (-1303.135) (-1303.790) * (-1299.734) (-1300.394) [-1299.502] (-1300.753) -- 0:00:50 178500 -- (-1299.609) [-1302.255] (-1302.385) (-1301.224) * (-1299.169) [-1298.265] (-1297.912) (-1300.574) -- 0:00:50 179000 -- (-1307.257) [-1308.243] (-1300.467) (-1297.968) * (-1304.080) (-1297.147) [-1298.801] (-1303.083) -- 0:00:50 179500 -- (-1302.909) (-1299.250) [-1298.876] (-1298.337) * (-1298.378) (-1297.326) (-1303.196) [-1299.779] -- 0:00:50 180000 -- [-1301.910] (-1300.339) (-1298.783) (-1299.863) * [-1302.051] (-1301.976) (-1299.184) (-1297.534) -- 0:00:50 Average standard deviation of split frequencies: 0.015076 180500 -- (-1302.158) [-1300.222] (-1299.270) (-1298.229) * (-1299.181) (-1298.072) [-1303.010] (-1297.130) -- 0:00:49 181000 -- [-1296.916] (-1302.505) (-1301.900) (-1298.752) * [-1299.226] (-1297.618) (-1301.123) (-1297.883) -- 0:00:49 181500 -- (-1302.183) (-1305.534) (-1297.744) [-1298.577] * (-1300.012) (-1303.839) (-1299.593) [-1299.700] -- 0:00:49 182000 -- (-1299.710) (-1299.270) [-1300.648] (-1298.915) * (-1300.220) [-1301.477] (-1298.436) (-1298.069) -- 0:00:53 182500 -- [-1298.021] (-1300.001) (-1301.740) (-1299.979) * (-1300.583) [-1301.864] (-1298.533) (-1298.306) -- 0:00:53 183000 -- (-1298.314) (-1300.208) (-1301.090) [-1297.301] * [-1297.738] (-1301.767) (-1299.367) (-1303.852) -- 0:00:53 183500 -- (-1299.301) (-1300.410) [-1302.454] (-1298.621) * (-1298.841) [-1300.964] (-1302.946) (-1307.426) -- 0:00:53 184000 -- [-1299.084] (-1300.345) (-1302.296) (-1302.369) * (-1297.313) [-1299.075] (-1297.719) (-1303.706) -- 0:00:53 184500 -- [-1301.466] (-1297.744) (-1301.925) (-1302.467) * [-1297.240] (-1298.837) (-1303.409) (-1303.153) -- 0:00:53 185000 -- (-1302.291) (-1297.740) (-1301.437) [-1299.684] * (-1298.358) [-1299.678] (-1300.000) (-1297.578) -- 0:00:52 Average standard deviation of split frequencies: 0.015740 185500 -- (-1299.854) [-1299.575] (-1300.694) (-1303.716) * (-1297.530) (-1300.938) [-1298.840] (-1298.579) -- 0:00:52 186000 -- [-1297.730] (-1300.879) (-1301.299) (-1297.712) * (-1299.933) [-1299.088] (-1300.924) (-1298.008) -- 0:00:52 186500 -- (-1297.789) (-1299.149) [-1300.505] (-1300.915) * (-1298.986) [-1298.937] (-1301.033) (-1302.400) -- 0:00:52 187000 -- (-1297.924) [-1298.663] (-1299.794) (-1300.352) * [-1301.746] (-1299.446) (-1300.124) (-1298.741) -- 0:00:52 187500 -- (-1301.741) (-1298.571) [-1298.737] (-1299.458) * (-1299.911) [-1298.443] (-1297.401) (-1300.828) -- 0:00:52 188000 -- [-1298.649] (-1299.794) (-1299.726) (-1299.665) * [-1298.922] (-1300.670) (-1297.401) (-1302.079) -- 0:00:51 188500 -- (-1298.963) (-1299.581) [-1298.936] (-1299.011) * (-1298.211) (-1300.978) [-1297.400] (-1299.920) -- 0:00:51 189000 -- (-1301.252) (-1298.314) (-1297.900) [-1298.359] * (-1300.786) (-1300.197) (-1300.916) [-1301.254] -- 0:00:51 189500 -- [-1301.911] (-1297.624) (-1298.516) (-1299.304) * (-1305.003) (-1300.597) (-1299.977) [-1298.846] -- 0:00:51 190000 -- (-1298.055) (-1297.327) (-1299.624) [-1301.553] * (-1305.304) (-1300.782) [-1299.368] (-1298.069) -- 0:00:51 Average standard deviation of split frequencies: 0.016836 190500 -- [-1301.312] (-1298.706) (-1298.027) (-1299.222) * [-1299.399] (-1299.524) (-1301.401) (-1298.233) -- 0:00:50 191000 -- [-1299.175] (-1300.128) (-1297.279) (-1299.407) * [-1297.757] (-1300.771) (-1300.381) (-1298.167) -- 0:00:50 191500 -- (-1299.633) (-1299.462) [-1298.998] (-1298.252) * (-1297.407) (-1298.342) (-1298.343) [-1298.130] -- 0:00:50 192000 -- (-1300.209) (-1300.867) (-1297.072) [-1298.093] * (-1298.924) [-1298.014] (-1297.877) (-1300.281) -- 0:00:50 192500 -- (-1299.834) (-1298.425) [-1297.949] (-1301.223) * (-1300.145) (-1298.075) [-1299.704] (-1298.692) -- 0:00:50 193000 -- (-1300.202) [-1298.047] (-1299.149) (-1299.087) * (-1300.145) (-1298.212) [-1301.318] (-1297.624) -- 0:00:50 193500 -- (-1299.926) (-1299.261) (-1298.996) [-1300.566] * (-1302.123) (-1299.377) [-1297.210] (-1297.624) -- 0:00:50 194000 -- [-1300.810] (-1299.391) (-1300.479) (-1297.470) * (-1301.268) (-1297.869) [-1298.561] (-1300.607) -- 0:00:49 194500 -- (-1298.607) (-1300.025) [-1299.306] (-1297.671) * (-1301.647) (-1297.869) (-1299.489) [-1299.952] -- 0:00:49 195000 -- (-1299.330) (-1300.728) (-1299.860) [-1298.599] * (-1300.592) [-1297.967] (-1297.976) (-1299.233) -- 0:00:49 Average standard deviation of split frequencies: 0.016378 195500 -- [-1299.264] (-1298.110) (-1297.861) (-1297.584) * (-1300.891) (-1297.635) [-1297.453] (-1300.511) -- 0:00:49 196000 -- [-1299.656] (-1298.110) (-1299.698) (-1298.734) * (-1305.541) [-1297.635] (-1299.073) (-1298.403) -- 0:00:49 196500 -- [-1298.002] (-1297.990) (-1300.393) (-1300.443) * (-1300.686) [-1297.640] (-1297.386) (-1298.480) -- 0:00:49 197000 -- [-1298.112] (-1302.628) (-1299.083) (-1300.834) * (-1299.282) (-1301.463) [-1298.043] (-1303.091) -- 0:00:52 197500 -- (-1300.573) (-1299.025) (-1301.541) [-1299.827] * (-1300.020) [-1299.607] (-1299.178) (-1298.348) -- 0:00:52 198000 -- (-1298.144) (-1298.868) [-1298.550] (-1298.456) * (-1301.098) (-1299.098) [-1300.345] (-1298.779) -- 0:00:52 198500 -- (-1298.438) (-1298.824) (-1300.772) [-1297.995] * (-1301.127) [-1301.506] (-1300.825) (-1298.482) -- 0:00:52 199000 -- (-1300.306) (-1298.506) [-1302.605] (-1298.037) * (-1300.219) (-1300.076) (-1300.237) [-1299.433] -- 0:00:52 199500 -- (-1299.259) (-1298.937) (-1304.058) [-1299.654] * (-1299.795) (-1298.324) (-1299.890) [-1300.561] -- 0:00:52 200000 -- (-1299.249) (-1300.330) [-1303.181] (-1298.952) * (-1302.615) (-1298.820) [-1299.014] (-1298.522) -- 0:00:51 Average standard deviation of split frequencies: 0.016444 200500 -- (-1298.427) (-1300.322) (-1305.297) [-1298.498] * (-1301.886) [-1300.008] (-1298.450) (-1302.732) -- 0:00:51 201000 -- (-1300.359) (-1300.635) (-1299.145) [-1297.258] * (-1300.585) [-1301.178] (-1300.068) (-1299.804) -- 0:00:51 201500 -- (-1301.960) [-1300.155] (-1298.318) (-1303.006) * (-1300.303) (-1301.044) [-1300.005] (-1298.608) -- 0:00:51 202000 -- (-1299.394) (-1298.392) (-1299.025) [-1299.629] * (-1300.196) (-1297.617) (-1298.352) [-1297.671] -- 0:00:51 202500 -- (-1299.162) (-1300.449) [-1299.075] (-1297.904) * [-1300.193] (-1299.828) (-1303.825) (-1296.962) -- 0:00:51 203000 -- (-1298.834) [-1300.507] (-1300.878) (-1298.517) * (-1301.063) (-1298.628) (-1299.686) [-1299.162] -- 0:00:51 203500 -- (-1299.162) (-1298.084) [-1300.067] (-1298.276) * (-1301.983) (-1298.444) [-1300.358] (-1298.340) -- 0:00:50 204000 -- (-1301.071) (-1301.346) (-1297.497) [-1301.529] * (-1299.426) [-1298.607] (-1299.151) (-1297.721) -- 0:00:50 204500 -- (-1297.795) (-1300.383) (-1298.721) [-1297.555] * (-1299.781) (-1299.779) [-1300.131] (-1298.415) -- 0:00:50 205000 -- (-1298.079) (-1301.437) [-1297.385] (-1302.548) * (-1299.976) [-1299.931] (-1299.525) (-1301.616) -- 0:00:50 Average standard deviation of split frequencies: 0.015692 205500 -- [-1299.421] (-1299.492) (-1298.544) (-1297.572) * (-1299.280) [-1299.170] (-1299.395) (-1298.097) -- 0:00:50 206000 -- (-1298.624) [-1299.263] (-1297.358) (-1300.723) * (-1299.264) (-1297.311) (-1302.596) [-1298.105] -- 0:00:50 206500 -- (-1298.679) [-1299.333] (-1299.186) (-1298.774) * (-1299.239) (-1300.168) (-1297.697) [-1300.390] -- 0:00:49 207000 -- (-1298.546) [-1300.380] (-1298.097) (-1301.366) * (-1303.099) (-1300.500) [-1297.337] (-1298.720) -- 0:00:49 207500 -- (-1297.454) [-1299.164] (-1298.064) (-1302.431) * (-1298.563) (-1300.542) (-1297.646) [-1301.977] -- 0:00:49 208000 -- (-1298.015) [-1299.164] (-1297.938) (-1302.171) * (-1299.167) (-1299.454) (-1298.564) [-1301.768] -- 0:00:49 208500 -- (-1297.454) (-1298.842) (-1297.935) [-1301.596] * (-1299.338) [-1297.952] (-1299.883) (-1301.809) -- 0:00:49 209000 -- (-1297.453) (-1300.545) [-1298.538] (-1299.295) * (-1300.110) (-1298.356) [-1297.682] (-1299.962) -- 0:00:49 209500 -- (-1297.086) (-1299.723) [-1298.667] (-1298.688) * [-1299.290] (-1297.257) (-1297.928) (-1300.105) -- 0:00:49 210000 -- (-1297.959) (-1299.477) [-1299.567] (-1303.878) * (-1299.549) (-1298.175) [-1298.454] (-1300.227) -- 0:00:48 Average standard deviation of split frequencies: 0.016135 210500 -- (-1298.170) (-1299.685) [-1298.183] (-1302.442) * (-1297.406) (-1298.937) [-1299.042] (-1300.104) -- 0:00:48 211000 -- [-1298.082] (-1297.869) (-1299.811) (-1302.720) * (-1299.706) [-1299.743] (-1299.040) (-1297.220) -- 0:00:48 211500 -- (-1301.071) (-1302.486) [-1299.095] (-1302.716) * [-1297.056] (-1298.964) (-1298.687) (-1301.487) -- 0:00:48 212000 -- [-1300.131] (-1301.358) (-1300.756) (-1300.881) * [-1299.009] (-1299.187) (-1299.445) (-1301.197) -- 0:00:48 212500 -- (-1299.741) (-1307.697) [-1299.133] (-1301.083) * (-1299.201) (-1299.505) (-1302.548) [-1300.275] -- 0:00:51 213000 -- (-1299.710) (-1299.188) [-1300.348] (-1304.312) * (-1300.060) (-1299.460) (-1301.093) [-1299.254] -- 0:00:51 213500 -- [-1298.755] (-1301.033) (-1304.382) (-1300.650) * (-1297.314) [-1301.700] (-1299.968) (-1299.314) -- 0:00:51 214000 -- (-1300.015) (-1300.490) [-1299.792] (-1298.567) * (-1297.111) (-1299.893) (-1302.538) [-1303.564] -- 0:00:51 214500 -- (-1300.249) [-1301.482] (-1300.072) (-1298.860) * (-1297.111) [-1299.681] (-1301.224) (-1300.160) -- 0:00:51 215000 -- [-1298.309] (-1303.360) (-1298.778) (-1298.363) * (-1297.954) [-1297.856] (-1299.486) (-1298.358) -- 0:00:51 Average standard deviation of split frequencies: 0.014186 215500 -- (-1298.094) [-1298.451] (-1299.137) (-1301.022) * (-1298.239) (-1299.011) (-1305.251) [-1299.833] -- 0:00:50 216000 -- (-1299.712) (-1300.064) [-1301.116] (-1301.293) * [-1297.668] (-1298.225) (-1298.723) (-1299.377) -- 0:00:50 216500 -- (-1299.399) [-1305.283] (-1299.614) (-1297.770) * [-1299.934] (-1303.982) (-1298.507) (-1298.586) -- 0:00:50 217000 -- [-1299.046] (-1306.065) (-1299.757) (-1300.188) * (-1298.351) [-1298.806] (-1299.372) (-1299.187) -- 0:00:50 217500 -- (-1307.190) (-1306.631) [-1299.791] (-1302.082) * (-1299.936) (-1301.754) (-1299.267) [-1299.530] -- 0:00:50 218000 -- (-1298.930) (-1298.750) [-1298.992] (-1300.817) * [-1298.531] (-1300.534) (-1306.271) (-1300.963) -- 0:00:50 218500 -- (-1299.126) (-1299.900) (-1297.934) [-1299.900] * (-1298.595) (-1300.748) [-1301.743] (-1300.396) -- 0:00:50 219000 -- (-1299.408) (-1301.847) (-1301.151) [-1297.409] * [-1299.170] (-1299.528) (-1300.211) (-1298.904) -- 0:00:49 219500 -- [-1298.563] (-1299.294) (-1301.225) (-1298.185) * (-1299.262) (-1299.644) [-1300.324] (-1298.664) -- 0:00:49 220000 -- (-1300.643) (-1298.537) (-1299.843) [-1298.143] * (-1300.187) (-1299.055) [-1299.687] (-1298.914) -- 0:00:49 Average standard deviation of split frequencies: 0.015629 220500 -- (-1302.314) (-1297.870) (-1301.887) [-1298.260] * (-1300.909) [-1299.546] (-1300.195) (-1297.289) -- 0:00:49 221000 -- (-1297.301) (-1298.914) (-1301.150) [-1297.995] * (-1302.084) (-1299.235) [-1299.908] (-1298.964) -- 0:00:49 221500 -- (-1298.761) (-1297.588) [-1298.115] (-1297.250) * (-1303.468) [-1300.452] (-1300.060) (-1298.892) -- 0:00:49 222000 -- [-1301.329] (-1301.392) (-1300.285) (-1297.146) * (-1302.545) (-1298.661) (-1298.388) [-1301.137] -- 0:00:49 222500 -- (-1300.804) (-1300.925) [-1299.300] (-1298.327) * (-1299.367) [-1297.744] (-1299.853) (-1300.317) -- 0:00:48 223000 -- (-1299.949) [-1299.380] (-1302.152) (-1303.845) * (-1301.351) (-1301.700) [-1299.516] (-1299.606) -- 0:00:48 223500 -- (-1298.689) (-1300.582) (-1301.678) [-1299.246] * (-1303.119) (-1300.845) [-1298.892] (-1299.718) -- 0:00:48 224000 -- (-1302.150) (-1304.825) (-1300.331) [-1298.608] * [-1297.637] (-1305.034) (-1298.503) (-1301.022) -- 0:00:48 224500 -- [-1302.221] (-1298.767) (-1301.093) (-1298.335) * (-1297.652) [-1299.769] (-1298.572) (-1302.944) -- 0:00:48 225000 -- [-1298.041] (-1297.147) (-1297.836) (-1298.673) * (-1298.923) (-1297.902) (-1302.445) [-1299.615] -- 0:00:48 Average standard deviation of split frequencies: 0.015331 225500 -- [-1297.930] (-1298.299) (-1297.201) (-1297.932) * [-1298.313] (-1299.039) (-1301.050) (-1299.609) -- 0:00:51 226000 -- (-1301.697) (-1299.169) (-1297.045) [-1299.018] * [-1298.615] (-1301.336) (-1300.889) (-1302.591) -- 0:00:51 226500 -- (-1299.023) [-1297.292] (-1298.803) (-1302.341) * (-1298.874) (-1301.167) (-1299.707) [-1300.340] -- 0:00:51 227000 -- [-1298.482] (-1301.136) (-1301.494) (-1300.218) * (-1299.286) [-1298.933] (-1299.876) (-1300.083) -- 0:00:51 227500 -- (-1302.590) [-1297.721] (-1299.879) (-1298.270) * (-1300.384) [-1300.414] (-1298.117) (-1301.975) -- 0:00:50 228000 -- (-1299.154) (-1297.881) (-1298.600) [-1299.036] * (-1304.876) [-1301.258] (-1299.588) (-1298.786) -- 0:00:50 228500 -- [-1297.952] (-1298.163) (-1299.889) (-1298.712) * (-1299.621) (-1300.055) (-1299.475) [-1299.919] -- 0:00:50 229000 -- (-1297.399) (-1297.872) [-1300.770] (-1298.871) * (-1298.684) [-1301.765] (-1299.682) (-1299.250) -- 0:00:50 229500 -- (-1297.367) (-1299.123) (-1301.159) [-1298.869] * [-1299.086] (-1302.214) (-1301.312) (-1299.423) -- 0:00:50 230000 -- [-1302.631] (-1298.226) (-1302.153) (-1302.438) * (-1299.086) (-1298.223) (-1300.867) [-1302.893] -- 0:00:50 Average standard deviation of split frequencies: 0.015634 230500 -- (-1303.251) (-1298.766) (-1302.309) [-1302.475] * (-1302.564) (-1298.030) (-1302.548) [-1299.420] -- 0:00:50 231000 -- (-1301.527) (-1297.668) [-1301.195] (-1303.265) * (-1301.243) (-1299.188) (-1304.647) [-1299.238] -- 0:00:49 231500 -- (-1300.453) (-1298.595) (-1299.409) [-1299.912] * [-1298.487] (-1298.078) (-1300.856) (-1300.426) -- 0:00:49 232000 -- (-1305.208) [-1298.742] (-1298.569) (-1302.815) * [-1300.871] (-1303.356) (-1297.656) (-1298.204) -- 0:00:49 232500 -- (-1298.247) (-1299.345) [-1297.839] (-1299.810) * (-1300.361) [-1297.619] (-1297.381) (-1298.194) -- 0:00:49 233000 -- (-1298.127) (-1301.416) [-1297.810] (-1299.030) * (-1301.213) (-1298.714) [-1297.571] (-1298.307) -- 0:00:49 233500 -- [-1298.603] (-1300.338) (-1300.563) (-1299.376) * (-1298.075) (-1300.267) [-1298.797] (-1298.546) -- 0:00:49 234000 -- [-1298.702] (-1300.527) (-1299.888) (-1298.754) * [-1300.285] (-1300.115) (-1298.462) (-1298.335) -- 0:00:49 234500 -- (-1301.368) (-1299.335) (-1301.847) [-1298.659] * [-1302.927] (-1301.096) (-1299.091) (-1298.295) -- 0:00:48 235000 -- (-1300.174) [-1298.547] (-1298.042) (-1299.547) * (-1300.850) (-1302.648) (-1301.022) [-1297.492] -- 0:00:48 Average standard deviation of split frequencies: 0.016821 235500 -- (-1298.981) (-1299.032) [-1297.509] (-1301.125) * (-1299.091) (-1300.520) [-1300.600] (-1298.360) -- 0:00:48 236000 -- (-1299.406) [-1302.769] (-1297.956) (-1300.199) * (-1297.401) (-1300.396) [-1298.835] (-1298.380) -- 0:00:48 236500 -- (-1300.287) (-1298.181) [-1299.063] (-1299.210) * (-1298.038) (-1298.930) [-1298.828] (-1300.204) -- 0:00:48 237000 -- (-1298.889) [-1300.744] (-1300.335) (-1305.797) * (-1297.672) (-1297.755) (-1298.311) [-1300.077] -- 0:00:48 237500 -- (-1298.891) [-1297.457] (-1300.266) (-1300.827) * (-1298.045) (-1297.356) (-1298.338) [-1299.430] -- 0:00:48 238000 -- (-1298.818) (-1303.083) (-1298.993) [-1299.195] * (-1299.579) (-1299.122) (-1304.649) [-1299.777] -- 0:00:48 238500 -- (-1298.883) [-1301.459] (-1299.508) (-1300.549) * (-1299.205) [-1298.739] (-1298.644) (-1300.261) -- 0:00:47 239000 -- (-1301.301) (-1300.555) (-1299.073) [-1301.921] * [-1297.780] (-1299.560) (-1299.398) (-1300.339) -- 0:00:47 239500 -- (-1299.806) (-1300.691) (-1302.597) [-1298.236] * (-1299.376) (-1297.950) [-1304.133] (-1300.145) -- 0:00:47 240000 -- (-1298.877) (-1301.377) (-1300.622) [-1297.794] * (-1298.059) (-1297.985) (-1302.617) [-1300.421] -- 0:00:47 Average standard deviation of split frequencies: 0.016214 240500 -- [-1299.635] (-1299.801) (-1301.008) (-1302.180) * [-1297.908] (-1298.274) (-1299.052) (-1300.127) -- 0:00:47 241000 -- (-1300.645) (-1300.715) (-1300.380) [-1298.249] * [-1298.971] (-1298.647) (-1300.634) (-1300.485) -- 0:00:47 241500 -- (-1301.882) (-1305.712) [-1301.704] (-1298.231) * (-1300.759) (-1299.651) [-1297.473] (-1297.669) -- 0:00:50 242000 -- (-1300.721) [-1300.699] (-1305.348) (-1297.232) * (-1300.346) (-1299.576) (-1299.907) [-1299.454] -- 0:00:50 242500 -- (-1301.273) (-1300.058) [-1299.552] (-1297.755) * (-1299.348) [-1300.054] (-1298.681) (-1301.229) -- 0:00:49 243000 -- (-1303.784) [-1299.874] (-1300.989) (-1298.900) * (-1297.482) (-1301.301) [-1297.923] (-1301.248) -- 0:00:49 243500 -- [-1302.476] (-1300.205) (-1303.486) (-1297.854) * (-1297.628) (-1300.308) [-1298.437] (-1302.418) -- 0:00:49 244000 -- (-1299.969) (-1299.689) (-1300.770) [-1301.803] * (-1297.540) (-1298.673) [-1297.555] (-1299.250) -- 0:00:49 244500 -- [-1299.255] (-1300.050) (-1298.850) (-1300.143) * (-1297.710) (-1299.629) [-1297.717] (-1299.062) -- 0:00:49 245000 -- (-1297.416) (-1301.531) (-1299.187) [-1298.087] * (-1297.320) (-1300.261) (-1299.480) [-1300.089] -- 0:00:49 Average standard deviation of split frequencies: 0.016036 245500 -- (-1300.288) (-1298.522) (-1298.848) [-1299.396] * (-1299.790) (-1298.573) [-1298.882] (-1301.421) -- 0:00:49 246000 -- [-1301.054] (-1302.806) (-1299.155) (-1299.903) * [-1298.055] (-1298.328) (-1301.910) (-1298.581) -- 0:00:49 246500 -- [-1300.678] (-1302.280) (-1299.351) (-1298.474) * (-1298.495) (-1298.103) (-1302.893) [-1297.718] -- 0:00:48 247000 -- (-1297.405) (-1304.909) [-1298.487] (-1301.250) * [-1299.310] (-1300.133) (-1299.531) (-1298.377) -- 0:00:48 247500 -- (-1299.183) [-1297.485] (-1300.848) (-1298.442) * [-1297.807] (-1302.466) (-1298.664) (-1297.766) -- 0:00:48 248000 -- (-1298.415) (-1297.009) (-1301.599) [-1298.718] * (-1298.419) (-1299.602) (-1299.083) [-1301.320] -- 0:00:48 248500 -- (-1299.063) (-1297.004) (-1300.792) [-1299.287] * (-1303.211) (-1297.582) [-1297.833] (-1297.787) -- 0:00:48 249000 -- (-1300.865) (-1297.283) (-1299.279) [-1298.963] * (-1303.784) (-1297.582) [-1297.782] (-1298.305) -- 0:00:48 249500 -- (-1302.017) (-1297.576) [-1303.501] (-1307.072) * (-1298.302) [-1297.574] (-1298.252) (-1299.603) -- 0:00:48 250000 -- (-1300.512) (-1299.006) (-1305.628) [-1301.678] * (-1299.004) (-1298.532) (-1298.222) [-1298.073] -- 0:00:48 Average standard deviation of split frequencies: 0.015985 250500 -- (-1300.285) (-1298.424) [-1301.184] (-1299.352) * (-1299.695) (-1301.291) (-1300.180) [-1298.073] -- 0:00:47 251000 -- (-1300.255) [-1297.407] (-1301.737) (-1303.242) * [-1298.548] (-1301.977) (-1300.154) (-1299.829) -- 0:00:47 251500 -- (-1300.597) [-1297.267] (-1301.559) (-1307.656) * [-1299.320] (-1298.072) (-1298.260) (-1298.168) -- 0:00:47 252000 -- [-1298.466] (-1298.155) (-1301.491) (-1305.685) * [-1298.404] (-1299.319) (-1299.653) (-1302.629) -- 0:00:47 252500 -- (-1300.365) [-1298.760] (-1300.943) (-1300.150) * (-1298.394) (-1300.573) (-1298.466) [-1301.105] -- 0:00:47 253000 -- (-1301.294) (-1297.424) [-1300.080] (-1300.039) * (-1297.970) [-1302.421] (-1297.874) (-1304.872) -- 0:00:47 253500 -- (-1300.192) (-1298.514) (-1299.541) [-1299.891] * [-1300.888] (-1303.093) (-1299.345) (-1300.998) -- 0:00:47 254000 -- (-1297.549) (-1297.488) (-1300.143) [-1299.121] * (-1311.240) [-1300.738] (-1299.786) (-1304.083) -- 0:00:46 254500 -- [-1297.446] (-1298.812) (-1298.405) (-1298.092) * [-1298.491] (-1300.108) (-1298.339) (-1299.812) -- 0:00:46 255000 -- [-1297.990] (-1297.576) (-1298.553) (-1299.615) * (-1297.892) (-1298.007) (-1297.601) [-1299.807] -- 0:00:46 Average standard deviation of split frequencies: 0.016164 255500 -- (-1299.161) (-1298.311) (-1299.966) [-1297.742] * (-1298.135) [-1298.455] (-1298.199) (-1300.533) -- 0:00:46 256000 -- [-1298.584] (-1299.035) (-1297.636) (-1297.784) * (-1298.165) [-1298.045] (-1298.866) (-1299.982) -- 0:00:46 256500 -- (-1300.082) (-1300.346) [-1297.599] (-1297.623) * (-1298.817) (-1299.782) [-1299.496] (-1301.066) -- 0:00:46 257000 -- (-1300.866) (-1297.893) (-1297.970) [-1300.223] * [-1300.221] (-1298.034) (-1299.521) (-1299.836) -- 0:00:46 257500 -- [-1300.079] (-1298.531) (-1299.116) (-1298.842) * (-1300.381) [-1298.034] (-1298.859) (-1300.682) -- 0:00:49 258000 -- (-1299.863) [-1299.080] (-1297.744) (-1303.161) * (-1298.624) [-1300.436] (-1299.741) (-1302.182) -- 0:00:48 258500 -- (-1298.559) [-1299.392] (-1301.847) (-1297.665) * (-1298.983) (-1298.709) [-1302.433] (-1300.407) -- 0:00:48 259000 -- (-1301.695) [-1302.561] (-1299.540) (-1300.645) * [-1298.790] (-1297.893) (-1300.345) (-1299.789) -- 0:00:48 259500 -- (-1298.248) (-1300.412) [-1297.726] (-1298.783) * [-1297.529] (-1299.117) (-1298.780) (-1298.014) -- 0:00:48 260000 -- (-1301.669) (-1300.252) [-1299.874] (-1298.789) * (-1297.700) [-1302.506] (-1297.746) (-1300.084) -- 0:00:48 Average standard deviation of split frequencies: 0.014367 260500 -- (-1296.925) (-1298.837) [-1299.414] (-1297.921) * [-1299.946] (-1300.188) (-1297.987) (-1299.603) -- 0:00:48 261000 -- (-1297.316) [-1300.180] (-1300.817) (-1298.926) * [-1301.658] (-1300.271) (-1297.460) (-1301.374) -- 0:00:48 261500 -- (-1304.525) [-1302.533] (-1299.210) (-1300.866) * (-1298.094) (-1299.097) (-1297.688) [-1300.920] -- 0:00:48 262000 -- (-1300.752) (-1302.759) [-1299.272] (-1298.366) * (-1298.852) [-1299.179] (-1298.896) (-1301.972) -- 0:00:47 262500 -- (-1298.086) [-1298.594] (-1302.489) (-1299.038) * (-1298.433) (-1304.520) (-1298.128) [-1300.787] -- 0:00:47 263000 -- (-1298.036) (-1298.492) [-1300.804] (-1300.031) * (-1298.580) (-1302.194) [-1298.163] (-1300.910) -- 0:00:47 263500 -- (-1300.981) [-1298.666] (-1302.481) (-1299.199) * (-1300.398) (-1302.998) [-1298.122] (-1303.945) -- 0:00:47 264000 -- [-1298.138] (-1303.594) (-1299.734) (-1297.239) * (-1302.327) (-1303.967) [-1298.229] (-1307.036) -- 0:00:47 264500 -- (-1297.678) (-1297.918) [-1297.911] (-1298.444) * (-1299.747) (-1299.318) [-1298.863] (-1298.145) -- 0:00:47 265000 -- [-1299.142] (-1298.262) (-1300.521) (-1299.711) * (-1298.424) (-1299.394) (-1301.804) [-1297.959] -- 0:00:47 Average standard deviation of split frequencies: 0.014457 265500 -- [-1298.520] (-1301.894) (-1300.300) (-1301.594) * (-1302.192) [-1300.076] (-1299.409) (-1297.761) -- 0:00:47 266000 -- (-1297.948) [-1297.602] (-1300.388) (-1306.629) * [-1301.792] (-1302.809) (-1297.760) (-1303.939) -- 0:00:46 266500 -- [-1297.631] (-1300.167) (-1298.065) (-1302.813) * (-1303.527) [-1298.691] (-1301.476) (-1300.346) -- 0:00:46 267000 -- (-1299.101) (-1297.998) [-1297.019] (-1304.225) * (-1303.346) (-1299.126) (-1298.751) [-1298.778] -- 0:00:46 267500 -- (-1299.121) [-1298.217] (-1297.777) (-1303.511) * (-1297.991) [-1298.723] (-1298.139) (-1297.519) -- 0:00:46 268000 -- (-1299.977) [-1300.130] (-1297.968) (-1299.680) * (-1301.683) (-1298.829) [-1298.548] (-1298.774) -- 0:00:46 268500 -- [-1298.257] (-1302.458) (-1298.849) (-1299.550) * (-1298.291) (-1298.638) [-1298.845] (-1299.371) -- 0:00:46 269000 -- (-1300.009) (-1298.909) [-1298.354] (-1301.548) * (-1300.621) (-1299.413) [-1297.393] (-1299.821) -- 0:00:46 269500 -- [-1298.009] (-1299.093) (-1298.562) (-1301.334) * (-1300.667) (-1301.866) [-1300.050] (-1300.262) -- 0:00:46 270000 -- [-1300.816] (-1300.370) (-1299.410) (-1298.524) * [-1301.606] (-1301.368) (-1300.346) (-1305.228) -- 0:00:45 Average standard deviation of split frequencies: 0.014666 270500 -- [-1300.356] (-1298.604) (-1300.371) (-1298.516) * [-1300.876] (-1298.263) (-1297.980) (-1298.540) -- 0:00:45 271000 -- (-1298.735) (-1297.900) [-1299.401] (-1299.898) * (-1297.813) (-1297.931) [-1298.481] (-1299.131) -- 0:00:45 271500 -- (-1298.614) (-1298.433) [-1298.445] (-1300.796) * [-1299.132] (-1297.974) (-1297.147) (-1298.279) -- 0:00:45 272000 -- (-1301.060) [-1300.002] (-1299.640) (-1302.848) * [-1298.729] (-1297.864) (-1297.281) (-1299.641) -- 0:00:45 272500 -- (-1299.110) [-1297.873] (-1300.593) (-1297.571) * (-1301.638) [-1297.545] (-1298.037) (-1297.766) -- 0:00:45 273000 -- (-1301.928) (-1298.502) (-1299.069) [-1299.366] * (-1299.730) [-1297.422] (-1298.669) (-1297.139) -- 0:00:45 273500 -- (-1304.631) (-1297.498) (-1298.789) [-1300.048] * (-1298.861) (-1298.568) (-1301.051) [-1297.198] -- 0:00:45 274000 -- [-1300.321] (-1298.970) (-1298.411) (-1297.613) * (-1298.785) (-1298.972) (-1299.585) [-1297.578] -- 0:00:47 274500 -- [-1303.788] (-1297.326) (-1300.063) (-1300.098) * (-1299.648) (-1300.694) [-1297.887] (-1300.399) -- 0:00:47 275000 -- (-1300.938) [-1297.305] (-1301.322) (-1297.764) * (-1303.758) (-1301.928) [-1298.649] (-1299.516) -- 0:00:47 Average standard deviation of split frequencies: 0.014897 275500 -- [-1302.781] (-1301.078) (-1299.981) (-1297.856) * (-1300.061) [-1297.584] (-1301.044) (-1301.554) -- 0:00:47 276000 -- [-1301.060] (-1300.357) (-1308.142) (-1300.137) * [-1302.001] (-1299.421) (-1298.909) (-1300.017) -- 0:00:47 276500 -- (-1299.053) [-1298.669] (-1297.473) (-1301.421) * (-1299.714) [-1298.600] (-1301.795) (-1301.204) -- 0:00:47 277000 -- (-1297.597) (-1298.495) [-1297.468] (-1299.830) * (-1298.690) [-1298.169] (-1300.179) (-1300.702) -- 0:00:46 277500 -- (-1298.901) (-1298.584) [-1297.856] (-1299.358) * [-1300.127] (-1300.561) (-1299.644) (-1302.600) -- 0:00:46 278000 -- (-1297.276) (-1299.449) (-1299.485) [-1298.448] * [-1298.964] (-1298.699) (-1301.143) (-1306.405) -- 0:00:46 278500 -- (-1297.655) [-1300.723] (-1297.690) (-1302.042) * (-1299.599) [-1298.646] (-1301.900) (-1302.604) -- 0:00:46 279000 -- (-1299.361) (-1300.067) [-1297.959] (-1298.836) * (-1302.761) [-1297.667] (-1303.802) (-1301.056) -- 0:00:46 279500 -- (-1298.884) (-1304.445) [-1299.210] (-1298.258) * (-1298.299) [-1297.088] (-1300.695) (-1297.135) -- 0:00:46 280000 -- (-1298.878) (-1298.564) (-1303.175) [-1298.129] * (-1299.148) (-1298.017) [-1299.658] (-1300.704) -- 0:00:46 Average standard deviation of split frequencies: 0.013832 280500 -- (-1298.437) (-1298.611) (-1297.497) [-1301.763] * [-1298.628] (-1297.962) (-1299.186) (-1297.760) -- 0:00:46 281000 -- (-1297.189) (-1298.929) [-1303.373] (-1300.322) * (-1298.821) (-1297.630) [-1297.968] (-1297.625) -- 0:00:46 281500 -- (-1298.217) (-1299.711) [-1298.371] (-1298.341) * (-1301.072) [-1297.638] (-1297.909) (-1298.740) -- 0:00:45 282000 -- (-1299.059) (-1299.588) [-1299.442] (-1299.061) * [-1301.102] (-1300.217) (-1299.708) (-1298.500) -- 0:00:45 282500 -- [-1300.730] (-1299.018) (-1297.421) (-1300.331) * (-1299.551) [-1298.411] (-1297.132) (-1300.240) -- 0:00:45 283000 -- (-1299.165) [-1297.918] (-1297.413) (-1297.658) * (-1300.055) (-1300.558) [-1299.518] (-1299.530) -- 0:00:45 283500 -- [-1297.772] (-1298.448) (-1297.702) (-1297.655) * (-1300.361) [-1298.964] (-1297.448) (-1297.893) -- 0:00:45 284000 -- (-1300.330) [-1299.970] (-1300.233) (-1297.418) * [-1300.278] (-1297.844) (-1297.843) (-1297.909) -- 0:00:45 284500 -- (-1299.530) [-1299.002] (-1300.965) (-1297.320) * (-1298.369) (-1300.718) [-1298.140] (-1298.952) -- 0:00:45 285000 -- (-1298.714) (-1298.237) (-1299.107) [-1299.672] * [-1299.464] (-1298.578) (-1298.600) (-1300.403) -- 0:00:45 Average standard deviation of split frequencies: 0.014544 285500 -- [-1298.455] (-1297.250) (-1298.496) (-1298.183) * (-1298.455) (-1300.719) [-1297.638] (-1299.315) -- 0:00:45 286000 -- (-1299.161) (-1297.281) [-1297.280] (-1298.236) * [-1298.340] (-1298.367) (-1297.688) (-1299.368) -- 0:00:44 286500 -- [-1301.250] (-1297.322) (-1298.133) (-1303.422) * (-1297.489) (-1300.488) [-1297.815] (-1298.850) -- 0:00:44 287000 -- (-1297.978) (-1303.946) [-1299.836] (-1302.714) * (-1301.173) [-1303.672] (-1297.974) (-1301.226) -- 0:00:44 287500 -- (-1301.767) (-1299.310) (-1298.416) [-1300.477] * (-1302.275) (-1297.650) (-1297.325) [-1299.289] -- 0:00:44 288000 -- (-1302.116) [-1299.291] (-1299.491) (-1300.960) * (-1308.224) (-1298.453) (-1297.403) [-1299.303] -- 0:00:44 288500 -- (-1300.816) (-1297.891) (-1298.914) [-1299.526] * (-1301.264) (-1298.779) [-1298.388] (-1301.987) -- 0:00:46 289000 -- (-1299.085) (-1300.703) [-1297.866] (-1299.340) * (-1305.326) (-1298.491) [-1297.716] (-1298.473) -- 0:00:46 289500 -- (-1297.791) (-1302.793) [-1298.664] (-1306.811) * (-1299.739) (-1298.267) [-1297.550] (-1297.912) -- 0:00:46 290000 -- (-1299.412) (-1301.992) [-1298.610] (-1302.715) * (-1299.744) (-1297.245) (-1298.886) [-1299.075] -- 0:00:46 Average standard deviation of split frequencies: 0.014692 290500 -- (-1296.826) [-1299.136] (-1298.326) (-1298.774) * (-1298.702) (-1300.657) [-1299.064] (-1297.339) -- 0:00:46 291000 -- (-1299.592) (-1298.447) [-1300.698] (-1299.148) * [-1298.698] (-1297.422) (-1298.293) (-1301.259) -- 0:00:46 291500 -- (-1307.081) (-1299.363) (-1298.398) [-1299.760] * [-1297.856] (-1299.520) (-1298.452) (-1300.891) -- 0:00:46 292000 -- (-1301.994) (-1298.656) [-1298.370] (-1300.994) * (-1298.586) (-1300.939) (-1298.108) [-1301.166] -- 0:00:46 292500 -- (-1301.571) (-1298.247) [-1298.596] (-1300.353) * (-1298.384) (-1299.276) (-1299.829) [-1299.191] -- 0:00:45 293000 -- (-1300.462) (-1298.320) [-1297.578] (-1298.308) * (-1298.379) [-1300.096] (-1298.204) (-1299.133) -- 0:00:45 293500 -- (-1302.702) (-1299.715) [-1297.770] (-1298.025) * (-1297.628) (-1299.017) [-1298.699] (-1304.461) -- 0:00:45 294000 -- [-1297.495] (-1298.761) (-1298.162) (-1297.107) * (-1298.693) (-1297.773) [-1298.054] (-1301.287) -- 0:00:45 294500 -- (-1298.506) (-1297.485) [-1300.426] (-1301.187) * [-1299.703] (-1297.762) (-1297.736) (-1301.313) -- 0:00:45 295000 -- (-1298.782) (-1300.270) [-1298.157] (-1302.458) * (-1298.619) [-1298.684] (-1297.724) (-1300.291) -- 0:00:45 Average standard deviation of split frequencies: 0.015270 295500 -- [-1297.988] (-1300.215) (-1298.156) (-1301.626) * (-1299.562) [-1298.213] (-1299.589) (-1301.790) -- 0:00:45 296000 -- (-1298.100) (-1299.109) [-1301.232] (-1301.657) * (-1298.466) (-1299.841) (-1299.827) [-1298.009] -- 0:00:45 296500 -- (-1299.607) (-1300.118) (-1300.081) [-1299.198] * (-1297.941) (-1298.146) (-1299.415) [-1298.496] -- 0:00:45 297000 -- (-1298.136) (-1300.358) [-1298.690] (-1302.278) * [-1297.965] (-1299.542) (-1298.790) (-1298.331) -- 0:00:44 297500 -- [-1297.421] (-1299.771) (-1306.859) (-1298.085) * (-1298.238) (-1299.411) [-1304.127] (-1299.661) -- 0:00:44 298000 -- [-1297.637] (-1297.355) (-1305.358) (-1298.980) * [-1298.008] (-1302.802) (-1301.001) (-1298.473) -- 0:00:44 298500 -- (-1297.637) (-1298.494) [-1299.156] (-1298.053) * (-1298.131) (-1302.231) (-1298.370) [-1300.089] -- 0:00:44 299000 -- (-1299.487) [-1300.354] (-1303.643) (-1298.091) * [-1298.163] (-1302.239) (-1297.859) (-1299.426) -- 0:00:44 299500 -- (-1298.924) (-1298.727) [-1301.847] (-1298.249) * (-1298.359) (-1301.250) [-1297.696] (-1304.598) -- 0:00:44 300000 -- (-1299.383) [-1300.454] (-1300.442) (-1299.310) * (-1298.480) (-1299.627) [-1299.903] (-1302.063) -- 0:00:44 Average standard deviation of split frequencies: 0.015033 300500 -- [-1298.760] (-1300.749) (-1299.857) (-1298.701) * [-1300.654] (-1297.711) (-1299.377) (-1300.698) -- 0:00:44 301000 -- [-1300.983] (-1297.671) (-1300.819) (-1300.787) * (-1297.848) (-1302.756) (-1298.720) [-1300.913] -- 0:00:44 301500 -- [-1301.053] (-1298.795) (-1302.702) (-1302.761) * (-1297.540) (-1299.837) (-1299.290) [-1299.552] -- 0:00:44 302000 -- (-1301.747) (-1298.451) (-1297.751) [-1297.599] * [-1299.346] (-1299.534) (-1299.520) (-1298.115) -- 0:00:43 302500 -- (-1299.936) [-1299.006] (-1299.544) (-1297.529) * [-1299.543] (-1299.633) (-1303.116) (-1298.731) -- 0:00:43 303000 -- (-1300.634) [-1299.465] (-1302.027) (-1299.085) * (-1298.312) [-1297.856] (-1302.493) (-1297.856) -- 0:00:43 303500 -- (-1301.194) [-1298.635] (-1299.216) (-1298.642) * [-1297.763] (-1297.420) (-1306.299) (-1297.920) -- 0:00:43 304000 -- (-1299.974) (-1299.829) [-1300.280] (-1300.012) * [-1299.791] (-1306.839) (-1302.793) (-1299.204) -- 0:00:45 304500 -- (-1299.974) (-1299.990) (-1299.476) [-1297.605] * (-1303.432) (-1300.632) [-1300.083] (-1301.267) -- 0:00:45 305000 -- (-1298.819) (-1300.125) (-1298.504) [-1297.622] * [-1297.616] (-1299.027) (-1299.125) (-1300.646) -- 0:00:45 Average standard deviation of split frequencies: 0.015496 305500 -- (-1299.197) (-1298.317) (-1299.570) [-1297.212] * (-1296.956) (-1299.680) (-1298.880) [-1299.171] -- 0:00:45 306000 -- (-1297.396) (-1298.632) [-1300.228] (-1297.858) * [-1300.262] (-1299.496) (-1300.510) (-1300.332) -- 0:00:45 306500 -- [-1298.685] (-1298.676) (-1301.547) (-1299.786) * (-1300.954) [-1298.796] (-1301.212) (-1298.768) -- 0:00:45 307000 -- (-1301.967) (-1299.343) [-1301.216] (-1299.025) * (-1301.725) (-1298.545) [-1298.890] (-1298.446) -- 0:00:45 307500 -- (-1298.641) (-1300.093) [-1301.441] (-1299.105) * (-1303.956) [-1301.348] (-1298.571) (-1302.172) -- 0:00:45 308000 -- (-1298.941) (-1298.289) [-1299.273] (-1300.921) * (-1301.708) [-1302.544] (-1299.716) (-1298.606) -- 0:00:44 308500 -- (-1299.573) (-1300.345) (-1300.665) [-1298.565] * (-1300.617) (-1299.211) [-1299.484] (-1300.607) -- 0:00:44 309000 -- (-1298.242) [-1298.747] (-1298.665) (-1298.530) * (-1299.529) (-1300.112) [-1300.945] (-1303.274) -- 0:00:44 309500 -- [-1298.348] (-1298.925) (-1297.917) (-1299.571) * (-1298.471) [-1298.326] (-1302.844) (-1304.265) -- 0:00:44 310000 -- (-1298.279) [-1301.140] (-1298.489) (-1299.208) * (-1302.099) [-1297.918] (-1299.820) (-1301.038) -- 0:00:44 Average standard deviation of split frequencies: 0.016156 310500 -- [-1299.882] (-1299.494) (-1298.134) (-1300.108) * (-1299.785) [-1298.208] (-1299.061) (-1297.567) -- 0:00:44 311000 -- (-1300.415) (-1301.354) (-1305.450) [-1300.384] * (-1299.700) (-1297.265) (-1299.254) [-1298.881] -- 0:00:44 311500 -- (-1299.642) [-1302.970] (-1299.786) (-1299.546) * (-1300.557) [-1299.566] (-1298.302) (-1298.043) -- 0:00:44 312000 -- (-1302.406) (-1301.764) [-1297.414] (-1299.433) * [-1300.363] (-1301.112) (-1303.655) (-1299.851) -- 0:00:44 312500 -- (-1306.313) (-1303.420) [-1299.117] (-1300.017) * (-1300.601) (-1301.155) (-1299.835) [-1299.715] -- 0:00:44 313000 -- (-1302.897) [-1298.717] (-1297.591) (-1302.363) * (-1300.263) (-1300.760) (-1299.488) [-1299.743] -- 0:00:43 313500 -- (-1299.410) (-1302.298) [-1298.329] (-1302.399) * (-1298.355) (-1303.359) (-1300.610) [-1298.901] -- 0:00:43 314000 -- (-1300.371) (-1301.825) (-1302.232) [-1299.065] * (-1298.562) (-1307.534) (-1301.274) [-1300.036] -- 0:00:43 314500 -- (-1299.448) (-1299.143) [-1303.577] (-1299.486) * (-1297.917) [-1300.132] (-1303.359) (-1298.516) -- 0:00:43 315000 -- [-1298.844] (-1298.492) (-1299.554) (-1302.097) * (-1298.148) [-1297.675] (-1301.294) (-1298.856) -- 0:00:43 Average standard deviation of split frequencies: 0.016936 315500 -- (-1301.593) (-1298.552) (-1303.382) [-1298.583] * (-1298.279) [-1297.624] (-1301.278) (-1297.870) -- 0:00:43 316000 -- (-1298.419) [-1303.181] (-1304.794) (-1297.538) * (-1302.091) (-1299.568) [-1299.782] (-1298.692) -- 0:00:43 316500 -- (-1299.950) [-1301.664] (-1297.795) (-1298.297) * [-1299.619] (-1300.832) (-1301.653) (-1299.501) -- 0:00:43 317000 -- (-1302.546) (-1301.161) [-1298.709] (-1297.777) * [-1299.015] (-1299.093) (-1301.003) (-1299.714) -- 0:00:43 317500 -- [-1299.436] (-1299.690) (-1299.968) (-1297.755) * [-1298.981] (-1298.772) (-1302.813) (-1299.933) -- 0:00:42 318000 -- (-1298.823) (-1300.753) (-1300.278) [-1300.215] * (-1299.324) [-1299.439] (-1300.077) (-1299.021) -- 0:00:42 318500 -- (-1300.935) [-1299.391] (-1302.543) (-1302.630) * (-1300.711) (-1300.262) [-1298.159] (-1298.193) -- 0:00:42 319000 -- (-1298.734) (-1301.566) (-1302.052) [-1300.493] * (-1301.458) [-1301.677] (-1301.401) (-1297.570) -- 0:00:42 319500 -- (-1297.069) [-1304.368] (-1300.467) (-1301.750) * [-1299.254] (-1297.956) (-1300.398) (-1297.994) -- 0:00:42 320000 -- (-1299.594) [-1300.561] (-1300.858) (-1300.196) * (-1300.190) (-1297.902) [-1302.394] (-1299.383) -- 0:00:44 Average standard deviation of split frequencies: 0.017554 320500 -- (-1299.766) (-1300.979) [-1298.934] (-1301.461) * (-1298.700) [-1298.305] (-1301.631) (-1298.512) -- 0:00:44 321000 -- (-1299.297) (-1302.167) [-1297.785] (-1300.830) * [-1299.270] (-1297.705) (-1300.422) (-1300.192) -- 0:00:44 321500 -- (-1299.323) (-1298.618) (-1299.884) [-1300.072] * [-1299.829] (-1299.108) (-1299.171) (-1298.625) -- 0:00:44 322000 -- (-1299.352) (-1299.087) [-1298.359] (-1300.471) * (-1299.737) (-1300.193) [-1299.305] (-1299.700) -- 0:00:44 322500 -- (-1303.381) [-1299.109] (-1299.185) (-1299.210) * [-1299.273] (-1299.522) (-1297.816) (-1297.209) -- 0:00:44 323000 -- (-1301.434) (-1298.734) (-1298.811) [-1298.187] * (-1299.180) (-1298.450) [-1303.542] (-1297.640) -- 0:00:44 323500 -- (-1300.229) [-1299.554] (-1297.668) (-1302.156) * (-1299.168) (-1298.011) (-1301.732) [-1298.634] -- 0:00:43 324000 -- (-1300.171) [-1299.038] (-1301.174) (-1302.998) * (-1300.226) [-1298.144] (-1298.390) (-1297.774) -- 0:00:43 324500 -- [-1297.373] (-1299.710) (-1299.067) (-1303.936) * (-1300.264) (-1298.012) (-1299.933) [-1297.751] -- 0:00:43 325000 -- (-1298.192) (-1299.320) (-1299.245) [-1298.266] * (-1300.084) (-1299.275) (-1300.590) [-1298.532] -- 0:00:43 Average standard deviation of split frequencies: 0.017267 325500 -- (-1298.354) (-1301.543) (-1302.051) [-1298.626] * (-1300.328) [-1298.893] (-1299.204) (-1298.174) -- 0:00:43 326000 -- (-1297.304) [-1298.859] (-1298.423) (-1297.595) * [-1298.627] (-1299.765) (-1298.374) (-1297.897) -- 0:00:43 326500 -- [-1299.481] (-1298.515) (-1297.573) (-1303.674) * (-1297.709) (-1301.094) (-1299.000) [-1298.432] -- 0:00:43 327000 -- (-1300.524) (-1298.774) (-1297.509) [-1298.139] * (-1301.266) (-1302.647) [-1298.053] (-1300.349) -- 0:00:43 327500 -- [-1302.981] (-1299.889) (-1304.018) (-1300.392) * [-1300.488] (-1302.567) (-1297.064) (-1297.799) -- 0:00:43 328000 -- (-1302.321) (-1300.729) [-1300.347] (-1303.274) * [-1304.086] (-1297.755) (-1298.609) (-1298.906) -- 0:00:43 328500 -- (-1302.262) [-1301.445] (-1300.614) (-1300.792) * (-1302.090) [-1297.819] (-1300.028) (-1301.058) -- 0:00:42 329000 -- (-1303.311) (-1297.963) (-1297.516) [-1300.174] * (-1300.185) (-1298.569) (-1299.899) [-1299.475] -- 0:00:42 329500 -- (-1312.281) (-1297.567) [-1297.817] (-1298.096) * (-1304.210) (-1302.039) (-1299.470) [-1300.698] -- 0:00:42 330000 -- (-1298.750) (-1299.312) (-1298.530) [-1298.827] * (-1304.225) (-1301.930) [-1300.020] (-1298.251) -- 0:00:42 Average standard deviation of split frequencies: 0.018622 330500 -- [-1298.431] (-1299.970) (-1300.095) (-1299.746) * (-1303.564) (-1300.370) [-1300.429] (-1298.569) -- 0:00:42 331000 -- (-1298.125) (-1299.247) (-1303.328) [-1300.673] * [-1301.702] (-1299.518) (-1299.394) (-1299.219) -- 0:00:42 331500 -- (-1298.810) (-1300.065) (-1299.326) [-1303.222] * [-1299.033] (-1299.987) (-1302.046) (-1299.373) -- 0:00:42 332000 -- (-1299.604) [-1297.720] (-1298.364) (-1299.602) * (-1298.975) [-1297.989] (-1299.460) (-1300.210) -- 0:00:42 332500 -- [-1298.093] (-1297.646) (-1297.965) (-1300.556) * [-1299.066] (-1297.877) (-1301.389) (-1299.809) -- 0:00:42 333000 -- (-1300.068) [-1297.971] (-1297.461) (-1300.541) * [-1299.413] (-1299.283) (-1298.492) (-1306.343) -- 0:00:42 333500 -- (-1298.493) (-1301.237) [-1297.012] (-1300.592) * (-1298.582) (-1297.162) [-1300.538] (-1304.680) -- 0:00:41 334000 -- (-1302.966) (-1304.037) [-1297.050] (-1300.646) * (-1299.083) (-1298.451) [-1301.459] (-1297.952) -- 0:00:41 334500 -- [-1298.042] (-1298.633) (-1299.085) (-1300.601) * [-1300.741] (-1298.386) (-1298.872) (-1298.459) -- 0:00:41 335000 -- (-1303.003) (-1303.105) [-1299.201] (-1302.180) * (-1300.797) (-1297.632) (-1299.084) [-1300.073] -- 0:00:41 Average standard deviation of split frequencies: 0.017976 335500 -- (-1303.915) [-1304.563] (-1299.691) (-1301.981) * (-1297.740) (-1298.255) [-1297.332] (-1302.263) -- 0:00:41 336000 -- (-1300.960) (-1306.059) (-1301.627) [-1300.749] * [-1298.000] (-1300.377) (-1300.663) (-1300.704) -- 0:00:43 336500 -- [-1298.782] (-1301.347) (-1300.262) (-1298.519) * (-1297.643) (-1301.159) (-1301.352) [-1298.229] -- 0:00:43 337000 -- (-1298.921) [-1299.625] (-1300.106) (-1298.485) * (-1299.320) [-1299.509] (-1298.764) (-1297.505) -- 0:00:43 337500 -- (-1299.172) (-1300.114) [-1298.113] (-1299.115) * (-1298.381) (-1298.882) (-1298.874) [-1298.022] -- 0:00:43 338000 -- (-1302.016) (-1300.896) [-1299.265] (-1298.265) * (-1297.802) (-1298.379) (-1298.075) [-1298.486] -- 0:00:43 338500 -- (-1303.420) (-1301.590) (-1298.577) [-1298.590] * [-1298.877] (-1299.620) (-1298.187) (-1298.082) -- 0:00:42 339000 -- (-1303.986) (-1303.570) (-1299.478) [-1299.311] * (-1298.476) (-1299.688) (-1297.922) [-1297.413] -- 0:00:42 339500 -- (-1299.665) [-1298.320] (-1298.966) (-1298.160) * (-1298.358) [-1299.857] (-1299.743) (-1298.335) -- 0:00:42 340000 -- [-1300.584] (-1298.683) (-1298.324) (-1298.663) * (-1301.119) [-1299.748] (-1299.598) (-1298.018) -- 0:00:42 Average standard deviation of split frequencies: 0.017989 340500 -- (-1298.566) (-1300.118) [-1298.175] (-1299.651) * (-1301.589) [-1299.622] (-1298.888) (-1297.466) -- 0:00:42 341000 -- (-1298.097) [-1300.475] (-1298.236) (-1299.854) * (-1299.882) (-1300.221) [-1299.881] (-1298.796) -- 0:00:42 341500 -- (-1297.833) (-1300.810) (-1302.634) [-1298.342] * (-1299.691) (-1299.558) [-1298.786] (-1299.667) -- 0:00:42 342000 -- (-1298.990) [-1300.060] (-1299.915) (-1300.450) * (-1301.842) (-1299.511) [-1299.574] (-1302.133) -- 0:00:42 342500 -- [-1298.999] (-1299.249) (-1303.822) (-1301.366) * (-1299.777) [-1299.116] (-1300.430) (-1298.104) -- 0:00:42 343000 -- (-1300.109) [-1299.057] (-1303.526) (-1298.618) * (-1298.361) (-1298.938) [-1299.630] (-1300.039) -- 0:00:42 343500 -- (-1299.358) (-1299.612) (-1301.631) [-1297.673] * (-1300.190) (-1298.641) (-1299.642) [-1298.409] -- 0:00:42 344000 -- [-1301.796] (-1308.814) (-1301.754) (-1298.999) * (-1305.876) (-1297.911) (-1298.894) [-1300.889] -- 0:00:41 344500 -- (-1298.319) (-1300.548) [-1297.933] (-1298.416) * (-1303.726) (-1297.537) [-1298.228] (-1300.169) -- 0:00:41 345000 -- (-1300.564) (-1300.141) (-1300.461) [-1298.495] * (-1298.712) (-1297.829) [-1298.085] (-1298.550) -- 0:00:41 Average standard deviation of split frequencies: 0.018904 345500 -- (-1298.718) [-1298.265] (-1301.690) (-1297.786) * (-1297.694) (-1298.231) [-1298.757] (-1299.774) -- 0:00:41 346000 -- (-1301.867) [-1298.210] (-1298.554) (-1297.957) * [-1297.740] (-1297.328) (-1302.004) (-1298.673) -- 0:00:41 346500 -- [-1301.188] (-1302.135) (-1297.585) (-1298.433) * (-1297.981) (-1297.809) [-1300.025] (-1298.890) -- 0:00:41 347000 -- (-1300.666) [-1300.932] (-1303.489) (-1298.484) * (-1297.621) [-1297.710] (-1298.822) (-1298.984) -- 0:00:41 347500 -- [-1302.361] (-1299.711) (-1299.167) (-1297.699) * (-1298.877) [-1298.724] (-1301.107) (-1300.542) -- 0:00:41 348000 -- (-1297.286) [-1298.760] (-1300.225) (-1300.573) * (-1302.500) [-1298.227] (-1299.934) (-1301.649) -- 0:00:41 348500 -- (-1297.195) [-1298.747] (-1300.117) (-1299.531) * (-1298.627) (-1298.013) [-1301.154] (-1298.917) -- 0:00:41 349000 -- (-1297.016) (-1298.797) [-1299.256] (-1300.341) * (-1301.795) [-1299.585] (-1297.981) (-1301.160) -- 0:00:41 349500 -- (-1297.004) (-1298.816) [-1300.404] (-1302.500) * (-1300.689) (-1299.734) (-1298.251) [-1301.368] -- 0:00:40 350000 -- [-1301.069] (-1300.287) (-1300.090) (-1300.435) * [-1306.786] (-1299.809) (-1297.784) (-1300.043) -- 0:00:40 Average standard deviation of split frequencies: 0.018988 350500 -- (-1298.679) [-1303.044] (-1299.029) (-1301.298) * (-1301.747) (-1301.191) (-1299.320) [-1299.986] -- 0:00:42 351000 -- (-1299.442) (-1305.499) [-1298.437] (-1299.108) * (-1300.185) (-1303.249) (-1298.911) [-1300.758] -- 0:00:42 351500 -- (-1299.405) [-1297.934] (-1298.288) (-1301.201) * (-1300.293) [-1301.793] (-1299.121) (-1302.626) -- 0:00:42 352000 -- (-1300.584) (-1297.762) [-1298.070] (-1299.637) * (-1301.082) (-1299.680) [-1300.265] (-1302.759) -- 0:00:42 352500 -- (-1302.054) (-1297.763) [-1297.649] (-1297.456) * (-1298.467) (-1298.861) (-1299.109) [-1301.788] -- 0:00:42 353000 -- (-1302.457) (-1297.763) (-1298.664) [-1298.877] * (-1299.143) (-1299.669) [-1301.421] (-1299.164) -- 0:00:42 353500 -- (-1301.036) [-1299.168] (-1299.080) (-1303.374) * (-1299.906) (-1297.768) (-1301.699) [-1298.379] -- 0:00:42 354000 -- (-1302.971) (-1303.846) [-1301.844] (-1302.916) * (-1304.117) (-1299.102) [-1301.023] (-1297.174) -- 0:00:41 354500 -- (-1300.763) [-1300.866] (-1299.546) (-1302.309) * (-1302.316) [-1298.977] (-1299.936) (-1300.495) -- 0:00:41 355000 -- (-1298.477) (-1300.258) [-1298.111] (-1299.510) * (-1297.767) (-1298.774) [-1299.793] (-1298.605) -- 0:00:41 Average standard deviation of split frequencies: 0.018456 355500 -- [-1298.077] (-1304.955) (-1299.568) (-1300.696) * (-1299.687) (-1300.220) (-1298.301) [-1301.395] -- 0:00:41 356000 -- (-1298.318) (-1298.809) [-1301.214] (-1300.128) * (-1301.897) (-1299.299) (-1298.004) [-1299.001] -- 0:00:41 356500 -- [-1300.351] (-1297.804) (-1298.144) (-1297.602) * (-1299.993) (-1301.072) (-1299.867) [-1302.517] -- 0:00:41 357000 -- (-1298.980) (-1297.185) [-1298.399] (-1298.447) * (-1298.594) [-1303.804] (-1300.373) (-1297.210) -- 0:00:41 357500 -- (-1298.302) (-1305.022) (-1298.526) [-1298.979] * (-1299.516) (-1298.321) [-1298.455] (-1300.044) -- 0:00:41 358000 -- [-1299.549] (-1301.448) (-1298.218) (-1299.029) * (-1298.565) (-1298.308) (-1299.186) [-1299.398] -- 0:00:41 358500 -- (-1298.436) (-1300.380) [-1298.521] (-1300.144) * (-1299.844) (-1298.308) (-1300.838) [-1300.154] -- 0:00:41 359000 -- (-1304.959) [-1299.398] (-1299.391) (-1299.414) * (-1298.693) (-1299.776) (-1301.502) [-1300.755] -- 0:00:41 359500 -- (-1299.561) [-1298.811] (-1299.645) (-1306.025) * (-1298.613) (-1304.220) (-1299.019) [-1298.907] -- 0:00:40 360000 -- (-1303.436) (-1299.630) [-1298.526] (-1298.808) * (-1298.393) (-1300.423) [-1297.524] (-1297.896) -- 0:00:40 Average standard deviation of split frequencies: 0.018053 360500 -- (-1299.158) [-1301.683] (-1299.047) (-1299.150) * [-1298.389] (-1300.406) (-1297.170) (-1303.106) -- 0:00:40 361000 -- (-1298.268) (-1302.404) (-1298.201) [-1300.538] * (-1298.692) (-1298.837) [-1297.173] (-1301.616) -- 0:00:40 361500 -- [-1298.451] (-1298.783) (-1303.381) (-1300.521) * (-1300.728) [-1298.166] (-1301.180) (-1301.349) -- 0:00:40 362000 -- (-1297.795) [-1298.249] (-1303.194) (-1299.661) * (-1300.254) (-1300.702) (-1298.715) [-1298.255] -- 0:00:40 362500 -- (-1298.547) (-1298.206) (-1302.431) [-1298.827] * (-1302.713) (-1300.116) (-1299.014) [-1298.611] -- 0:00:40 363000 -- [-1298.600] (-1306.863) (-1302.114) (-1301.320) * [-1298.462] (-1304.174) (-1298.161) (-1298.355) -- 0:00:40 363500 -- [-1298.069] (-1299.389) (-1303.276) (-1301.947) * (-1297.649) (-1303.838) [-1301.957] (-1298.781) -- 0:00:40 364000 -- (-1301.840) [-1301.347] (-1301.367) (-1299.289) * (-1300.231) (-1302.770) (-1298.354) [-1300.608] -- 0:00:40 364500 -- (-1299.109) [-1300.283] (-1300.203) (-1302.874) * [-1300.704] (-1299.359) (-1299.186) (-1300.467) -- 0:00:40 365000 -- (-1301.845) (-1304.432) (-1299.535) [-1301.824] * [-1299.327] (-1303.126) (-1302.161) (-1299.191) -- 0:00:40 Average standard deviation of split frequencies: 0.016592 365500 -- [-1298.452] (-1299.652) (-1299.535) (-1304.950) * (-1299.081) (-1298.363) (-1302.956) [-1299.368] -- 0:00:41 366000 -- [-1299.850] (-1302.443) (-1300.832) (-1307.011) * (-1298.783) (-1297.444) [-1298.761] (-1302.664) -- 0:00:41 366500 -- (-1297.917) (-1299.878) [-1301.029] (-1303.094) * [-1298.900] (-1299.488) (-1297.379) (-1300.103) -- 0:00:41 367000 -- (-1301.182) (-1299.047) [-1298.385] (-1299.918) * (-1298.301) [-1300.671] (-1297.364) (-1300.550) -- 0:00:41 367500 -- [-1302.049] (-1299.068) (-1301.805) (-1300.816) * (-1298.426) (-1299.773) (-1301.195) [-1299.598] -- 0:00:41 368000 -- (-1299.861) (-1302.485) [-1297.540] (-1298.500) * (-1302.756) (-1297.628) (-1299.460) [-1302.439] -- 0:00:41 368500 -- (-1299.934) (-1299.362) (-1302.041) [-1297.840] * (-1304.208) (-1297.828) [-1298.335] (-1302.042) -- 0:00:41 369000 -- [-1299.945] (-1297.789) (-1303.612) (-1297.220) * (-1299.061) (-1298.732) [-1297.349] (-1300.429) -- 0:00:41 369500 -- (-1299.313) [-1297.689] (-1300.783) (-1297.522) * (-1298.699) (-1300.765) [-1297.457] (-1303.354) -- 0:00:40 370000 -- (-1298.201) (-1298.189) (-1301.069) [-1297.517] * (-1298.451) (-1300.690) [-1297.977] (-1301.060) -- 0:00:40 Average standard deviation of split frequencies: 0.016309 370500 -- [-1297.528] (-1298.883) (-1298.710) (-1297.492) * (-1300.820) (-1297.908) (-1297.145) [-1301.082] -- 0:00:40 371000 -- [-1298.846] (-1299.128) (-1300.079) (-1297.492) * (-1300.683) (-1300.167) (-1300.935) [-1301.117] -- 0:00:40 371500 -- (-1297.905) [-1298.745] (-1299.084) (-1297.496) * (-1299.291) [-1301.272] (-1299.320) (-1302.129) -- 0:00:40 372000 -- (-1299.697) [-1299.300] (-1301.073) (-1297.527) * (-1297.808) (-1298.436) [-1300.789] (-1301.560) -- 0:00:40 372500 -- (-1298.230) (-1299.659) [-1298.738] (-1300.444) * (-1298.568) (-1297.974) (-1301.629) [-1301.678] -- 0:00:40 373000 -- (-1298.863) (-1297.760) (-1298.361) [-1297.452] * [-1299.657] (-1299.153) (-1302.242) (-1300.935) -- 0:00:40 373500 -- (-1300.002) (-1296.942) [-1298.608] (-1297.834) * [-1298.758] (-1298.647) (-1302.795) (-1303.859) -- 0:00:40 374000 -- (-1299.593) [-1298.508] (-1302.612) (-1297.280) * (-1303.521) [-1298.637] (-1301.938) (-1299.963) -- 0:00:40 374500 -- (-1299.012) [-1298.494] (-1300.201) (-1297.185) * (-1303.911) [-1298.212] (-1299.522) (-1300.658) -- 0:00:40 375000 -- (-1298.614) (-1300.760) (-1299.472) [-1298.502] * [-1298.200] (-1303.864) (-1302.177) (-1298.293) -- 0:00:40 Average standard deviation of split frequencies: 0.015561 375500 -- (-1301.058) (-1302.725) (-1298.246) [-1299.854] * (-1298.367) (-1302.379) (-1301.763) [-1298.851] -- 0:00:39 376000 -- (-1301.335) (-1298.212) (-1300.888) [-1297.972] * (-1305.413) [-1303.265] (-1299.748) (-1298.057) -- 0:00:39 376500 -- (-1304.824) (-1298.172) [-1298.036] (-1297.850) * (-1299.029) [-1300.227] (-1298.505) (-1301.596) -- 0:00:39 377000 -- (-1302.969) [-1300.335] (-1297.722) (-1297.889) * (-1298.520) (-1301.812) [-1298.356] (-1300.889) -- 0:00:39 377500 -- [-1299.587] (-1298.518) (-1299.552) (-1298.977) * [-1297.335] (-1299.546) (-1300.200) (-1300.670) -- 0:00:39 378000 -- (-1298.842) [-1297.706] (-1307.214) (-1300.766) * (-1299.529) (-1300.316) [-1301.769] (-1298.966) -- 0:00:39 378500 -- (-1300.213) [-1297.706] (-1303.510) (-1300.099) * (-1300.294) (-1297.611) (-1301.411) [-1303.254] -- 0:00:39 379000 -- [-1300.486] (-1298.842) (-1299.377) (-1299.287) * (-1298.172) (-1298.177) [-1297.952] (-1298.278) -- 0:00:39 379500 -- [-1297.381] (-1299.990) (-1300.213) (-1301.739) * (-1299.014) [-1297.614] (-1299.739) (-1299.807) -- 0:00:39 380000 -- [-1297.410] (-1300.547) (-1300.970) (-1302.229) * (-1298.311) (-1301.338) (-1300.210) [-1299.172] -- 0:00:39 Average standard deviation of split frequencies: 0.016536 380500 -- [-1297.677] (-1298.570) (-1298.115) (-1298.207) * (-1298.216) (-1298.484) [-1299.872] (-1298.130) -- 0:00:39 381000 -- (-1297.630) [-1298.007] (-1300.503) (-1299.295) * (-1297.969) (-1299.289) [-1300.012] (-1300.779) -- 0:00:40 381500 -- [-1297.160] (-1299.323) (-1298.651) (-1300.527) * (-1299.786) [-1297.920] (-1298.731) (-1302.443) -- 0:00:40 382000 -- (-1297.577) (-1298.231) (-1299.082) [-1299.175] * (-1301.741) (-1299.598) [-1298.804] (-1300.843) -- 0:00:40 382500 -- (-1297.568) [-1298.996] (-1298.279) (-1298.225) * (-1299.731) [-1299.644] (-1301.696) (-1298.552) -- 0:00:40 383000 -- [-1297.566] (-1299.153) (-1300.770) (-1297.643) * (-1299.015) (-1298.745) (-1300.755) [-1299.491] -- 0:00:40 383500 -- (-1297.568) (-1299.484) (-1298.972) [-1298.365] * [-1298.115] (-1298.961) (-1300.152) (-1300.075) -- 0:00:40 384000 -- [-1299.711] (-1301.422) (-1299.411) (-1304.456) * (-1298.769) (-1299.579) (-1299.067) [-1298.878] -- 0:00:40 384500 -- (-1298.293) [-1298.978] (-1297.509) (-1299.433) * [-1298.832] (-1298.493) (-1297.894) (-1299.535) -- 0:00:40 385000 -- [-1298.984] (-1298.331) (-1298.658) (-1300.281) * (-1302.090) (-1298.021) [-1299.896] (-1300.746) -- 0:00:39 Average standard deviation of split frequencies: 0.016555 385500 -- (-1298.496) [-1297.853] (-1297.456) (-1299.342) * (-1299.498) [-1298.080] (-1299.028) (-1300.112) -- 0:00:39 386000 -- [-1298.781] (-1297.362) (-1299.173) (-1298.487) * (-1304.009) [-1299.897] (-1298.598) (-1298.782) -- 0:00:39 386500 -- [-1297.906] (-1298.135) (-1301.500) (-1297.695) * (-1300.984) [-1299.298] (-1298.744) (-1303.111) -- 0:00:39 387000 -- (-1300.599) (-1302.334) (-1298.883) [-1299.015] * (-1303.354) [-1298.536] (-1298.902) (-1299.077) -- 0:00:39 387500 -- [-1303.196] (-1301.574) (-1299.061) (-1302.547) * (-1299.653) (-1298.128) [-1299.459] (-1298.093) -- 0:00:39 388000 -- (-1297.141) (-1298.878) (-1299.442) [-1298.298] * (-1299.395) (-1301.154) [-1298.994] (-1298.117) -- 0:00:39 388500 -- (-1297.227) (-1298.526) (-1298.154) [-1298.002] * [-1298.800] (-1299.645) (-1298.291) (-1299.428) -- 0:00:39 389000 -- (-1297.851) (-1299.692) (-1300.921) [-1297.461] * (-1300.151) (-1299.210) [-1298.682] (-1297.435) -- 0:00:39 389500 -- [-1299.062] (-1298.756) (-1297.851) (-1299.297) * (-1302.491) [-1298.897] (-1298.962) (-1297.710) -- 0:00:39 390000 -- (-1302.722) [-1298.461] (-1298.714) (-1299.877) * [-1301.301] (-1299.810) (-1302.482) (-1301.695) -- 0:00:39 Average standard deviation of split frequencies: 0.017027 390500 -- [-1297.480] (-1300.569) (-1299.043) (-1296.947) * (-1299.660) (-1300.402) [-1299.865] (-1299.923) -- 0:00:39 391000 -- (-1297.429) [-1299.012] (-1304.498) (-1298.387) * [-1299.588] (-1309.225) (-1302.365) (-1300.715) -- 0:00:38 391500 -- [-1299.703] (-1299.046) (-1303.981) (-1298.487) * (-1303.082) [-1301.363] (-1301.743) (-1298.107) -- 0:00:38 392000 -- (-1299.122) (-1297.791) (-1301.145) [-1302.237] * (-1299.899) (-1303.289) [-1297.069] (-1297.602) -- 0:00:38 392500 -- [-1300.420] (-1298.892) (-1299.763) (-1299.699) * (-1299.092) [-1303.687] (-1300.840) (-1301.851) -- 0:00:38 393000 -- (-1300.056) (-1298.576) [-1299.723] (-1298.906) * [-1301.407] (-1303.103) (-1300.001) (-1298.639) -- 0:00:38 393500 -- (-1298.268) [-1298.662] (-1301.040) (-1300.563) * (-1301.261) [-1297.927] (-1303.057) (-1298.570) -- 0:00:38 394000 -- (-1297.993) (-1301.691) (-1299.387) [-1300.805] * (-1299.742) (-1297.946) [-1302.760] (-1299.252) -- 0:00:38 394500 -- (-1299.388) (-1298.543) (-1302.355) [-1298.514] * (-1299.081) [-1298.734] (-1300.464) (-1298.761) -- 0:00:38 395000 -- [-1299.210] (-1299.881) (-1298.702) (-1303.413) * (-1305.167) [-1299.846] (-1298.424) (-1300.766) -- 0:00:38 Average standard deviation of split frequencies: 0.016666 395500 -- [-1299.678] (-1303.877) (-1300.408) (-1303.107) * [-1303.009] (-1299.763) (-1301.849) (-1299.673) -- 0:00:38 396000 -- (-1302.689) (-1299.814) [-1300.484] (-1302.145) * (-1299.357) [-1301.859] (-1302.058) (-1300.123) -- 0:00:38 396500 -- (-1299.666) (-1297.779) [-1298.008] (-1301.096) * (-1300.536) [-1299.412] (-1298.936) (-1301.913) -- 0:00:38 397000 -- (-1300.260) [-1299.148] (-1298.347) (-1300.009) * [-1299.946] (-1299.039) (-1298.326) (-1299.083) -- 0:00:37 397500 -- (-1298.917) (-1298.056) [-1299.409] (-1297.914) * (-1299.236) (-1299.768) [-1298.427] (-1301.795) -- 0:00:39 398000 -- [-1297.497] (-1298.632) (-1298.204) (-1298.102) * (-1299.481) [-1302.946] (-1298.758) (-1299.316) -- 0:00:39 398500 -- (-1302.042) (-1298.508) [-1298.730] (-1297.377) * [-1299.283] (-1306.000) (-1301.008) (-1299.111) -- 0:00:39 399000 -- (-1299.370) (-1298.660) [-1300.431] (-1301.220) * (-1299.013) [-1297.760] (-1300.563) (-1300.487) -- 0:00:39 399500 -- (-1300.395) (-1303.094) [-1298.122] (-1302.296) * (-1297.906) [-1300.598] (-1298.322) (-1303.166) -- 0:00:39 400000 -- [-1298.630] (-1302.011) (-1297.674) (-1301.522) * [-1298.853] (-1302.056) (-1297.483) (-1301.735) -- 0:00:39 Average standard deviation of split frequencies: 0.016406 400500 -- (-1300.418) (-1301.292) [-1297.161] (-1298.674) * (-1298.928) [-1298.616] (-1297.836) (-1299.751) -- 0:00:38 401000 -- (-1298.984) [-1297.244] (-1300.261) (-1298.863) * (-1299.610) (-1300.189) (-1298.474) [-1299.434] -- 0:00:38 401500 -- [-1299.305] (-1299.369) (-1300.351) (-1298.435) * (-1299.899) [-1301.676] (-1299.867) (-1300.399) -- 0:00:38 402000 -- [-1297.774] (-1298.944) (-1297.698) (-1298.601) * (-1300.699) [-1300.990] (-1298.987) (-1300.899) -- 0:00:38 402500 -- (-1298.627) (-1300.198) (-1298.241) [-1297.891] * (-1297.864) [-1299.780] (-1299.992) (-1297.884) -- 0:00:38 403000 -- (-1298.568) [-1299.157] (-1298.621) (-1298.929) * (-1300.502) [-1298.737] (-1298.517) (-1297.325) -- 0:00:38 403500 -- (-1297.966) (-1301.508) [-1301.545] (-1300.198) * [-1297.798] (-1299.125) (-1302.361) (-1298.046) -- 0:00:38 404000 -- (-1298.111) (-1301.035) [-1299.351] (-1298.143) * [-1301.004] (-1301.510) (-1297.807) (-1300.265) -- 0:00:38 404500 -- (-1297.936) (-1301.093) (-1299.178) [-1297.302] * [-1299.166] (-1299.777) (-1297.815) (-1300.601) -- 0:00:38 405000 -- (-1297.923) [-1298.731] (-1301.866) (-1297.176) * (-1299.201) (-1299.698) (-1297.850) [-1299.265] -- 0:00:38 Average standard deviation of split frequencies: 0.015804 405500 -- [-1300.870] (-1299.931) (-1300.809) (-1299.434) * (-1298.372) (-1299.609) (-1298.793) [-1298.252] -- 0:00:38 406000 -- [-1299.963] (-1298.170) (-1301.912) (-1301.884) * (-1300.771) (-1300.155) [-1298.781] (-1300.259) -- 0:00:38 406500 -- (-1298.432) (-1300.109) (-1300.719) [-1299.574] * (-1297.774) (-1300.683) [-1298.809] (-1297.523) -- 0:00:37 407000 -- (-1302.466) [-1299.343] (-1300.616) (-1298.824) * (-1298.316) (-1298.571) [-1299.079] (-1298.944) -- 0:00:37 407500 -- (-1301.180) [-1299.796] (-1299.888) (-1299.419) * [-1299.043] (-1296.982) (-1300.178) (-1300.027) -- 0:00:37 408000 -- (-1302.749) [-1300.189] (-1299.769) (-1298.322) * (-1299.126) [-1299.260] (-1303.248) (-1300.235) -- 0:00:37 408500 -- (-1306.570) (-1297.973) (-1298.459) [-1298.624] * (-1305.387) [-1297.075] (-1297.249) (-1299.263) -- 0:00:37 409000 -- (-1302.050) (-1297.338) (-1298.466) [-1297.774] * (-1306.108) (-1299.001) [-1298.728] (-1297.219) -- 0:00:37 409500 -- (-1300.376) (-1298.979) (-1298.466) [-1298.976] * (-1303.635) (-1300.000) (-1298.158) [-1298.672] -- 0:00:37 410000 -- (-1301.318) (-1298.106) (-1299.534) [-1297.580] * (-1297.680) [-1299.508] (-1300.616) (-1302.750) -- 0:00:37 Average standard deviation of split frequencies: 0.016262 410500 -- (-1302.297) [-1297.744] (-1302.486) (-1297.580) * (-1305.933) [-1299.111] (-1302.599) (-1299.557) -- 0:00:37 411000 -- (-1299.228) [-1297.814] (-1299.455) (-1297.579) * (-1301.003) [-1299.174] (-1302.445) (-1301.196) -- 0:00:37 411500 -- (-1301.038) [-1297.695] (-1302.515) (-1297.798) * (-1299.392) [-1298.726] (-1302.248) (-1299.060) -- 0:00:37 412000 -- (-1300.744) (-1298.564) (-1299.402) [-1301.875] * (-1298.450) [-1297.725] (-1301.588) (-1299.527) -- 0:00:37 412500 -- (-1299.839) (-1298.403) [-1297.245] (-1301.739) * (-1299.092) (-1299.116) [-1297.502] (-1302.993) -- 0:00:37 413000 -- (-1303.848) (-1297.254) [-1297.420] (-1303.808) * (-1297.384) (-1300.084) (-1297.760) [-1299.561] -- 0:00:36 413500 -- (-1297.780) [-1300.140] (-1302.787) (-1305.896) * (-1300.359) (-1299.930) (-1299.194) [-1299.724] -- 0:00:38 414000 -- [-1300.460] (-1301.982) (-1299.674) (-1300.161) * (-1299.645) (-1302.587) (-1297.108) [-1297.629] -- 0:00:38 414500 -- (-1300.927) (-1299.069) [-1301.986] (-1298.974) * (-1302.272) (-1301.701) [-1297.119] (-1298.232) -- 0:00:38 415000 -- [-1297.087] (-1298.213) (-1299.889) (-1298.492) * (-1299.513) [-1300.025] (-1300.405) (-1298.594) -- 0:00:38 Average standard deviation of split frequencies: 0.015531 415500 -- [-1297.294] (-1300.043) (-1298.637) (-1298.696) * (-1299.557) (-1302.215) [-1300.921] (-1299.594) -- 0:00:37 416000 -- (-1297.256) (-1299.971) [-1298.585] (-1297.664) * (-1299.109) (-1304.458) [-1301.498] (-1301.689) -- 0:00:37 416500 -- (-1301.595) (-1299.452) [-1298.131] (-1298.917) * [-1299.908] (-1299.977) (-1302.425) (-1302.863) -- 0:00:37 417000 -- (-1300.183) (-1299.530) [-1298.749] (-1302.110) * (-1299.907) [-1299.011] (-1297.842) (-1299.867) -- 0:00:37 417500 -- [-1298.387] (-1300.449) (-1300.137) (-1299.762) * (-1299.421) (-1302.111) (-1297.732) [-1301.112] -- 0:00:37 418000 -- (-1299.337) (-1298.244) [-1302.509] (-1303.307) * (-1298.661) (-1302.173) (-1299.738) [-1300.047] -- 0:00:37 418500 -- (-1299.098) [-1298.251] (-1302.159) (-1300.697) * (-1299.627) (-1299.206) (-1300.477) [-1297.479] -- 0:00:37 419000 -- (-1302.176) (-1298.200) (-1298.901) [-1300.299] * (-1302.098) [-1300.348] (-1299.446) (-1298.413) -- 0:00:37 419500 -- (-1302.104) (-1298.891) (-1299.571) [-1300.076] * (-1301.280) [-1298.471] (-1301.368) (-1299.002) -- 0:00:37 420000 -- (-1298.715) (-1300.784) [-1298.075] (-1299.839) * (-1299.552) [-1299.234] (-1300.972) (-1300.057) -- 0:00:37 Average standard deviation of split frequencies: 0.016018 420500 -- (-1301.977) (-1299.375) [-1297.582] (-1300.878) * (-1298.078) (-1299.507) [-1302.497] (-1303.118) -- 0:00:37 421000 -- (-1301.993) (-1300.127) [-1297.912] (-1300.167) * (-1303.677) (-1299.069) (-1300.449) [-1300.219] -- 0:00:37 421500 -- (-1300.391) (-1298.428) [-1298.828] (-1301.868) * (-1307.824) (-1305.849) (-1302.445) [-1298.920] -- 0:00:37 422000 -- (-1300.653) [-1297.867] (-1302.677) (-1298.017) * [-1300.209] (-1306.308) (-1299.944) (-1300.702) -- 0:00:36 422500 -- (-1300.100) [-1300.470] (-1305.297) (-1302.030) * [-1300.521] (-1298.185) (-1299.582) (-1301.403) -- 0:00:36 423000 -- (-1298.864) [-1298.576] (-1300.197) (-1298.841) * (-1301.479) (-1298.057) [-1298.220] (-1301.745) -- 0:00:36 423500 -- (-1299.121) (-1303.752) (-1298.590) [-1301.126] * (-1300.513) (-1298.521) (-1300.525) [-1298.202] -- 0:00:36 424000 -- (-1299.438) [-1299.492] (-1300.364) (-1298.071) * [-1300.287] (-1299.124) (-1302.655) (-1298.808) -- 0:00:36 424500 -- (-1299.125) (-1299.682) [-1297.795] (-1298.150) * (-1300.889) [-1299.124] (-1301.068) (-1298.879) -- 0:00:36 425000 -- (-1299.296) (-1298.837) [-1297.307] (-1302.550) * (-1298.414) [-1298.592] (-1300.364) (-1301.532) -- 0:00:36 Average standard deviation of split frequencies: 0.016208 425500 -- (-1302.327) [-1300.764] (-1300.978) (-1299.504) * (-1299.146) (-1300.797) (-1298.942) [-1299.418] -- 0:00:36 426000 -- (-1304.161) (-1298.606) (-1302.550) [-1298.825] * (-1299.615) [-1297.837] (-1300.000) (-1298.686) -- 0:00:36 426500 -- (-1303.446) (-1300.371) (-1300.024) [-1299.797] * [-1298.799] (-1297.369) (-1299.702) (-1298.117) -- 0:00:36 427000 -- (-1303.279) (-1299.254) (-1299.516) [-1298.058] * (-1300.165) (-1298.369) [-1298.836] (-1301.364) -- 0:00:36 427500 -- (-1299.815) (-1299.442) (-1300.517) [-1303.383] * [-1299.570] (-1298.200) (-1300.185) (-1298.321) -- 0:00:36 428000 -- (-1300.955) [-1299.612] (-1303.424) (-1299.872) * (-1299.310) (-1297.702) (-1299.630) [-1302.171] -- 0:00:36 428500 -- (-1301.628) [-1298.018] (-1300.365) (-1300.042) * (-1304.704) (-1297.707) [-1298.719] (-1299.100) -- 0:00:36 429000 -- (-1299.880) (-1302.098) [-1299.228] (-1299.788) * (-1297.663) [-1298.036] (-1299.732) (-1297.571) -- 0:00:35 429500 -- (-1302.503) (-1300.452) (-1299.643) [-1297.266] * (-1303.190) (-1299.693) (-1298.011) [-1301.336] -- 0:00:35 430000 -- [-1300.959] (-1301.286) (-1302.556) (-1300.573) * [-1298.115] (-1298.646) (-1301.216) (-1298.103) -- 0:00:37 Average standard deviation of split frequencies: 0.017320 430500 -- (-1302.038) [-1298.499] (-1304.462) (-1301.786) * (-1298.072) [-1302.282] (-1300.527) (-1298.470) -- 0:00:37 431000 -- (-1299.892) [-1300.957] (-1303.120) (-1301.997) * (-1300.580) [-1300.367] (-1301.997) (-1297.471) -- 0:00:36 431500 -- (-1299.273) (-1299.530) (-1299.894) [-1298.198] * [-1300.667] (-1297.588) (-1299.237) (-1299.741) -- 0:00:36 432000 -- (-1302.796) (-1302.478) (-1299.065) [-1297.470] * [-1298.891] (-1298.628) (-1297.957) (-1299.210) -- 0:00:36 432500 -- (-1299.788) [-1299.418] (-1299.932) (-1300.726) * (-1298.868) (-1301.287) (-1298.398) [-1297.048] -- 0:00:36 433000 -- (-1300.423) (-1300.298) (-1303.778) [-1301.273] * (-1298.762) (-1298.910) [-1300.792] (-1298.624) -- 0:00:36 433500 -- (-1300.374) [-1298.276] (-1302.745) (-1304.732) * [-1297.370] (-1297.240) (-1304.106) (-1304.668) -- 0:00:36 434000 -- [-1297.358] (-1298.182) (-1299.281) (-1302.386) * (-1299.267) (-1300.139) [-1300.765] (-1299.638) -- 0:00:36 434500 -- (-1297.360) (-1297.700) (-1300.482) [-1299.228] * [-1298.527] (-1298.968) (-1299.623) (-1298.833) -- 0:00:36 435000 -- (-1298.815) [-1297.662] (-1298.769) (-1296.930) * [-1298.169] (-1297.871) (-1298.816) (-1297.882) -- 0:00:36 Average standard deviation of split frequencies: 0.018317 435500 -- (-1301.997) (-1299.045) [-1298.164] (-1297.086) * (-1299.691) [-1299.721] (-1299.475) (-1304.469) -- 0:00:36 436000 -- [-1298.397] (-1299.538) (-1297.767) (-1299.287) * [-1300.080] (-1300.259) (-1298.644) (-1298.923) -- 0:00:36 436500 -- [-1300.922] (-1299.875) (-1297.739) (-1298.405) * (-1297.462) [-1300.658] (-1299.755) (-1300.122) -- 0:00:36 437000 -- (-1301.870) (-1300.155) [-1298.087] (-1297.937) * (-1298.121) (-1301.162) [-1299.483] (-1300.722) -- 0:00:36 437500 -- (-1297.985) (-1301.823) [-1299.109] (-1298.596) * (-1297.810) (-1298.392) (-1298.619) [-1300.631] -- 0:00:36 438000 -- (-1301.695) (-1298.620) (-1297.660) [-1299.259] * (-1299.262) [-1298.164] (-1298.016) (-1298.958) -- 0:00:35 438500 -- (-1299.839) (-1300.235) [-1300.850] (-1299.688) * (-1301.284) [-1307.729] (-1299.031) (-1300.659) -- 0:00:35 439000 -- (-1299.682) [-1298.253] (-1298.114) (-1298.955) * (-1300.680) (-1299.622) [-1298.779] (-1299.193) -- 0:00:35 439500 -- (-1298.329) [-1302.550] (-1298.854) (-1301.044) * (-1298.972) [-1299.557] (-1300.895) (-1299.402) -- 0:00:35 440000 -- [-1297.596] (-1299.431) (-1297.625) (-1299.440) * (-1299.713) [-1301.537] (-1299.932) (-1299.076) -- 0:00:35 Average standard deviation of split frequencies: 0.018689 440500 -- (-1303.580) (-1301.646) (-1300.672) [-1296.981] * (-1302.155) (-1303.828) [-1297.492] (-1299.424) -- 0:00:35 441000 -- [-1301.570] (-1300.644) (-1299.314) (-1298.688) * (-1298.041) [-1301.983] (-1299.226) (-1299.960) -- 0:00:35 441500 -- (-1300.981) (-1298.978) [-1302.652] (-1299.182) * (-1297.345) (-1300.196) (-1301.392) [-1301.010] -- 0:00:35 442000 -- (-1302.047) (-1298.819) (-1300.010) [-1298.171] * (-1298.014) (-1297.440) (-1301.462) [-1302.931] -- 0:00:35 442500 -- (-1301.280) (-1297.065) [-1301.895] (-1297.907) * (-1297.378) (-1302.161) (-1300.223) [-1297.364] -- 0:00:35 443000 -- (-1299.926) [-1298.260] (-1304.050) (-1298.601) * [-1298.368] (-1297.648) (-1300.744) (-1298.866) -- 0:00:35 443500 -- (-1300.142) (-1297.093) [-1299.942] (-1299.296) * (-1298.382) (-1298.619) (-1298.039) [-1299.466] -- 0:00:35 444000 -- (-1300.744) [-1299.956] (-1298.791) (-1297.723) * (-1297.929) [-1299.746] (-1298.344) (-1302.133) -- 0:00:35 444500 -- (-1300.118) [-1299.508] (-1305.365) (-1299.641) * (-1299.258) (-1299.840) (-1300.639) [-1299.574] -- 0:00:34 445000 -- (-1299.889) [-1296.910] (-1303.617) (-1298.956) * (-1299.377) (-1300.681) [-1299.557] (-1299.337) -- 0:00:34 Average standard deviation of split frequencies: 0.018155 445500 -- (-1299.643) (-1300.236) (-1299.993) [-1297.430] * (-1299.906) (-1302.360) (-1301.617) [-1299.214] -- 0:00:34 446000 -- (-1299.015) (-1302.147) (-1298.167) [-1300.974] * (-1299.712) [-1301.128] (-1301.777) (-1297.902) -- 0:00:36 446500 -- [-1299.089] (-1302.120) (-1300.058) (-1301.815) * [-1298.336] (-1298.395) (-1300.207) (-1299.098) -- 0:00:35 447000 -- (-1303.075) [-1297.656] (-1299.100) (-1297.878) * (-1300.405) (-1298.048) [-1303.132] (-1301.113) -- 0:00:35 447500 -- (-1298.477) [-1297.252] (-1298.814) (-1299.751) * (-1305.975) (-1299.613) (-1302.119) [-1297.254] -- 0:00:35 448000 -- [-1299.046] (-1298.855) (-1301.173) (-1303.694) * (-1298.359) [-1298.871] (-1303.138) (-1303.195) -- 0:00:35 448500 -- (-1298.497) [-1297.518] (-1298.893) (-1299.116) * [-1302.070] (-1302.079) (-1303.932) (-1302.951) -- 0:00:35 449000 -- [-1301.460] (-1297.598) (-1303.209) (-1298.353) * (-1301.644) [-1299.978] (-1301.023) (-1299.983) -- 0:00:35 449500 -- (-1297.465) [-1301.261] (-1300.723) (-1299.382) * [-1297.486] (-1298.209) (-1301.140) (-1300.869) -- 0:00:35 450000 -- (-1298.831) (-1301.472) [-1300.530] (-1300.744) * [-1297.032] (-1301.044) (-1301.135) (-1300.786) -- 0:00:35 Average standard deviation of split frequencies: 0.018275 450500 -- (-1302.353) (-1298.792) (-1307.591) [-1299.013] * (-1303.626) (-1300.062) (-1299.628) [-1298.503] -- 0:00:35 451000 -- (-1304.044) (-1299.934) (-1304.457) [-1298.511] * [-1298.951] (-1299.077) (-1302.413) (-1297.965) -- 0:00:35 451500 -- (-1300.784) (-1298.813) (-1302.474) [-1300.618] * (-1299.055) [-1304.803] (-1302.534) (-1298.699) -- 0:00:35 452000 -- (-1297.513) (-1298.813) (-1304.748) [-1299.218] * (-1299.567) (-1303.153) [-1301.868] (-1302.049) -- 0:00:35 452500 -- (-1299.163) (-1297.945) [-1298.977] (-1299.089) * (-1299.621) (-1297.206) [-1298.646] (-1298.783) -- 0:00:35 453000 -- (-1298.717) (-1297.836) (-1300.898) [-1300.496] * (-1299.054) (-1300.631) [-1298.520] (-1298.885) -- 0:00:35 453500 -- (-1298.814) (-1298.593) (-1299.313) [-1300.399] * (-1301.342) (-1297.269) [-1298.326] (-1299.163) -- 0:00:34 454000 -- [-1300.684] (-1298.800) (-1302.096) (-1300.568) * [-1300.530] (-1297.393) (-1299.000) (-1297.412) -- 0:00:34 454500 -- (-1300.659) [-1298.726] (-1301.545) (-1299.708) * (-1298.632) (-1298.892) [-1299.752] (-1298.507) -- 0:00:34 455000 -- [-1297.849] (-1301.990) (-1302.763) (-1299.056) * [-1298.803] (-1299.245) (-1299.383) (-1299.818) -- 0:00:34 Average standard deviation of split frequencies: 0.017209 455500 -- (-1297.675) (-1300.084) [-1299.186] (-1298.264) * (-1301.104) (-1299.170) [-1298.811] (-1300.232) -- 0:00:34 456000 -- (-1305.127) (-1303.297) [-1298.016] (-1301.078) * (-1302.957) [-1301.281] (-1298.240) (-1300.474) -- 0:00:34 456500 -- [-1299.479] (-1301.056) (-1299.936) (-1299.423) * (-1298.641) (-1300.202) [-1297.254] (-1298.088) -- 0:00:34 457000 -- [-1297.920] (-1300.936) (-1301.471) (-1298.162) * [-1297.924] (-1303.430) (-1298.114) (-1299.817) -- 0:00:34 457500 -- (-1298.707) (-1300.466) [-1300.563] (-1304.192) * (-1299.557) (-1297.635) [-1300.109] (-1300.782) -- 0:00:34 458000 -- (-1300.399) [-1302.381] (-1301.210) (-1302.281) * [-1298.757] (-1298.521) (-1299.402) (-1299.681) -- 0:00:34 458500 -- (-1300.484) [-1298.702] (-1299.091) (-1298.881) * [-1300.029] (-1302.974) (-1299.227) (-1299.281) -- 0:00:34 459000 -- [-1297.543] (-1299.322) (-1298.070) (-1299.219) * (-1297.698) (-1305.240) [-1302.533] (-1298.559) -- 0:00:34 459500 -- [-1297.392] (-1298.988) (-1299.380) (-1302.007) * (-1298.918) (-1301.406) (-1304.154) [-1297.336] -- 0:00:34 460000 -- (-1297.122) [-1299.390] (-1299.548) (-1302.080) * (-1298.166) (-1300.550) [-1297.667] (-1297.398) -- 0:00:34 Average standard deviation of split frequencies: 0.015691 460500 -- (-1298.133) (-1301.056) (-1298.425) [-1299.131] * (-1299.576) [-1299.015] (-1300.489) (-1297.700) -- 0:00:33 461000 -- (-1297.525) (-1303.057) [-1301.694] (-1298.501) * [-1303.866] (-1300.377) (-1297.173) (-1298.929) -- 0:00:33 461500 -- [-1301.571] (-1301.717) (-1302.728) (-1297.001) * [-1298.966] (-1298.475) (-1297.100) (-1299.315) -- 0:00:33 462000 -- (-1301.664) (-1298.820) [-1298.681] (-1297.791) * [-1298.446] (-1298.294) (-1298.800) (-1298.595) -- 0:00:33 462500 -- (-1302.090) [-1298.698] (-1299.144) (-1299.350) * (-1298.929) (-1297.288) (-1298.813) [-1300.735] -- 0:00:34 463000 -- [-1300.353] (-1298.424) (-1298.706) (-1304.842) * (-1299.577) [-1297.563] (-1298.520) (-1300.899) -- 0:00:34 463500 -- (-1298.835) [-1301.396] (-1297.987) (-1300.020) * (-1298.002) (-1298.593) (-1299.644) [-1298.619] -- 0:00:34 464000 -- (-1302.053) (-1303.069) [-1300.787] (-1298.761) * [-1304.854] (-1297.726) (-1299.402) (-1298.919) -- 0:00:34 464500 -- (-1300.425) (-1301.160) [-1299.082] (-1300.357) * (-1300.052) [-1297.264] (-1297.713) (-1298.790) -- 0:00:34 465000 -- (-1299.258) (-1301.510) (-1298.981) [-1297.399] * (-1297.052) [-1297.459] (-1300.077) (-1303.345) -- 0:00:34 Average standard deviation of split frequencies: 0.015567 465500 -- [-1301.313] (-1302.965) (-1298.239) (-1300.116) * (-1298.868) [-1297.907] (-1302.236) (-1298.507) -- 0:00:34 466000 -- (-1298.828) [-1298.417] (-1297.568) (-1304.197) * [-1297.393] (-1298.606) (-1302.820) (-1299.311) -- 0:00:34 466500 -- (-1300.920) (-1301.274) [-1297.311] (-1299.423) * (-1297.515) (-1298.316) (-1299.666) [-1298.723] -- 0:00:34 467000 -- (-1299.528) (-1298.181) [-1297.746] (-1298.113) * [-1299.672] (-1299.591) (-1299.771) (-1300.027) -- 0:00:34 467500 -- [-1300.036] (-1297.736) (-1297.403) (-1301.258) * (-1299.861) (-1298.243) [-1297.755] (-1302.362) -- 0:00:34 468000 -- (-1300.879) (-1297.968) (-1297.305) [-1299.703] * [-1297.867] (-1297.871) (-1300.205) (-1298.721) -- 0:00:34 468500 -- (-1305.522) [-1298.978] (-1300.826) (-1300.483) * (-1299.078) [-1298.519] (-1303.983) (-1300.967) -- 0:00:34 469000 -- (-1301.521) (-1303.225) [-1301.440] (-1303.151) * (-1299.731) (-1298.240) [-1300.586] (-1297.390) -- 0:00:33 469500 -- [-1298.471] (-1300.452) (-1299.401) (-1300.418) * (-1299.724) (-1299.497) (-1306.282) [-1298.395] -- 0:00:33 470000 -- (-1298.574) [-1299.744] (-1299.373) (-1300.412) * (-1299.313) (-1298.924) (-1303.450) [-1298.603] -- 0:00:33 Average standard deviation of split frequencies: 0.015672 470500 -- [-1297.699] (-1299.702) (-1301.098) (-1298.833) * [-1300.448] (-1298.307) (-1301.928) (-1301.356) -- 0:00:33 471000 -- (-1298.387) (-1299.266) (-1301.791) [-1299.717] * (-1299.922) (-1297.314) (-1304.435) [-1298.846] -- 0:00:33 471500 -- (-1298.664) [-1301.217] (-1299.849) (-1298.261) * (-1300.731) (-1298.139) (-1301.924) [-1297.753] -- 0:00:33 472000 -- (-1297.753) (-1302.234) [-1302.430] (-1308.092) * [-1300.527] (-1299.799) (-1302.956) (-1298.899) -- 0:00:33 472500 -- [-1297.946] (-1303.104) (-1301.575) (-1304.364) * [-1302.903] (-1299.251) (-1302.811) (-1299.787) -- 0:00:33 473000 -- [-1301.533] (-1300.547) (-1300.679) (-1297.324) * [-1298.956] (-1298.608) (-1299.272) (-1300.002) -- 0:00:33 473500 -- (-1300.273) (-1299.317) (-1300.383) [-1298.289] * (-1297.891) [-1297.833] (-1299.271) (-1301.762) -- 0:00:33 474000 -- (-1299.816) [-1300.272] (-1300.480) (-1297.924) * (-1297.719) [-1298.073] (-1301.936) (-1301.086) -- 0:00:33 474500 -- [-1298.509] (-1300.288) (-1298.753) (-1297.291) * (-1300.484) (-1298.768) (-1302.219) [-1303.280] -- 0:00:33 475000 -- (-1300.416) [-1300.405] (-1299.480) (-1298.186) * [-1299.827] (-1299.267) (-1300.158) (-1303.792) -- 0:00:33 Average standard deviation of split frequencies: 0.014564 475500 -- (-1299.607) [-1299.615] (-1299.120) (-1298.166) * (-1301.442) (-1305.824) [-1297.953] (-1300.114) -- 0:00:33 476000 -- (-1299.099) (-1298.571) (-1298.203) [-1298.766] * (-1300.023) (-1300.698) (-1298.662) [-1297.315] -- 0:00:33 476500 -- (-1299.203) (-1299.089) (-1298.435) [-1300.492] * (-1299.270) [-1298.871] (-1300.441) (-1299.118) -- 0:00:32 477000 -- [-1299.747] (-1298.585) (-1299.230) (-1300.239) * (-1298.589) (-1298.882) [-1299.513] (-1302.607) -- 0:00:32 477500 -- (-1298.338) [-1298.781] (-1298.902) (-1298.217) * (-1298.164) (-1301.142) [-1301.724] (-1300.004) -- 0:00:32 478000 -- (-1301.720) [-1297.942] (-1300.431) (-1301.738) * (-1300.757) [-1298.161] (-1298.831) (-1298.239) -- 0:00:32 478500 -- (-1300.222) (-1299.719) (-1301.843) [-1297.979] * (-1302.370) (-1298.463) [-1299.965] (-1297.492) -- 0:00:33 479000 -- (-1299.769) (-1299.996) (-1308.059) [-1298.984] * (-1303.443) [-1300.209] (-1298.991) (-1299.814) -- 0:00:33 479500 -- (-1298.320) [-1302.044] (-1301.353) (-1299.026) * (-1299.571) (-1298.509) (-1299.396) [-1299.004] -- 0:00:33 480000 -- (-1299.569) (-1299.869) (-1303.152) [-1300.161] * (-1298.966) (-1298.161) [-1298.453] (-1298.815) -- 0:00:33 Average standard deviation of split frequencies: 0.013903 480500 -- (-1298.917) (-1299.602) [-1298.649] (-1301.563) * (-1302.458) [-1297.504] (-1300.377) (-1298.943) -- 0:00:33 481000 -- (-1299.092) [-1298.023] (-1297.730) (-1298.697) * [-1297.330] (-1297.375) (-1300.897) (-1298.525) -- 0:00:33 481500 -- (-1300.763) (-1300.229) [-1299.892] (-1301.347) * (-1297.963) (-1298.736) (-1301.533) [-1300.970] -- 0:00:33 482000 -- [-1298.985] (-1297.769) (-1299.894) (-1299.605) * [-1298.416] (-1297.942) (-1298.435) (-1298.397) -- 0:00:33 482500 -- (-1298.222) (-1297.339) (-1299.429) [-1302.642] * (-1297.942) [-1304.021] (-1299.319) (-1299.420) -- 0:00:33 483000 -- [-1298.866] (-1297.594) (-1300.411) (-1302.474) * (-1299.290) (-1300.549) [-1298.820] (-1299.044) -- 0:00:33 483500 -- [-1298.056] (-1298.738) (-1298.792) (-1299.231) * [-1297.561] (-1298.788) (-1298.107) (-1297.312) -- 0:00:33 484000 -- (-1298.652) [-1297.768] (-1298.125) (-1301.196) * (-1297.263) (-1299.808) [-1302.707] (-1298.739) -- 0:00:33 484500 -- (-1301.544) [-1298.117] (-1299.317) (-1304.770) * [-1297.386] (-1303.721) (-1299.986) (-1303.288) -- 0:00:32 485000 -- (-1300.232) (-1298.281) (-1297.321) [-1298.635] * (-1301.173) (-1299.445) [-1297.386] (-1303.438) -- 0:00:32 Average standard deviation of split frequencies: 0.013694 485500 -- [-1297.701] (-1298.335) (-1300.082) (-1298.985) * (-1297.781) (-1298.931) [-1298.273] (-1300.924) -- 0:00:32 486000 -- (-1297.726) (-1299.829) (-1301.521) [-1298.090] * (-1297.981) (-1301.186) (-1297.738) [-1297.613] -- 0:00:32 486500 -- (-1298.044) (-1300.064) (-1298.640) [-1299.519] * [-1299.300] (-1301.642) (-1302.622) (-1297.646) -- 0:00:32 487000 -- (-1298.515) [-1297.260] (-1298.436) (-1299.899) * (-1299.956) (-1300.405) (-1299.076) [-1298.173] -- 0:00:32 487500 -- [-1298.917] (-1299.108) (-1300.844) (-1298.583) * (-1304.214) (-1302.386) [-1298.987] (-1297.516) -- 0:00:32 488000 -- [-1297.402] (-1297.782) (-1299.822) (-1297.517) * [-1301.022] (-1300.769) (-1298.282) (-1300.917) -- 0:00:32 488500 -- (-1298.949) [-1297.990] (-1298.268) (-1300.686) * (-1298.181) (-1299.804) (-1298.271) [-1300.990] -- 0:00:32 489000 -- (-1303.269) (-1298.016) [-1297.498] (-1297.883) * (-1302.304) (-1299.559) (-1300.414) [-1299.271] -- 0:00:32 489500 -- (-1297.719) [-1297.689] (-1302.511) (-1300.360) * (-1302.461) (-1299.710) [-1297.072] (-1300.639) -- 0:00:32 490000 -- [-1299.163] (-1298.035) (-1300.559) (-1300.096) * (-1304.114) (-1301.718) [-1299.130] (-1300.369) -- 0:00:32 Average standard deviation of split frequencies: 0.013846 490500 -- [-1297.369] (-1298.958) (-1298.085) (-1297.259) * (-1306.683) (-1297.113) (-1297.558) [-1299.864] -- 0:00:32 491000 -- [-1298.939] (-1298.934) (-1300.639) (-1300.224) * (-1300.203) (-1300.199) [-1298.143] (-1299.797) -- 0:00:32 491500 -- (-1298.279) (-1298.564) (-1304.043) [-1299.292] * (-1299.157) (-1298.538) (-1300.268) [-1301.825] -- 0:00:32 492000 -- (-1298.398) (-1299.542) [-1300.183] (-1297.499) * [-1297.819] (-1298.794) (-1303.059) (-1302.579) -- 0:00:32 492500 -- (-1301.174) [-1297.402] (-1298.335) (-1298.510) * [-1298.059] (-1299.771) (-1301.976) (-1300.014) -- 0:00:31 493000 -- [-1298.111] (-1299.435) (-1299.300) (-1297.300) * (-1300.169) [-1299.962] (-1300.504) (-1299.296) -- 0:00:31 493500 -- (-1298.969) (-1299.752) (-1298.168) [-1297.640] * (-1298.386) [-1298.721] (-1302.820) (-1300.695) -- 0:00:31 494000 -- [-1306.684] (-1299.796) (-1300.878) (-1301.334) * (-1299.183) [-1299.241] (-1298.586) (-1301.756) -- 0:00:31 494500 -- (-1300.736) (-1304.505) [-1299.161] (-1299.583) * (-1299.093) [-1301.311] (-1298.269) (-1298.769) -- 0:00:31 495000 -- [-1302.212] (-1300.082) (-1298.670) (-1299.582) * [-1300.382] (-1299.546) (-1300.115) (-1299.066) -- 0:00:32 Average standard deviation of split frequencies: 0.013362 495500 -- (-1300.177) (-1300.682) [-1301.015] (-1298.776) * (-1304.183) (-1298.322) (-1300.184) [-1299.314] -- 0:00:32 496000 -- (-1300.195) [-1297.815] (-1300.297) (-1304.216) * (-1300.397) (-1298.324) [-1297.365] (-1299.373) -- 0:00:32 496500 -- (-1298.426) (-1297.484) [-1297.737] (-1299.716) * (-1298.983) (-1297.855) [-1299.261] (-1297.950) -- 0:00:32 497000 -- [-1299.419] (-1297.435) (-1298.043) (-1300.109) * (-1300.929) [-1300.403] (-1300.459) (-1298.284) -- 0:00:32 497500 -- (-1300.734) (-1298.710) [-1297.258] (-1299.099) * (-1298.433) (-1298.716) [-1301.089] (-1298.909) -- 0:00:32 498000 -- (-1298.781) [-1297.942] (-1299.375) (-1297.901) * (-1298.022) (-1297.358) (-1300.407) [-1300.277] -- 0:00:32 498500 -- (-1299.542) [-1297.697] (-1299.264) (-1298.354) * (-1300.066) (-1298.936) (-1299.786) [-1298.564] -- 0:00:32 499000 -- (-1300.519) (-1298.214) [-1298.109] (-1300.033) * (-1298.247) [-1298.762] (-1301.115) (-1303.602) -- 0:00:32 499500 -- [-1298.087] (-1302.173) (-1298.033) (-1299.728) * [-1297.252] (-1299.746) (-1302.782) (-1301.603) -- 0:00:32 500000 -- (-1297.704) (-1297.511) (-1302.210) [-1297.874] * (-1297.914) [-1297.954] (-1302.914) (-1299.059) -- 0:00:32 Average standard deviation of split frequencies: 0.013293 500500 -- (-1298.304) (-1299.008) [-1299.848] (-1299.243) * [-1299.985] (-1299.107) (-1302.695) (-1298.877) -- 0:00:31 501000 -- [-1297.782] (-1304.444) (-1299.715) (-1300.946) * (-1300.729) (-1299.821) [-1298.458] (-1298.465) -- 0:00:31 501500 -- (-1297.363) (-1299.890) (-1297.896) [-1298.990] * [-1298.732] (-1301.343) (-1300.273) (-1298.080) -- 0:00:31 502000 -- (-1298.159) [-1298.370] (-1297.411) (-1298.317) * (-1298.614) (-1299.066) [-1301.060] (-1301.836) -- 0:00:31 502500 -- (-1300.550) (-1300.558) [-1300.457] (-1298.205) * (-1300.907) [-1299.616] (-1300.684) (-1301.195) -- 0:00:31 503000 -- (-1299.674) (-1299.562) (-1298.765) [-1300.554] * (-1301.300) [-1305.022] (-1298.386) (-1298.181) -- 0:00:31 503500 -- (-1302.100) [-1299.231] (-1298.709) (-1298.836) * [-1299.399] (-1297.975) (-1297.993) (-1299.405) -- 0:00:31 504000 -- (-1299.789) [-1298.460] (-1301.274) (-1300.284) * (-1299.446) [-1297.587] (-1298.324) (-1297.521) -- 0:00:31 504500 -- [-1299.649] (-1299.161) (-1300.851) (-1298.843) * (-1299.588) (-1297.510) [-1298.362] (-1298.617) -- 0:00:31 505000 -- (-1300.252) (-1302.776) (-1301.209) [-1301.453] * (-1299.648) (-1298.915) (-1299.765) [-1301.095] -- 0:00:31 Average standard deviation of split frequencies: 0.014139 505500 -- (-1300.125) (-1302.312) (-1301.595) [-1299.508] * (-1299.680) (-1297.593) (-1299.489) [-1297.805] -- 0:00:31 506000 -- (-1301.181) (-1300.606) [-1300.308] (-1298.336) * (-1300.429) (-1301.751) [-1298.591] (-1302.066) -- 0:00:31 506500 -- (-1300.277) (-1298.117) (-1298.766) [-1297.804] * (-1298.178) [-1299.436] (-1304.664) (-1300.287) -- 0:00:31 507000 -- [-1302.391] (-1299.138) (-1298.731) (-1300.849) * (-1298.065) [-1298.662] (-1300.975) (-1297.464) -- 0:00:31 507500 -- (-1301.992) [-1301.838] (-1303.049) (-1304.275) * [-1298.367] (-1300.241) (-1300.941) (-1298.544) -- 0:00:31 508000 -- [-1300.571] (-1302.773) (-1299.725) (-1297.801) * (-1300.968) (-1303.294) (-1301.752) [-1298.281] -- 0:00:30 508500 -- (-1304.210) [-1299.796] (-1301.043) (-1297.062) * (-1299.353) (-1298.357) (-1303.373) [-1297.687] -- 0:00:30 509000 -- (-1300.398) [-1297.237] (-1300.225) (-1299.727) * (-1299.387) (-1298.032) (-1299.137) [-1298.642] -- 0:00:30 509500 -- [-1298.759] (-1297.264) (-1300.055) (-1302.004) * (-1299.790) [-1299.043] (-1299.471) (-1299.030) -- 0:00:30 510000 -- (-1300.036) (-1300.277) (-1298.892) [-1301.760] * (-1298.494) [-1298.251] (-1297.448) (-1303.967) -- 0:00:30 Average standard deviation of split frequencies: 0.014118 510500 -- (-1298.506) [-1299.503] (-1299.075) (-1299.921) * [-1298.146] (-1298.034) (-1300.420) (-1302.938) -- 0:00:31 511000 -- (-1301.372) (-1301.237) (-1298.249) [-1299.495] * (-1299.377) [-1298.341] (-1299.767) (-1297.952) -- 0:00:31 511500 -- (-1300.662) (-1300.968) (-1299.433) [-1299.272] * (-1298.522) [-1297.095] (-1299.972) (-1298.622) -- 0:00:31 512000 -- (-1299.671) (-1299.162) (-1297.879) [-1300.860] * (-1298.567) (-1297.528) [-1300.696] (-1300.013) -- 0:00:31 512500 -- (-1297.266) (-1299.128) (-1298.479) [-1301.525] * [-1298.443] (-1299.781) (-1297.964) (-1302.414) -- 0:00:31 513000 -- (-1297.332) (-1300.844) (-1297.580) [-1299.109] * (-1300.608) [-1298.847] (-1298.051) (-1297.345) -- 0:00:31 513500 -- [-1298.546] (-1300.370) (-1302.465) (-1298.404) * (-1297.698) (-1297.435) (-1300.101) [-1297.585] -- 0:00:31 514000 -- (-1297.736) (-1302.351) [-1297.671] (-1303.361) * (-1297.698) [-1298.193] (-1299.772) (-1297.999) -- 0:00:31 514500 -- (-1298.060) [-1301.153] (-1299.378) (-1298.953) * [-1298.075] (-1297.461) (-1300.747) (-1299.846) -- 0:00:31 515000 -- (-1298.021) (-1300.690) [-1297.625] (-1299.383) * (-1298.359) (-1298.788) (-1306.564) [-1299.998] -- 0:00:31 Average standard deviation of split frequencies: 0.013381 515500 -- (-1297.994) (-1300.288) [-1299.108] (-1299.697) * [-1300.175] (-1304.748) (-1297.780) (-1297.282) -- 0:00:31 516000 -- (-1299.603) (-1299.529) (-1299.153) [-1298.932] * (-1300.448) (-1302.267) [-1298.191] (-1297.875) -- 0:00:30 516500 -- (-1301.153) [-1298.394] (-1299.021) (-1298.899) * [-1297.602] (-1303.557) (-1298.936) (-1306.615) -- 0:00:30 517000 -- (-1299.378) (-1300.996) [-1298.078] (-1298.856) * (-1298.990) [-1300.809] (-1299.104) (-1298.446) -- 0:00:30 517500 -- (-1298.617) [-1301.048] (-1298.755) (-1299.037) * [-1303.058] (-1298.820) (-1300.402) (-1301.865) -- 0:00:30 518000 -- (-1302.056) [-1299.196] (-1298.006) (-1297.962) * (-1297.625) (-1298.746) [-1299.510] (-1303.140) -- 0:00:30 518500 -- (-1300.083) (-1300.529) [-1298.596] (-1299.153) * (-1297.901) (-1298.441) [-1299.008] (-1299.104) -- 0:00:30 519000 -- (-1297.386) (-1301.620) (-1302.816) [-1298.774] * (-1299.297) (-1299.459) (-1300.771) [-1299.761] -- 0:00:30 519500 -- [-1299.328] (-1299.498) (-1299.730) (-1298.216) * (-1299.419) (-1299.698) [-1304.423] (-1297.802) -- 0:00:30 520000 -- (-1298.439) (-1300.487) (-1299.260) [-1301.583] * (-1298.580) (-1299.343) (-1302.706) [-1297.722] -- 0:00:30 Average standard deviation of split frequencies: 0.013900 520500 -- (-1298.698) [-1300.509] (-1308.522) (-1299.759) * (-1300.799) (-1297.489) [-1300.080] (-1298.020) -- 0:00:30 521000 -- [-1299.424] (-1297.198) (-1301.404) (-1299.188) * (-1298.290) (-1299.743) (-1298.948) [-1300.679] -- 0:00:30 521500 -- (-1299.307) [-1297.139] (-1299.602) (-1298.830) * [-1297.566] (-1302.325) (-1297.988) (-1300.271) -- 0:00:30 522000 -- (-1298.049) (-1297.748) (-1300.278) [-1299.226] * [-1298.128] (-1301.363) (-1299.354) (-1298.416) -- 0:00:30 522500 -- (-1304.155) (-1297.617) [-1300.471] (-1301.072) * (-1299.305) [-1301.965] (-1298.150) (-1299.940) -- 0:00:30 523000 -- [-1300.817] (-1297.463) (-1302.922) (-1298.957) * (-1300.287) (-1299.536) (-1298.800) [-1299.412] -- 0:00:30 523500 -- (-1301.208) [-1297.906] (-1299.485) (-1303.227) * (-1299.653) (-1300.553) [-1297.765] (-1298.487) -- 0:00:30 524000 -- [-1297.774] (-1303.321) (-1299.271) (-1303.088) * [-1297.548] (-1300.548) (-1299.769) (-1297.453) -- 0:00:29 524500 -- (-1297.871) [-1302.819] (-1298.055) (-1299.610) * [-1297.634] (-1299.156) (-1301.940) (-1300.330) -- 0:00:29 525000 -- [-1298.736] (-1300.741) (-1298.528) (-1299.924) * (-1298.443) (-1300.151) [-1297.987] (-1299.119) -- 0:00:29 Average standard deviation of split frequencies: 0.014283 525500 -- (-1298.922) (-1299.111) [-1299.992] (-1297.491) * (-1298.431) [-1300.792] (-1301.120) (-1298.887) -- 0:00:29 526000 -- [-1298.604] (-1298.724) (-1299.346) (-1301.189) * [-1300.219] (-1299.071) (-1301.802) (-1299.442) -- 0:00:29 526500 -- (-1301.372) (-1297.074) (-1299.207) [-1299.225] * [-1297.786] (-1298.470) (-1302.037) (-1299.459) -- 0:00:29 527000 -- (-1299.025) (-1297.198) [-1298.910] (-1302.095) * [-1300.863] (-1297.860) (-1304.335) (-1298.891) -- 0:00:30 527500 -- (-1299.710) (-1299.313) (-1299.967) [-1299.729] * (-1297.902) (-1299.710) (-1302.227) [-1299.127] -- 0:00:30 528000 -- (-1298.607) [-1302.145] (-1301.488) (-1299.503) * (-1300.386) (-1298.382) [-1300.774] (-1299.731) -- 0:00:30 528500 -- (-1298.616) (-1298.056) (-1297.679) [-1300.233] * (-1299.571) [-1298.460] (-1297.751) (-1299.227) -- 0:00:30 529000 -- (-1297.397) (-1298.865) [-1298.347] (-1297.285) * (-1298.549) [-1297.972] (-1303.393) (-1304.361) -- 0:00:30 529500 -- [-1301.722] (-1298.163) (-1300.239) (-1299.719) * (-1301.293) (-1301.545) (-1297.421) [-1300.900] -- 0:00:30 530000 -- (-1299.455) (-1297.948) (-1300.376) [-1299.975] * (-1299.394) (-1300.144) [-1301.966] (-1297.295) -- 0:00:30 Average standard deviation of split frequencies: 0.013991 530500 -- (-1299.285) [-1302.316] (-1300.851) (-1299.135) * (-1297.791) [-1298.435] (-1298.902) (-1297.387) -- 0:00:30 531000 -- (-1298.787) (-1301.476) (-1302.041) [-1297.613] * [-1299.897] (-1298.612) (-1298.513) (-1303.669) -- 0:00:30 531500 -- [-1301.544] (-1300.773) (-1303.219) (-1299.101) * (-1298.713) (-1297.968) (-1298.018) [-1298.437] -- 0:00:29 532000 -- [-1297.679] (-1300.773) (-1297.209) (-1297.690) * [-1300.712] (-1297.729) (-1300.343) (-1299.596) -- 0:00:29 532500 -- (-1297.364) (-1297.498) (-1297.303) [-1299.039] * (-1300.493) (-1298.449) (-1301.453) [-1299.280] -- 0:00:29 533000 -- (-1298.447) (-1297.481) (-1298.393) [-1298.874] * [-1299.837] (-1300.596) (-1301.263) (-1298.871) -- 0:00:29 533500 -- (-1297.997) (-1297.663) (-1299.038) [-1298.373] * (-1302.945) (-1301.271) (-1298.156) [-1297.932] -- 0:00:29 534000 -- [-1299.347] (-1298.584) (-1302.098) (-1298.733) * (-1305.166) [-1298.705] (-1298.524) (-1300.828) -- 0:00:29 534500 -- (-1300.858) [-1298.981] (-1301.457) (-1303.635) * (-1300.502) (-1299.528) [-1297.893] (-1299.319) -- 0:00:29 535000 -- [-1299.195] (-1300.976) (-1299.820) (-1303.211) * (-1297.467) (-1299.092) (-1297.854) [-1297.996] -- 0:00:29 Average standard deviation of split frequencies: 0.013357 535500 -- (-1297.901) (-1300.758) [-1298.114] (-1303.733) * (-1300.927) [-1304.892] (-1302.996) (-1301.626) -- 0:00:29 536000 -- (-1298.139) [-1299.535] (-1297.919) (-1301.476) * (-1299.815) (-1298.634) (-1298.913) [-1298.464] -- 0:00:29 536500 -- (-1298.596) [-1301.450] (-1298.659) (-1298.048) * (-1301.649) (-1297.012) [-1299.951] (-1298.062) -- 0:00:29 537000 -- (-1301.133) (-1298.345) (-1297.673) [-1299.576] * (-1299.633) [-1298.110] (-1300.867) (-1297.996) -- 0:00:29 537500 -- (-1300.117) [-1299.995] (-1298.603) (-1298.871) * (-1297.661) (-1299.002) (-1300.572) [-1302.037] -- 0:00:29 538000 -- [-1297.168] (-1298.748) (-1300.281) (-1301.120) * (-1298.792) [-1299.469] (-1299.279) (-1299.639) -- 0:00:29 538500 -- [-1299.357] (-1298.886) (-1302.386) (-1299.757) * (-1299.519) (-1302.203) [-1299.907] (-1298.464) -- 0:00:29 539000 -- [-1297.816] (-1301.794) (-1301.740) (-1297.892) * [-1298.879] (-1299.577) (-1298.684) (-1299.053) -- 0:00:29 539500 -- (-1298.295) (-1298.645) [-1298.554] (-1302.083) * [-1298.916] (-1298.994) (-1297.725) (-1302.759) -- 0:00:29 540000 -- (-1299.283) (-1299.715) (-1305.060) [-1298.790] * [-1298.027] (-1297.993) (-1298.145) (-1300.060) -- 0:00:28 Average standard deviation of split frequencies: 0.013187 540500 -- (-1297.767) (-1297.764) [-1299.357] (-1301.189) * (-1299.873) (-1297.472) (-1298.514) [-1298.445] -- 0:00:28 541000 -- (-1299.087) (-1298.431) (-1300.819) [-1298.355] * [-1307.843] (-1298.647) (-1297.206) (-1298.540) -- 0:00:28 541500 -- (-1297.651) (-1297.323) (-1300.322) [-1299.264] * (-1302.248) [-1298.198] (-1301.984) (-1298.770) -- 0:00:28 542000 -- [-1297.870] (-1298.668) (-1303.189) (-1297.737) * (-1298.884) [-1299.284] (-1297.680) (-1298.359) -- 0:00:28 542500 -- (-1299.716) (-1299.956) [-1300.383] (-1298.094) * (-1298.818) (-1297.974) [-1301.567] (-1297.414) -- 0:00:28 543000 -- (-1301.383) (-1300.134) [-1304.173] (-1298.925) * (-1298.917) [-1298.665] (-1300.377) (-1300.991) -- 0:00:29 543500 -- (-1301.410) [-1298.828] (-1301.756) (-1298.337) * (-1303.609) (-1299.408) [-1301.109] (-1300.493) -- 0:00:29 544000 -- (-1301.992) (-1300.170) [-1299.399] (-1298.406) * (-1300.055) (-1300.137) [-1298.326] (-1301.084) -- 0:00:29 544500 -- [-1298.973] (-1300.142) (-1297.396) (-1299.319) * (-1302.170) (-1300.873) [-1298.980] (-1299.311) -- 0:00:29 545000 -- [-1298.978] (-1299.789) (-1298.702) (-1300.414) * [-1298.020] (-1297.188) (-1298.511) (-1304.088) -- 0:00:29 Average standard deviation of split frequencies: 0.012897 545500 -- [-1298.171] (-1298.623) (-1299.859) (-1300.073) * (-1299.437) [-1297.018] (-1297.672) (-1299.907) -- 0:00:29 546000 -- (-1299.100) [-1299.571] (-1297.480) (-1300.101) * (-1300.579) [-1297.571] (-1299.186) (-1299.637) -- 0:00:29 546500 -- [-1299.177] (-1301.687) (-1302.001) (-1299.649) * [-1297.712] (-1302.333) (-1301.352) (-1299.466) -- 0:00:29 547000 -- (-1297.874) (-1302.538) (-1300.278) [-1299.399] * (-1299.017) (-1298.387) (-1299.455) [-1298.502] -- 0:00:28 547500 -- (-1300.743) (-1300.336) [-1299.727] (-1297.649) * (-1299.660) [-1299.582] (-1297.052) (-1298.091) -- 0:00:28 548000 -- (-1300.409) (-1299.961) (-1299.394) [-1297.648] * [-1300.201] (-1300.068) (-1298.095) (-1300.339) -- 0:00:28 548500 -- (-1299.204) (-1297.508) (-1302.778) [-1297.020] * (-1298.658) [-1298.931] (-1297.702) (-1301.023) -- 0:00:28 549000 -- (-1302.887) (-1298.982) (-1298.956) [-1297.450] * (-1304.687) (-1298.061) (-1300.185) [-1299.677] -- 0:00:28 549500 -- (-1300.454) (-1299.477) (-1298.279) [-1298.245] * [-1302.127] (-1298.359) (-1299.870) (-1299.749) -- 0:00:28 550000 -- (-1299.790) (-1301.080) [-1298.613] (-1299.483) * (-1300.586) (-1298.201) (-1301.891) [-1299.192] -- 0:00:28 Average standard deviation of split frequencies: 0.013429 550500 -- (-1298.176) (-1302.657) [-1303.042] (-1298.749) * (-1298.752) [-1298.826] (-1302.139) (-1299.344) -- 0:00:28 551000 -- [-1299.798] (-1297.937) (-1299.600) (-1300.961) * (-1302.218) (-1298.859) [-1298.538] (-1297.779) -- 0:00:28 551500 -- (-1299.846) (-1297.934) (-1299.052) [-1299.152] * (-1301.540) (-1298.959) (-1299.074) [-1301.062] -- 0:00:28 552000 -- (-1300.999) (-1299.046) [-1298.517] (-1299.210) * (-1301.207) (-1301.198) (-1299.915) [-1299.893] -- 0:00:28 552500 -- (-1300.580) (-1302.664) (-1298.533) [-1301.336] * (-1298.039) [-1301.047] (-1298.205) (-1301.698) -- 0:00:28 553000 -- [-1300.458] (-1303.503) (-1298.458) (-1300.221) * (-1300.557) [-1299.532] (-1298.858) (-1300.493) -- 0:00:28 553500 -- (-1300.024) (-1297.523) (-1298.824) [-1299.362] * [-1298.567] (-1299.366) (-1299.064) (-1298.263) -- 0:00:28 554000 -- [-1305.225] (-1300.414) (-1298.985) (-1304.692) * (-1300.638) [-1299.287] (-1299.055) (-1303.233) -- 0:00:28 554500 -- (-1299.633) [-1298.038] (-1300.666) (-1306.888) * (-1300.499) [-1299.296] (-1298.808) (-1299.871) -- 0:00:28 555000 -- (-1300.402) (-1298.033) (-1301.584) [-1300.026] * (-1299.341) (-1298.561) [-1297.938] (-1303.273) -- 0:00:28 Average standard deviation of split frequencies: 0.013354 555500 -- [-1300.026] (-1298.821) (-1299.009) (-1307.640) * (-1299.883) [-1299.618] (-1298.289) (-1304.886) -- 0:00:28 556000 -- (-1299.764) [-1300.625] (-1298.846) (-1305.540) * [-1297.886] (-1299.181) (-1298.527) (-1298.716) -- 0:00:27 556500 -- (-1302.939) (-1299.599) (-1300.683) [-1303.163] * (-1299.510) (-1303.291) [-1299.428] (-1298.190) -- 0:00:27 557000 -- [-1301.616] (-1301.521) (-1297.574) (-1299.973) * (-1303.427) (-1298.031) [-1299.889] (-1297.709) -- 0:00:27 557500 -- (-1300.728) [-1300.971] (-1298.424) (-1300.910) * (-1299.213) [-1298.686] (-1305.219) (-1297.613) -- 0:00:27 558000 -- [-1298.694] (-1301.132) (-1297.936) (-1298.129) * (-1300.211) [-1299.603] (-1299.406) (-1297.491) -- 0:00:28 558500 -- [-1301.713] (-1299.602) (-1297.784) (-1302.361) * [-1301.180] (-1300.524) (-1297.903) (-1299.735) -- 0:00:28 559000 -- (-1301.183) (-1301.333) (-1297.194) [-1298.928] * (-1302.709) [-1297.494] (-1300.619) (-1299.949) -- 0:00:28 559500 -- (-1303.945) (-1304.122) [-1297.269] (-1297.198) * (-1297.971) (-1298.256) [-1297.822] (-1307.514) -- 0:00:28 560000 -- (-1301.006) (-1302.618) [-1298.367] (-1298.822) * [-1297.496] (-1297.844) (-1299.133) (-1298.832) -- 0:00:28 Average standard deviation of split frequencies: 0.013610 560500 -- (-1299.004) (-1298.735) [-1299.585] (-1302.022) * (-1299.056) (-1298.089) [-1297.782] (-1300.052) -- 0:00:28 561000 -- [-1302.359] (-1300.302) (-1301.677) (-1300.151) * (-1299.228) (-1299.498) [-1299.601] (-1299.668) -- 0:00:28 561500 -- (-1301.383) [-1299.133] (-1300.245) (-1301.048) * (-1299.157) (-1299.894) [-1301.899] (-1301.191) -- 0:00:28 562000 -- [-1297.798] (-1301.604) (-1301.208) (-1298.327) * (-1298.647) [-1300.794] (-1310.136) (-1299.168) -- 0:00:28 562500 -- (-1297.932) (-1298.105) (-1302.320) [-1298.232] * (-1297.790) (-1302.075) [-1301.260] (-1298.512) -- 0:00:28 563000 -- (-1298.842) [-1298.076] (-1300.614) (-1297.971) * (-1299.903) (-1297.892) [-1298.381] (-1300.912) -- 0:00:27 563500 -- (-1303.625) (-1298.980) [-1301.544] (-1304.263) * [-1299.052] (-1297.553) (-1298.405) (-1301.953) -- 0:00:27 564000 -- (-1299.918) [-1298.928] (-1302.406) (-1302.150) * (-1300.617) (-1299.211) [-1298.843] (-1299.224) -- 0:00:27 564500 -- (-1299.962) [-1300.349] (-1300.121) (-1302.000) * (-1301.955) (-1298.741) (-1297.847) [-1299.203] -- 0:00:27 565000 -- [-1299.096] (-1297.396) (-1298.613) (-1300.111) * [-1297.974] (-1303.028) (-1299.750) (-1298.729) -- 0:00:27 Average standard deviation of split frequencies: 0.013586 565500 -- (-1298.999) (-1297.311) [-1297.934] (-1300.524) * [-1297.665] (-1303.440) (-1299.046) (-1299.196) -- 0:00:27 566000 -- (-1299.648) (-1297.778) [-1308.918] (-1301.091) * [-1298.292] (-1299.523) (-1302.774) (-1299.510) -- 0:00:27 566500 -- [-1297.230] (-1299.145) (-1301.835) (-1298.916) * (-1297.472) (-1298.672) (-1303.856) [-1299.434] -- 0:00:27 567000 -- (-1298.568) (-1299.084) (-1299.245) [-1297.879] * (-1300.116) (-1299.315) (-1302.389) [-1299.582] -- 0:00:27 567500 -- [-1299.084] (-1298.820) (-1302.768) (-1297.767) * (-1303.063) (-1298.613) (-1303.793) [-1297.537] -- 0:00:27 568000 -- (-1298.871) [-1299.787] (-1300.979) (-1299.931) * [-1299.166] (-1300.530) (-1303.897) (-1297.835) -- 0:00:27 568500 -- (-1303.400) (-1300.122) [-1298.529] (-1299.902) * (-1299.927) [-1300.794] (-1303.590) (-1301.324) -- 0:00:27 569000 -- [-1298.719] (-1307.265) (-1300.453) (-1298.246) * (-1299.648) (-1299.752) (-1301.741) [-1301.484] -- 0:00:27 569500 -- (-1298.864) (-1304.143) [-1297.771] (-1297.088) * (-1298.809) [-1299.487] (-1300.652) (-1299.135) -- 0:00:27 570000 -- [-1298.927] (-1299.670) (-1299.365) (-1299.255) * (-1297.956) [-1298.979] (-1299.475) (-1299.800) -- 0:00:27 Average standard deviation of split frequencies: 0.013733 570500 -- (-1298.378) [-1301.277] (-1298.471) (-1301.466) * (-1298.317) [-1299.622] (-1299.263) (-1301.994) -- 0:00:27 571000 -- [-1301.772] (-1302.614) (-1297.373) (-1301.609) * (-1297.698) (-1303.682) (-1298.633) [-1301.222] -- 0:00:27 571500 -- [-1299.767] (-1301.579) (-1297.490) (-1299.059) * (-1299.967) [-1300.694] (-1301.263) (-1304.375) -- 0:00:26 572000 -- (-1298.179) [-1298.760] (-1299.574) (-1298.680) * (-1302.580) [-1297.348] (-1301.260) (-1301.366) -- 0:00:26 572500 -- (-1299.334) (-1297.940) (-1301.228) [-1297.861] * (-1298.151) [-1297.891] (-1297.298) (-1299.445) -- 0:00:26 573000 -- [-1301.626] (-1298.413) (-1302.528) (-1299.006) * (-1299.201) [-1298.653] (-1304.111) (-1298.718) -- 0:00:26 573500 -- [-1298.531] (-1302.408) (-1300.998) (-1299.468) * (-1301.945) (-1302.191) (-1299.100) [-1298.312] -- 0:00:26 574000 -- (-1297.716) [-1302.530] (-1299.064) (-1299.248) * (-1300.940) (-1306.091) [-1304.578] (-1302.393) -- 0:00:27 574500 -- (-1298.503) (-1299.399) [-1300.654] (-1299.670) * [-1299.425] (-1301.545) (-1302.436) (-1299.375) -- 0:00:27 575000 -- [-1298.409] (-1301.729) (-1298.387) (-1299.703) * (-1298.704) (-1298.449) (-1298.646) [-1300.245] -- 0:00:27 Average standard deviation of split frequencies: 0.012992 575500 -- [-1297.679] (-1300.611) (-1299.137) (-1297.432) * (-1299.439) (-1298.107) (-1301.746) [-1299.420] -- 0:00:27 576000 -- [-1298.339] (-1299.139) (-1300.827) (-1298.227) * [-1299.303] (-1301.585) (-1301.501) (-1303.885) -- 0:00:27 576500 -- (-1299.062) (-1300.693) (-1299.684) [-1301.242] * (-1299.306) (-1298.146) (-1297.686) [-1299.772] -- 0:00:27 577000 -- (-1300.489) (-1299.960) [-1301.165] (-1300.076) * (-1297.765) (-1300.458) [-1297.490] (-1298.667) -- 0:00:27 577500 -- (-1298.040) (-1298.258) (-1299.228) [-1297.705] * (-1298.379) (-1299.378) (-1297.371) [-1299.389] -- 0:00:27 578000 -- (-1301.756) (-1301.134) (-1299.216) [-1298.654] * (-1297.975) [-1300.914] (-1303.427) (-1299.414) -- 0:00:27 578500 -- (-1297.690) (-1300.679) [-1298.433] (-1299.791) * (-1298.982) [-1299.618] (-1298.880) (-1299.597) -- 0:00:26 579000 -- (-1299.076) [-1299.174] (-1297.996) (-1307.183) * (-1299.384) (-1298.071) [-1297.397] (-1300.352) -- 0:00:26 579500 -- [-1298.261] (-1300.265) (-1302.930) (-1308.635) * (-1303.675) [-1300.676] (-1301.898) (-1297.740) -- 0:00:26 580000 -- (-1298.445) (-1299.883) [-1304.615] (-1301.945) * (-1300.482) (-1301.922) [-1300.048] (-1299.028) -- 0:00:26 Average standard deviation of split frequencies: 0.013649 580500 -- [-1298.635] (-1299.821) (-1301.399) (-1298.667) * (-1303.342) (-1298.128) [-1299.851] (-1300.892) -- 0:00:26 581000 -- (-1299.051) (-1302.768) [-1302.141] (-1299.402) * (-1298.621) (-1298.092) [-1297.516] (-1298.375) -- 0:00:26 581500 -- [-1299.528] (-1305.334) (-1301.798) (-1300.329) * (-1298.922) [-1297.551] (-1297.528) (-1304.956) -- 0:00:26 582000 -- (-1298.779) (-1306.301) [-1297.916] (-1302.436) * (-1297.757) (-1298.209) (-1302.721) [-1301.922] -- 0:00:26 582500 -- (-1299.078) (-1303.912) [-1302.245] (-1301.883) * (-1300.701) (-1298.719) (-1301.615) [-1299.293] -- 0:00:26 583000 -- [-1298.987] (-1304.281) (-1301.948) (-1300.593) * (-1299.398) (-1305.308) [-1299.433] (-1301.864) -- 0:00:26 583500 -- (-1299.344) (-1301.756) [-1299.047] (-1303.044) * [-1298.827] (-1302.487) (-1300.047) (-1301.463) -- 0:00:26 584000 -- (-1300.702) (-1301.195) [-1299.021] (-1298.679) * [-1297.367] (-1298.774) (-1302.907) (-1297.963) -- 0:00:26 584500 -- [-1298.164] (-1300.863) (-1299.188) (-1298.367) * [-1298.092] (-1296.915) (-1306.180) (-1297.996) -- 0:00:26 585000 -- (-1300.203) (-1297.975) [-1299.778] (-1298.925) * (-1299.732) (-1297.108) [-1302.643] (-1299.667) -- 0:00:26 Average standard deviation of split frequencies: 0.012972 585500 -- (-1300.999) (-1299.560) [-1297.921] (-1299.886) * [-1301.233] (-1298.370) (-1300.712) (-1301.079) -- 0:00:26 586000 -- (-1301.467) (-1298.185) (-1299.008) [-1301.032] * (-1302.894) (-1298.313) [-1301.005] (-1298.811) -- 0:00:26 586500 -- (-1304.077) [-1299.478] (-1297.667) (-1302.032) * [-1300.937] (-1297.628) (-1297.268) (-1299.289) -- 0:00:26 587000 -- (-1298.585) (-1303.506) [-1298.488] (-1300.192) * [-1297.174] (-1298.928) (-1297.324) (-1298.210) -- 0:00:26 587500 -- (-1301.090) [-1300.485] (-1298.876) (-1300.795) * (-1298.027) (-1299.853) [-1300.309] (-1300.058) -- 0:00:25 588000 -- [-1297.819] (-1299.014) (-1297.345) (-1301.409) * (-1299.284) (-1300.381) (-1300.037) [-1301.215] -- 0:00:25 588500 -- (-1297.795) (-1299.275) [-1297.618] (-1298.218) * (-1301.345) (-1304.176) [-1297.749] (-1305.777) -- 0:00:25 589000 -- (-1299.087) (-1300.467) (-1297.710) [-1297.979] * (-1300.450) (-1301.038) (-1297.172) [-1297.433] -- 0:00:25 589500 -- (-1299.127) (-1301.599) (-1298.208) [-1297.747] * (-1300.568) (-1298.129) (-1297.912) [-1298.767] -- 0:00:25 590000 -- (-1299.819) (-1297.504) (-1297.663) [-1300.174] * (-1301.303) (-1297.891) [-1299.143] (-1298.332) -- 0:00:25 Average standard deviation of split frequencies: 0.012670 590500 -- [-1298.989] (-1297.500) (-1299.045) (-1302.096) * [-1298.158] (-1301.649) (-1299.544) (-1301.068) -- 0:00:26 591000 -- (-1298.796) (-1297.223) (-1301.431) [-1298.589] * [-1298.423] (-1298.637) (-1304.501) (-1300.338) -- 0:00:26 591500 -- (-1300.037) (-1297.476) (-1301.258) [-1298.586] * (-1300.413) [-1297.544] (-1298.252) (-1298.016) -- 0:00:26 592000 -- (-1302.286) [-1298.587] (-1298.592) (-1300.320) * (-1301.001) (-1298.777) [-1297.307] (-1297.741) -- 0:00:26 592500 -- (-1301.899) (-1298.549) [-1304.939] (-1300.956) * (-1297.787) (-1297.977) [-1298.113] (-1301.493) -- 0:00:26 593000 -- (-1299.304) [-1299.999] (-1298.239) (-1298.362) * [-1298.166] (-1301.019) (-1300.414) (-1299.819) -- 0:00:26 593500 -- (-1301.314) (-1299.024) [-1298.758] (-1298.379) * (-1300.227) [-1302.102] (-1298.475) (-1298.600) -- 0:00:26 594000 -- (-1298.902) (-1299.339) [-1298.151] (-1297.828) * [-1298.208] (-1300.513) (-1300.216) (-1298.490) -- 0:00:25 594500 -- (-1297.464) (-1300.949) (-1297.910) [-1305.493] * [-1297.717] (-1300.262) (-1300.831) (-1302.871) -- 0:00:25 595000 -- (-1302.534) (-1300.274) [-1297.996] (-1298.800) * [-1298.300] (-1299.393) (-1302.407) (-1300.349) -- 0:00:25 Average standard deviation of split frequencies: 0.012444 595500 -- (-1298.883) [-1300.473] (-1297.427) (-1298.533) * (-1299.160) [-1298.190] (-1301.967) (-1297.193) -- 0:00:25 596000 -- (-1300.691) (-1299.716) [-1299.245] (-1304.243) * (-1299.714) (-1298.528) (-1300.000) [-1297.884] -- 0:00:25 596500 -- (-1303.247) (-1299.978) [-1298.111] (-1299.965) * (-1297.614) [-1299.898] (-1301.910) (-1301.076) -- 0:00:25 597000 -- (-1299.847) (-1299.027) [-1297.994] (-1300.910) * [-1297.362] (-1299.574) (-1297.600) (-1301.556) -- 0:00:25 597500 -- (-1297.689) (-1301.082) (-1300.676) [-1299.581] * [-1301.955] (-1301.430) (-1303.453) (-1300.229) -- 0:00:25 598000 -- (-1301.226) [-1304.506] (-1300.152) (-1298.558) * (-1297.553) [-1299.419] (-1299.094) (-1298.638) -- 0:00:25 598500 -- (-1300.033) (-1301.056) [-1299.300] (-1299.034) * (-1299.571) [-1301.426] (-1304.110) (-1297.484) -- 0:00:25 599000 -- [-1300.321] (-1298.057) (-1300.254) (-1298.145) * (-1299.005) (-1297.512) (-1301.748) [-1298.941] -- 0:00:25 599500 -- (-1299.777) [-1297.887] (-1299.403) (-1298.416) * (-1299.354) (-1298.376) (-1300.801) [-1297.165] -- 0:00:25 600000 -- (-1299.143) [-1298.695] (-1297.884) (-1299.459) * [-1297.933] (-1299.799) (-1299.212) (-1303.021) -- 0:00:25 Average standard deviation of split frequencies: 0.012191 600500 -- [-1298.867] (-1297.602) (-1300.198) (-1299.825) * (-1298.403) (-1300.925) [-1297.887] (-1305.165) -- 0:00:25 601000 -- (-1297.947) [-1297.697] (-1297.178) (-1301.978) * (-1299.339) (-1299.352) (-1299.217) [-1301.419] -- 0:00:25 601500 -- (-1298.174) (-1299.094) [-1297.178] (-1303.720) * (-1299.521) [-1299.189] (-1298.923) (-1298.709) -- 0:00:25 602000 -- (-1298.845) (-1298.837) (-1297.778) [-1298.792] * (-1298.942) [-1298.846] (-1300.736) (-1297.642) -- 0:00:25 602500 -- (-1301.838) [-1297.286] (-1298.030) (-1299.176) * (-1299.235) (-1298.070) [-1302.205] (-1298.214) -- 0:00:25 603000 -- (-1297.759) (-1299.943) (-1303.722) [-1299.693] * (-1301.616) (-1297.829) [-1302.078] (-1301.402) -- 0:00:25 603500 -- [-1298.673] (-1298.978) (-1297.526) (-1298.711) * (-1301.649) (-1298.865) (-1298.668) [-1300.578] -- 0:00:24 604000 -- [-1298.616] (-1299.954) (-1298.581) (-1298.053) * (-1300.223) (-1299.596) (-1300.227) [-1299.747] -- 0:00:24 604500 -- (-1299.820) (-1297.899) [-1298.084] (-1300.131) * [-1300.297] (-1299.757) (-1300.625) (-1299.571) -- 0:00:24 605000 -- (-1301.375) (-1299.368) (-1298.312) [-1299.185] * (-1301.966) [-1301.334] (-1300.606) (-1301.436) -- 0:00:24 Average standard deviation of split frequencies: 0.011182 605500 -- (-1297.657) (-1299.814) (-1298.704) [-1304.689] * [-1299.665] (-1299.662) (-1302.663) (-1300.491) -- 0:00:24 606000 -- (-1298.039) [-1298.714] (-1298.437) (-1300.306) * [-1298.299] (-1300.143) (-1299.996) (-1298.275) -- 0:00:25 606500 -- (-1297.785) [-1298.482] (-1300.252) (-1297.978) * (-1298.376) (-1300.760) [-1299.442] (-1299.663) -- 0:00:25 607000 -- (-1299.678) [-1300.117] (-1299.592) (-1297.996) * (-1299.334) [-1300.760] (-1301.538) (-1298.396) -- 0:00:25 607500 -- (-1300.596) (-1298.673) [-1297.549] (-1302.486) * (-1297.779) (-1300.032) [-1298.037] (-1298.999) -- 0:00:25 608000 -- (-1297.882) [-1298.687] (-1299.532) (-1299.590) * [-1298.507] (-1297.462) (-1299.473) (-1297.884) -- 0:00:25 608500 -- [-1298.474] (-1298.658) (-1301.162) (-1299.191) * [-1299.920] (-1301.077) (-1299.628) (-1300.026) -- 0:00:25 609000 -- (-1297.652) (-1299.456) (-1298.228) [-1299.803] * (-1298.781) [-1300.389] (-1302.964) (-1301.405) -- 0:00:25 609500 -- (-1297.656) (-1301.509) [-1302.171] (-1298.217) * (-1299.721) [-1297.577] (-1306.877) (-1299.100) -- 0:00:24 610000 -- (-1300.351) (-1299.155) [-1297.922] (-1301.287) * [-1300.462] (-1303.790) (-1298.817) (-1299.593) -- 0:00:24 Average standard deviation of split frequencies: 0.011145 610500 -- (-1299.154) [-1302.490] (-1297.714) (-1301.965) * (-1304.001) (-1302.725) (-1300.127) [-1300.023] -- 0:00:24 611000 -- (-1299.028) (-1300.432) (-1297.653) [-1300.032] * [-1299.914] (-1299.513) (-1300.310) (-1298.537) -- 0:00:24 611500 -- (-1297.670) (-1299.705) [-1298.335] (-1300.641) * (-1298.991) (-1300.516) [-1299.871] (-1300.052) -- 0:00:24 612000 -- (-1299.539) (-1299.909) [-1298.444] (-1300.018) * [-1297.930] (-1298.647) (-1299.177) (-1298.541) -- 0:00:24 612500 -- [-1300.129] (-1298.999) (-1299.237) (-1298.340) * [-1298.395] (-1299.138) (-1299.040) (-1302.352) -- 0:00:24 613000 -- (-1299.260) (-1297.825) [-1300.496] (-1302.051) * (-1301.647) (-1298.464) (-1297.850) [-1302.869] -- 0:00:24 613500 -- (-1305.933) [-1299.432] (-1303.471) (-1298.752) * (-1301.209) [-1299.576] (-1301.679) (-1300.760) -- 0:00:24 614000 -- (-1305.712) (-1308.285) (-1301.782) [-1300.410] * [-1298.913] (-1299.230) (-1297.806) (-1297.969) -- 0:00:24 614500 -- [-1302.420] (-1301.777) (-1300.303) (-1299.130) * (-1310.350) (-1298.244) [-1302.018] (-1297.949) -- 0:00:24 615000 -- (-1301.006) (-1300.629) [-1299.551] (-1303.996) * (-1300.088) (-1299.172) [-1299.803] (-1299.389) -- 0:00:24 Average standard deviation of split frequencies: 0.010666 615500 -- [-1298.940] (-1298.785) (-1298.015) (-1300.014) * (-1299.831) [-1297.670] (-1297.903) (-1297.160) -- 0:00:24 616000 -- (-1299.269) (-1300.580) (-1297.103) [-1299.090] * (-1298.777) (-1298.367) (-1300.359) [-1297.150] -- 0:00:24 616500 -- (-1301.517) (-1300.118) (-1297.397) [-1301.244] * [-1299.475] (-1297.906) (-1299.956) (-1298.665) -- 0:00:24 617000 -- (-1301.576) (-1299.012) (-1302.039) [-1301.997] * [-1301.123] (-1298.550) (-1301.604) (-1298.843) -- 0:00:24 617500 -- (-1300.504) (-1302.175) [-1299.104] (-1298.878) * (-1299.034) (-1300.167) [-1298.560] (-1298.665) -- 0:00:24 618000 -- (-1298.637) (-1299.512) [-1299.078] (-1299.770) * [-1302.798] (-1300.186) (-1297.560) (-1300.522) -- 0:00:24 618500 -- [-1298.070] (-1299.915) (-1299.114) (-1298.706) * (-1298.321) [-1298.686] (-1298.510) (-1301.974) -- 0:00:24 619000 -- (-1298.177) (-1299.792) (-1299.255) [-1298.777] * (-1298.904) [-1299.376] (-1301.010) (-1303.036) -- 0:00:24 619500 -- (-1298.784) (-1298.023) [-1299.359] (-1297.844) * [-1298.218] (-1297.778) (-1300.347) (-1298.133) -- 0:00:23 620000 -- (-1299.143) (-1300.100) (-1298.779) [-1298.041] * (-1299.444) (-1297.558) [-1298.882] (-1300.403) -- 0:00:23 Average standard deviation of split frequencies: 0.010301 620500 -- (-1298.614) (-1298.320) [-1297.977] (-1299.702) * (-1300.337) [-1298.628] (-1303.100) (-1299.998) -- 0:00:23 621000 -- (-1297.063) (-1300.025) [-1297.979] (-1299.455) * (-1302.930) (-1299.705) [-1298.585] (-1298.299) -- 0:00:23 621500 -- (-1302.032) [-1299.216] (-1297.662) (-1300.209) * (-1301.266) [-1303.855] (-1298.236) (-1298.462) -- 0:00:23 622000 -- [-1299.176] (-1297.949) (-1297.295) (-1301.240) * [-1303.020] (-1299.240) (-1298.337) (-1300.404) -- 0:00:23 622500 -- (-1301.057) [-1298.732] (-1298.721) (-1302.812) * [-1299.457] (-1301.232) (-1298.070) (-1300.115) -- 0:00:24 623000 -- (-1299.196) (-1299.503) (-1299.454) [-1300.437] * (-1301.094) (-1298.097) (-1298.109) [-1300.637] -- 0:00:24 623500 -- (-1299.362) (-1299.163) (-1300.527) [-1297.483] * [-1298.234] (-1298.140) (-1302.045) (-1299.011) -- 0:00:24 624000 -- (-1298.443) (-1301.552) [-1298.550] (-1297.996) * [-1297.232] (-1301.089) (-1299.174) (-1297.591) -- 0:00:24 624500 -- (-1298.117) (-1300.015) (-1298.725) [-1297.400] * (-1301.139) (-1299.691) [-1301.091] (-1309.099) -- 0:00:24 625000 -- [-1297.967] (-1300.809) (-1300.664) (-1297.258) * (-1298.335) (-1299.916) [-1299.369] (-1307.181) -- 0:00:24 Average standard deviation of split frequencies: 0.010448 625500 -- [-1298.930] (-1299.630) (-1301.130) (-1299.688) * (-1298.359) (-1298.742) (-1298.765) [-1300.450] -- 0:00:23 626000 -- (-1301.363) [-1300.361] (-1303.725) (-1303.126) * [-1298.841] (-1299.691) (-1300.438) (-1298.049) -- 0:00:23 626500 -- (-1300.821) (-1302.809) (-1298.975) [-1301.331] * (-1298.889) [-1297.900] (-1298.866) (-1300.295) -- 0:00:23 627000 -- (-1299.689) (-1298.949) (-1298.022) [-1300.934] * (-1300.415) (-1297.867) (-1302.419) [-1298.508] -- 0:00:23 627500 -- (-1300.220) (-1298.753) [-1297.798] (-1299.398) * [-1298.878] (-1299.278) (-1302.935) (-1298.526) -- 0:00:23 628000 -- (-1301.885) (-1297.140) [-1299.532] (-1301.333) * (-1297.302) [-1299.248] (-1298.391) (-1299.942) -- 0:00:23 628500 -- [-1300.135] (-1298.280) (-1301.921) (-1299.822) * (-1298.259) (-1298.479) [-1299.185] (-1298.354) -- 0:00:23 629000 -- (-1299.200) (-1299.934) [-1298.325] (-1300.410) * (-1299.011) (-1301.481) (-1297.301) [-1298.353] -- 0:00:23 629500 -- [-1299.837] (-1301.963) (-1298.185) (-1299.491) * (-1299.946) (-1303.317) [-1297.939] (-1297.936) -- 0:00:23 630000 -- [-1298.887] (-1298.331) (-1298.267) (-1299.491) * (-1297.991) (-1299.735) (-1301.855) [-1299.369] -- 0:00:23 Average standard deviation of split frequencies: 0.010963 630500 -- (-1297.240) [-1298.018] (-1301.573) (-1298.555) * (-1297.838) [-1300.028] (-1298.828) (-1302.908) -- 0:00:23 631000 -- (-1298.831) [-1298.122] (-1300.756) (-1299.218) * (-1300.451) (-1298.926) (-1298.017) [-1298.885] -- 0:00:23 631500 -- (-1299.570) [-1297.780] (-1300.779) (-1299.071) * [-1297.227] (-1299.960) (-1298.964) (-1298.469) -- 0:00:23 632000 -- (-1300.541) [-1298.783] (-1300.242) (-1298.662) * [-1298.279] (-1303.571) (-1299.466) (-1298.529) -- 0:00:23 632500 -- (-1299.200) (-1298.194) (-1303.834) [-1298.038] * (-1298.433) [-1298.186] (-1298.936) (-1300.001) -- 0:00:23 633000 -- (-1299.172) [-1297.748] (-1300.652) (-1301.817) * (-1299.368) (-1301.953) [-1300.384] (-1299.914) -- 0:00:23 633500 -- (-1300.799) (-1297.687) [-1298.049] (-1303.365) * (-1302.443) (-1298.767) [-1298.170] (-1304.356) -- 0:00:23 634000 -- [-1299.349] (-1300.077) (-1301.462) (-1297.937) * (-1310.740) [-1300.882] (-1298.073) (-1299.494) -- 0:00:23 634500 -- (-1299.102) (-1297.276) (-1300.223) [-1297.695] * (-1310.022) (-1297.691) (-1297.916) [-1304.092] -- 0:00:23 635000 -- (-1299.350) (-1297.276) [-1304.257] (-1297.592) * (-1305.931) [-1297.376] (-1297.711) (-1297.486) -- 0:00:22 Average standard deviation of split frequencies: 0.010673 635500 -- [-1299.937] (-1298.496) (-1298.786) (-1300.100) * [-1301.404] (-1298.534) (-1300.914) (-1297.197) -- 0:00:22 636000 -- (-1303.827) (-1299.411) [-1297.036] (-1298.722) * [-1300.159] (-1300.212) (-1301.118) (-1297.629) -- 0:00:22 636500 -- (-1299.517) (-1302.507) [-1297.814] (-1300.624) * (-1301.678) (-1299.994) (-1299.416) [-1298.381] -- 0:00:22 637000 -- (-1300.514) (-1298.591) (-1300.625) [-1305.603] * [-1300.532] (-1303.995) (-1298.066) (-1300.557) -- 0:00:22 637500 -- [-1305.191] (-1297.969) (-1299.738) (-1299.837) * (-1303.891) (-1300.104) [-1298.134] (-1298.008) -- 0:00:22 638000 -- (-1302.477) (-1298.356) (-1298.525) [-1300.237] * [-1302.576] (-1299.854) (-1298.191) (-1299.356) -- 0:00:22 638500 -- (-1301.539) [-1298.788] (-1298.351) (-1306.815) * (-1300.237) (-1297.840) [-1298.263] (-1299.067) -- 0:00:23 639000 -- (-1298.059) (-1297.636) [-1301.857] (-1300.033) * [-1299.077] (-1297.064) (-1299.118) (-1297.822) -- 0:00:23 639500 -- (-1298.133) (-1300.892) (-1299.480) [-1298.193] * (-1297.459) (-1300.872) (-1298.926) [-1301.833] -- 0:00:23 640000 -- [-1298.486] (-1298.351) (-1298.491) (-1298.983) * [-1298.535] (-1297.934) (-1303.054) (-1304.347) -- 0:00:23 Average standard deviation of split frequencies: 0.010694 640500 -- (-1298.998) (-1298.244) (-1305.597) [-1300.136] * (-1304.129) (-1299.165) [-1300.618] (-1298.618) -- 0:00:23 641000 -- (-1298.002) [-1297.311] (-1300.556) (-1301.017) * (-1300.259) (-1299.727) [-1299.650] (-1298.173) -- 0:00:22 641500 -- (-1301.104) [-1297.559] (-1299.962) (-1300.629) * [-1301.989] (-1297.144) (-1299.435) (-1301.789) -- 0:00:22 642000 -- (-1299.813) [-1297.886] (-1299.711) (-1302.959) * (-1305.305) (-1300.159) [-1300.581] (-1300.318) -- 0:00:22 642500 -- (-1301.045) (-1301.034) (-1298.320) [-1299.294] * (-1305.465) [-1296.993] (-1299.359) (-1304.126) -- 0:00:22 643000 -- (-1299.543) [-1299.470] (-1298.928) (-1299.836) * [-1297.835] (-1300.594) (-1300.141) (-1302.766) -- 0:00:22 643500 -- (-1299.358) (-1299.196) [-1298.672] (-1302.732) * (-1301.904) (-1301.009) (-1299.216) [-1299.926] -- 0:00:22 644000 -- (-1298.535) (-1298.482) [-1299.237] (-1297.519) * (-1304.009) (-1298.025) [-1301.286] (-1299.703) -- 0:00:22 644500 -- (-1300.789) [-1299.993] (-1300.957) (-1300.345) * (-1300.224) (-1298.025) (-1301.992) [-1298.748] -- 0:00:22 645000 -- (-1299.541) (-1298.385) (-1297.956) [-1299.929] * (-1302.119) (-1298.064) [-1301.269] (-1297.575) -- 0:00:22 Average standard deviation of split frequencies: 0.010557 645500 -- (-1299.595) [-1299.164] (-1300.421) (-1300.335) * (-1301.200) (-1299.594) (-1297.389) [-1299.696] -- 0:00:22 646000 -- (-1302.188) [-1298.804] (-1298.273) (-1298.041) * (-1298.731) [-1298.603] (-1299.973) (-1298.460) -- 0:00:22 646500 -- (-1304.507) (-1298.663) (-1300.077) [-1298.416] * [-1300.348] (-1299.267) (-1298.326) (-1298.944) -- 0:00:22 647000 -- (-1303.869) [-1298.478] (-1303.072) (-1303.061) * (-1302.516) (-1299.092) [-1298.650] (-1299.610) -- 0:00:22 647500 -- (-1297.635) (-1297.602) [-1299.415] (-1300.666) * [-1299.281] (-1300.593) (-1301.716) (-1300.290) -- 0:00:22 648000 -- (-1299.121) (-1297.733) [-1299.531] (-1297.268) * (-1300.319) [-1298.760] (-1299.565) (-1299.545) -- 0:00:22 648500 -- (-1301.155) (-1299.404) [-1300.259] (-1298.432) * (-1299.171) (-1299.877) [-1297.916] (-1297.925) -- 0:00:22 649000 -- [-1298.568] (-1298.972) (-1301.370) (-1300.099) * (-1298.916) (-1302.545) (-1300.357) [-1297.510] -- 0:00:22 649500 -- (-1301.217) (-1298.254) [-1303.345] (-1298.709) * [-1298.467] (-1300.493) (-1304.027) (-1301.238) -- 0:00:22 650000 -- (-1303.519) [-1298.439] (-1298.865) (-1300.385) * (-1299.667) (-1300.847) [-1298.044] (-1300.629) -- 0:00:22 Average standard deviation of split frequencies: 0.009781 650500 -- (-1300.934) (-1298.012) [-1297.391] (-1303.438) * (-1304.062) (-1300.966) [-1296.903] (-1303.955) -- 0:00:22 651000 -- (-1303.364) (-1300.090) [-1297.635] (-1301.103) * [-1298.960] (-1302.927) (-1299.580) (-1298.214) -- 0:00:21 651500 -- (-1300.518) (-1301.982) (-1297.599) [-1298.892] * (-1301.894) (-1298.848) [-1297.974] (-1297.571) -- 0:00:21 652000 -- (-1298.296) (-1301.265) (-1297.929) [-1301.445] * (-1302.487) (-1299.134) [-1300.420] (-1300.106) -- 0:00:21 652500 -- (-1297.533) (-1299.336) (-1298.340) [-1303.912] * (-1299.724) (-1297.939) [-1298.535] (-1298.541) -- 0:00:21 653000 -- (-1299.574) (-1298.469) [-1299.141] (-1303.375) * (-1298.350) (-1305.891) (-1298.062) [-1301.689] -- 0:00:21 653500 -- (-1297.293) [-1297.178] (-1298.289) (-1301.648) * (-1298.376) [-1304.438] (-1298.514) (-1301.689) -- 0:00:21 654000 -- (-1297.951) [-1298.754] (-1301.405) (-1301.316) * (-1299.026) (-1299.091) [-1299.304] (-1299.225) -- 0:00:21 654500 -- [-1300.521] (-1298.197) (-1298.043) (-1297.936) * [-1298.985] (-1303.804) (-1298.476) (-1298.646) -- 0:00:22 655000 -- (-1298.396) [-1303.373] (-1299.926) (-1297.977) * (-1300.043) [-1299.047] (-1302.066) (-1298.798) -- 0:00:22 Average standard deviation of split frequencies: 0.009611 655500 -- (-1299.269) (-1298.363) [-1297.644] (-1301.319) * (-1304.262) (-1298.443) (-1300.084) [-1300.459] -- 0:00:22 656000 -- (-1297.469) (-1300.138) [-1298.977] (-1300.208) * (-1298.965) [-1299.057] (-1301.143) (-1300.548) -- 0:00:22 656500 -- (-1301.351) (-1298.917) [-1299.892] (-1299.158) * [-1297.750] (-1299.133) (-1297.379) (-1299.558) -- 0:00:21 657000 -- [-1299.411] (-1299.509) (-1299.425) (-1298.277) * (-1298.289) [-1298.127] (-1297.540) (-1300.114) -- 0:00:21 657500 -- (-1306.954) (-1300.273) [-1299.485] (-1302.677) * (-1300.664) [-1297.919] (-1299.774) (-1298.390) -- 0:00:21 658000 -- (-1299.705) (-1299.813) [-1299.254] (-1298.259) * [-1301.845] (-1301.119) (-1302.469) (-1299.467) -- 0:00:21 658500 -- (-1301.821) (-1299.726) (-1299.705) [-1298.521] * (-1302.132) [-1301.246] (-1302.147) (-1300.842) -- 0:00:21 659000 -- (-1299.025) (-1301.476) (-1298.143) [-1298.521] * (-1301.844) (-1300.992) [-1298.239] (-1299.900) -- 0:00:21 659500 -- (-1297.276) (-1303.143) (-1300.758) [-1299.776] * (-1297.753) [-1297.753] (-1298.960) (-1301.626) -- 0:00:21 660000 -- [-1298.752] (-1301.307) (-1299.773) (-1300.829) * (-1297.882) (-1298.080) [-1298.555] (-1298.586) -- 0:00:21 Average standard deviation of split frequencies: 0.009677 660500 -- (-1299.139) (-1298.485) (-1305.310) [-1299.569] * (-1298.293) (-1300.234) (-1297.875) [-1301.136] -- 0:00:21 661000 -- (-1301.461) (-1305.188) [-1297.372] (-1299.897) * (-1300.472) [-1298.352] (-1303.592) (-1298.791) -- 0:00:21 661500 -- (-1307.963) (-1299.060) (-1299.663) [-1300.631] * (-1300.142) [-1298.628] (-1298.782) (-1300.589) -- 0:00:21 662000 -- (-1304.676) (-1299.781) [-1297.713] (-1302.481) * [-1299.406] (-1299.496) (-1298.687) (-1299.665) -- 0:00:21 662500 -- (-1301.377) (-1298.733) [-1298.176] (-1299.328) * (-1300.235) [-1299.352] (-1299.288) (-1301.939) -- 0:00:21 663000 -- (-1298.934) (-1298.957) [-1298.392] (-1297.435) * [-1300.343] (-1300.610) (-1298.292) (-1300.404) -- 0:00:21 663500 -- (-1302.908) (-1299.275) (-1298.392) [-1298.996] * [-1298.823] (-1298.946) (-1299.873) (-1298.209) -- 0:00:21 664000 -- (-1301.817) (-1298.105) (-1299.458) [-1301.056] * (-1297.575) (-1302.524) (-1300.528) [-1298.384] -- 0:00:21 664500 -- (-1298.009) (-1298.516) [-1299.148] (-1300.174) * (-1299.201) (-1300.055) [-1299.163] (-1298.095) -- 0:00:21 665000 -- [-1299.264] (-1298.291) (-1298.929) (-1298.755) * (-1297.656) (-1299.227) (-1300.963) [-1299.672] -- 0:00:21 Average standard deviation of split frequencies: 0.010284 665500 -- (-1297.255) (-1300.594) [-1298.218] (-1298.864) * (-1301.521) (-1300.278) (-1301.615) [-1302.078] -- 0:00:21 666000 -- [-1300.245] (-1298.234) (-1305.199) (-1301.417) * (-1299.177) (-1299.964) [-1303.317] (-1297.767) -- 0:00:21 666500 -- (-1298.916) (-1302.248) (-1298.488) [-1298.479] * (-1299.876) (-1298.262) [-1300.863] (-1297.687) -- 0:00:21 667000 -- (-1300.298) [-1301.016] (-1298.563) (-1300.965) * [-1300.967] (-1300.327) (-1301.852) (-1298.387) -- 0:00:20 667500 -- (-1298.819) (-1299.479) (-1299.030) [-1299.626] * [-1298.979] (-1298.470) (-1300.537) (-1301.971) -- 0:00:20 668000 -- (-1301.330) (-1299.543) [-1301.213] (-1299.225) * (-1299.152) (-1299.203) (-1299.248) [-1300.126] -- 0:00:20 668500 -- (-1300.242) (-1300.738) [-1299.074] (-1299.308) * [-1306.996] (-1298.094) (-1299.704) (-1300.015) -- 0:00:20 669000 -- (-1299.018) (-1299.003) [-1298.777] (-1299.962) * (-1299.676) [-1297.945] (-1303.126) (-1298.298) -- 0:00:20 669500 -- (-1298.871) [-1299.143] (-1298.336) (-1300.910) * (-1308.816) [-1298.228] (-1302.724) (-1302.641) -- 0:00:20 670000 -- [-1299.793] (-1298.885) (-1297.994) (-1300.986) * (-1300.709) (-1302.433) (-1297.745) [-1299.998] -- 0:00:20 Average standard deviation of split frequencies: 0.010171 670500 -- (-1300.933) (-1299.049) [-1298.006] (-1298.902) * (-1298.689) (-1299.394) (-1297.104) [-1300.303] -- 0:00:21 671000 -- (-1300.697) (-1298.077) (-1300.566) [-1297.728] * (-1297.724) (-1299.216) [-1299.086] (-1300.139) -- 0:00:21 671500 -- (-1299.898) [-1298.092] (-1299.889) (-1299.161) * (-1299.404) [-1298.586] (-1300.926) (-1303.033) -- 0:00:21 672000 -- (-1298.807) (-1304.409) (-1297.662) [-1297.887] * (-1299.319) (-1300.637) (-1298.397) [-1298.301] -- 0:00:20 672500 -- (-1299.229) (-1299.915) (-1297.369) [-1301.026] * (-1300.336) (-1297.392) [-1299.360] (-1298.486) -- 0:00:20 673000 -- (-1300.211) [-1300.670] (-1297.779) (-1299.032) * (-1301.690) (-1297.515) [-1298.409] (-1300.539) -- 0:00:20 673500 -- [-1297.588] (-1300.158) (-1298.164) (-1297.633) * (-1300.368) (-1297.091) [-1300.732] (-1302.205) -- 0:00:20 674000 -- [-1297.796] (-1297.683) (-1298.912) (-1298.803) * (-1298.027) [-1298.747] (-1298.857) (-1298.910) -- 0:00:20 674500 -- (-1297.773) (-1298.429) [-1298.226] (-1298.723) * (-1297.755) (-1298.070) [-1300.709] (-1300.019) -- 0:00:20 675000 -- (-1301.735) (-1298.214) [-1298.034] (-1299.090) * (-1298.980) (-1298.764) (-1299.319) [-1300.015] -- 0:00:20 Average standard deviation of split frequencies: 0.010419 675500 -- (-1298.355) (-1298.267) [-1297.924] (-1299.121) * [-1298.435] (-1297.343) (-1299.205) (-1297.568) -- 0:00:20 676000 -- (-1301.168) (-1297.256) (-1298.440) [-1298.281] * (-1297.937) (-1297.726) [-1298.990] (-1299.301) -- 0:00:20 676500 -- (-1300.746) (-1297.297) (-1298.478) [-1297.867] * [-1297.984] (-1298.072) (-1300.358) (-1299.210) -- 0:00:20 677000 -- (-1299.283) (-1298.941) (-1301.388) [-1300.487] * (-1297.620) (-1298.670) (-1302.028) [-1301.298] -- 0:00:20 677500 -- (-1300.060) (-1297.839) (-1300.873) [-1299.559] * (-1297.844) (-1298.801) (-1299.058) [-1301.561] -- 0:00:20 678000 -- (-1298.289) (-1301.665) (-1300.779) [-1299.403] * (-1297.819) [-1299.609] (-1298.969) (-1298.901) -- 0:00:20 678500 -- (-1303.145) (-1299.653) [-1297.833] (-1301.023) * (-1299.341) [-1299.049] (-1298.223) (-1299.961) -- 0:00:20 679000 -- [-1301.122] (-1300.123) (-1304.173) (-1298.767) * (-1299.934) (-1300.294) [-1300.955] (-1300.078) -- 0:00:20 679500 -- (-1300.395) (-1299.093) (-1297.964) [-1298.242] * [-1299.363] (-1300.731) (-1299.003) (-1303.794) -- 0:00:20 680000 -- (-1302.214) [-1297.863] (-1299.445) (-1298.343) * (-1297.382) (-1298.745) (-1298.834) [-1298.350] -- 0:00:20 Average standard deviation of split frequencies: 0.010266 680500 -- [-1301.586] (-1298.013) (-1298.835) (-1299.277) * [-1298.252] (-1297.793) (-1299.526) (-1297.325) -- 0:00:20 681000 -- (-1298.050) [-1298.368] (-1302.935) (-1302.070) * (-1298.733) (-1298.543) (-1302.065) [-1297.884] -- 0:00:20 681500 -- (-1299.695) (-1300.758) (-1305.270) [-1299.312] * (-1299.938) (-1304.150) (-1297.644) [-1304.375] -- 0:00:20 682000 -- (-1302.892) (-1302.158) (-1306.075) [-1300.774] * [-1297.778] (-1299.402) (-1299.957) (-1302.189) -- 0:00:20 682500 -- (-1303.107) [-1306.746] (-1302.159) (-1303.295) * [-1298.359] (-1298.650) (-1299.865) (-1302.243) -- 0:00:20 683000 -- (-1297.550) (-1304.612) [-1299.462] (-1300.063) * (-1297.291) (-1297.922) [-1304.512] (-1297.659) -- 0:00:19 683500 -- (-1299.436) (-1300.494) (-1303.207) [-1297.629] * (-1299.258) [-1297.230] (-1299.408) (-1300.701) -- 0:00:19 684000 -- (-1297.365) (-1299.227) [-1300.267] (-1298.717) * [-1298.071] (-1299.071) (-1301.158) (-1298.730) -- 0:00:19 684500 -- (-1301.538) [-1297.632] (-1300.943) (-1299.378) * [-1297.704] (-1300.341) (-1299.898) (-1298.881) -- 0:00:19 685000 -- [-1299.109] (-1299.510) (-1301.554) (-1307.731) * (-1297.540) [-1301.114] (-1299.710) (-1301.229) -- 0:00:19 Average standard deviation of split frequencies: 0.010025 685500 -- (-1300.262) (-1299.562) [-1297.526] (-1303.958) * (-1299.372) (-1299.196) [-1299.201] (-1303.705) -- 0:00:19 686000 -- (-1299.199) (-1298.160) (-1300.823) [-1304.195] * (-1299.036) (-1298.237) (-1297.898) [-1298.891] -- 0:00:19 686500 -- (-1299.594) (-1298.035) (-1297.350) [-1301.249] * (-1298.800) (-1300.081) (-1297.898) [-1298.895] -- 0:00:20 687000 -- [-1297.604] (-1297.906) (-1300.549) (-1298.655) * (-1300.607) (-1303.283) (-1297.436) [-1299.093] -- 0:00:20 687500 -- [-1298.734] (-1297.408) (-1297.557) (-1300.227) * (-1301.688) (-1301.395) [-1297.526] (-1298.518) -- 0:00:20 688000 -- (-1299.176) (-1298.416) [-1298.580] (-1298.393) * (-1299.347) (-1306.254) (-1302.183) [-1297.891] -- 0:00:19 688500 -- (-1299.406) (-1301.189) (-1298.611) [-1298.604] * (-1298.095) (-1302.168) (-1302.470) [-1298.673] -- 0:00:19 689000 -- (-1297.900) (-1306.627) [-1298.356] (-1300.747) * (-1297.492) (-1301.028) (-1299.423) [-1305.043] -- 0:00:19 689500 -- [-1299.468] (-1306.559) (-1296.991) (-1302.212) * (-1297.627) (-1298.887) (-1299.142) [-1298.563] -- 0:00:19 690000 -- (-1300.126) (-1300.283) [-1297.007] (-1299.115) * (-1298.627) (-1302.788) (-1298.018) [-1299.263] -- 0:00:19 Average standard deviation of split frequencies: 0.009636 690500 -- (-1298.874) [-1302.660] (-1296.983) (-1299.576) * (-1300.934) (-1297.326) [-1300.117] (-1302.315) -- 0:00:19 691000 -- (-1299.283) (-1302.214) [-1297.980] (-1300.513) * (-1299.422) [-1297.073] (-1298.675) (-1300.007) -- 0:00:19 691500 -- (-1300.540) [-1299.254] (-1298.317) (-1300.122) * (-1299.915) [-1302.847] (-1297.262) (-1303.824) -- 0:00:19 692000 -- [-1298.314] (-1297.658) (-1300.592) (-1302.045) * (-1299.437) [-1303.605] (-1297.840) (-1300.548) -- 0:00:19 692500 -- [-1298.934] (-1298.193) (-1301.246) (-1304.385) * (-1297.537) (-1298.682) (-1301.232) [-1300.842] -- 0:00:19 693000 -- (-1298.080) [-1297.905] (-1298.053) (-1298.509) * (-1299.515) (-1300.241) [-1300.886] (-1299.687) -- 0:00:19 693500 -- (-1298.221) (-1298.772) [-1299.833] (-1297.533) * (-1301.432) [-1299.166] (-1299.333) (-1300.714) -- 0:00:19 694000 -- (-1303.117) (-1302.066) [-1298.705] (-1298.079) * (-1301.641) [-1303.262] (-1300.871) (-1298.084) -- 0:00:19 694500 -- [-1299.517] (-1298.166) (-1298.374) (-1298.638) * (-1299.288) (-1302.801) (-1300.149) [-1301.822] -- 0:00:19 695000 -- [-1298.072] (-1302.327) (-1300.484) (-1298.089) * (-1298.743) (-1302.455) (-1303.469) [-1299.104] -- 0:00:19 Average standard deviation of split frequencies: 0.009721 695500 -- (-1298.631) (-1300.170) (-1299.428) [-1297.533] * (-1299.164) (-1299.056) [-1301.769] (-1298.810) -- 0:00:19 696000 -- (-1298.828) [-1302.112] (-1298.002) (-1298.951) * (-1299.077) (-1297.290) (-1302.201) [-1298.558] -- 0:00:19 696500 -- (-1299.305) [-1300.290] (-1298.510) (-1298.039) * [-1298.257] (-1298.616) (-1298.994) (-1299.526) -- 0:00:19 697000 -- (-1301.122) (-1298.839) [-1298.781] (-1300.575) * (-1297.212) [-1298.106] (-1297.740) (-1299.134) -- 0:00:19 697500 -- (-1303.536) [-1298.014] (-1298.975) (-1301.554) * (-1299.554) (-1299.238) [-1297.021] (-1299.570) -- 0:00:19 698000 -- (-1299.616) [-1298.421] (-1299.986) (-1299.606) * (-1300.649) (-1300.004) [-1297.562] (-1297.816) -- 0:00:19 698500 -- [-1297.976] (-1298.863) (-1303.965) (-1298.726) * (-1305.733) (-1299.327) [-1298.518] (-1297.630) -- 0:00:18 699000 -- (-1298.083) [-1298.094] (-1302.808) (-1297.829) * (-1299.254) (-1300.204) [-1301.120] (-1298.908) -- 0:00:18 699500 -- (-1299.074) (-1299.497) (-1300.795) [-1299.300] * (-1301.981) (-1299.363) (-1299.417) [-1297.464] -- 0:00:18 700000 -- [-1298.003] (-1302.623) (-1300.178) (-1304.483) * (-1301.989) (-1302.466) [-1299.567] (-1299.280) -- 0:00:18 Average standard deviation of split frequencies: 0.009577 700500 -- (-1299.184) (-1301.428) [-1301.780] (-1302.206) * (-1305.901) (-1297.676) (-1300.824) [-1299.807] -- 0:00:18 701000 -- (-1307.099) (-1299.695) (-1301.349) [-1298.783] * (-1298.834) (-1298.653) [-1299.831] (-1297.293) -- 0:00:18 701500 -- (-1300.166) (-1300.684) [-1299.683] (-1300.372) * (-1298.353) (-1298.635) [-1297.587] (-1297.913) -- 0:00:18 702000 -- (-1297.864) [-1298.477] (-1302.247) (-1299.366) * (-1300.017) [-1299.882] (-1297.973) (-1301.569) -- 0:00:18 702500 -- (-1297.147) (-1298.162) (-1298.820) [-1297.467] * [-1297.979] (-1306.115) (-1298.066) (-1299.789) -- 0:00:19 703000 -- (-1299.285) (-1298.806) [-1298.191] (-1298.219) * (-1298.594) [-1302.778] (-1300.823) (-1301.383) -- 0:00:19 703500 -- (-1298.272) (-1297.331) (-1300.529) [-1298.953] * (-1301.135) [-1297.737] (-1297.408) (-1297.825) -- 0:00:18 704000 -- (-1301.417) [-1297.155] (-1298.501) (-1299.053) * (-1298.797) (-1297.747) (-1298.774) [-1297.324] -- 0:00:18 704500 -- [-1299.587] (-1297.156) (-1297.269) (-1298.039) * [-1298.844] (-1301.000) (-1298.385) (-1298.790) -- 0:00:18 705000 -- (-1300.481) (-1297.737) [-1299.223] (-1298.049) * (-1298.659) (-1298.050) [-1298.125] (-1297.204) -- 0:00:18 Average standard deviation of split frequencies: 0.009269 705500 -- (-1299.147) (-1301.845) [-1298.609] (-1300.090) * (-1299.084) (-1299.532) (-1298.000) [-1297.607] -- 0:00:18 706000 -- [-1298.802] (-1298.686) (-1299.659) (-1298.506) * (-1298.342) (-1300.239) [-1298.707] (-1297.985) -- 0:00:18 706500 -- (-1298.038) (-1297.952) (-1303.282) [-1297.240] * (-1298.870) [-1300.968] (-1299.014) (-1299.618) -- 0:00:18 707000 -- (-1301.801) (-1299.975) [-1302.139] (-1298.966) * (-1300.778) (-1300.373) (-1297.998) [-1298.164] -- 0:00:18 707500 -- [-1302.480] (-1300.047) (-1299.813) (-1297.636) * (-1298.637) (-1300.994) (-1298.308) [-1300.106] -- 0:00:18 708000 -- [-1301.818] (-1299.006) (-1297.690) (-1299.556) * (-1299.365) [-1300.694] (-1300.524) (-1298.466) -- 0:00:18 708500 -- (-1303.410) [-1304.110] (-1297.827) (-1298.059) * (-1297.411) (-1305.637) [-1298.440] (-1297.891) -- 0:00:18 709000 -- [-1302.829] (-1298.510) (-1300.559) (-1298.945) * [-1300.459] (-1303.058) (-1301.141) (-1299.512) -- 0:00:18 709500 -- [-1298.877] (-1299.064) (-1301.846) (-1298.242) * (-1298.479) (-1300.763) [-1299.180] (-1299.564) -- 0:00:18 710000 -- (-1299.789) (-1298.103) [-1298.715] (-1301.888) * (-1298.903) [-1298.459] (-1300.644) (-1298.197) -- 0:00:18 Average standard deviation of split frequencies: 0.009443 710500 -- (-1302.293) (-1298.137) (-1299.409) [-1299.546] * (-1299.565) (-1299.498) [-1298.082] (-1300.829) -- 0:00:18 711000 -- (-1306.677) (-1299.668) [-1300.313] (-1299.877) * (-1298.142) (-1299.322) [-1298.585] (-1298.568) -- 0:00:18 711500 -- [-1299.373] (-1303.754) (-1298.277) (-1297.798) * (-1299.056) (-1297.914) (-1297.412) [-1297.865] -- 0:00:18 712000 -- (-1300.693) (-1297.455) [-1298.676] (-1298.573) * (-1297.830) (-1299.710) [-1297.351] (-1298.564) -- 0:00:18 712500 -- [-1299.198] (-1300.325) (-1298.034) (-1298.732) * (-1299.665) (-1301.437) [-1297.663] (-1297.933) -- 0:00:18 713000 -- (-1298.315) (-1297.417) [-1297.258] (-1300.609) * (-1301.293) (-1299.991) [-1297.930] (-1298.998) -- 0:00:18 713500 -- (-1298.083) (-1298.149) [-1297.529] (-1297.715) * (-1300.955) [-1300.518] (-1299.807) (-1301.178) -- 0:00:18 714000 -- (-1299.723) (-1298.842) [-1299.889] (-1297.421) * (-1299.414) [-1299.378] (-1307.117) (-1301.217) -- 0:00:18 714500 -- [-1298.298] (-1298.708) (-1299.833) (-1301.274) * [-1299.243] (-1298.262) (-1304.270) (-1300.617) -- 0:00:17 715000 -- [-1300.264] (-1301.683) (-1300.937) (-1301.718) * [-1299.596] (-1301.594) (-1298.104) (-1300.137) -- 0:00:17 Average standard deviation of split frequencies: 0.009915 715500 -- (-1302.751) [-1297.649] (-1303.141) (-1302.743) * (-1299.176) [-1302.125] (-1298.673) (-1299.116) -- 0:00:17 716000 -- (-1298.447) (-1300.602) [-1299.143] (-1298.606) * (-1298.039) (-1299.102) (-1300.384) [-1299.719] -- 0:00:17 716500 -- (-1300.335) (-1298.409) [-1298.473] (-1300.254) * (-1298.122) [-1300.219] (-1299.044) (-1303.897) -- 0:00:17 717000 -- (-1301.015) (-1298.437) (-1299.715) [-1300.526] * (-1304.087) (-1299.518) (-1298.648) [-1301.943] -- 0:00:17 717500 -- (-1297.449) [-1300.139] (-1298.751) (-1302.345) * (-1301.862) [-1300.246] (-1300.078) (-1299.302) -- 0:00:17 718000 -- (-1298.378) (-1301.554) [-1303.387] (-1301.507) * (-1298.903) (-1298.059) (-1301.470) [-1299.378] -- 0:00:17 718500 -- (-1298.417) [-1299.966] (-1297.936) (-1299.929) * (-1298.718) (-1300.580) (-1299.730) [-1298.720] -- 0:00:17 719000 -- (-1298.408) (-1298.443) [-1297.172] (-1299.449) * (-1300.057) (-1302.921) [-1303.737] (-1298.290) -- 0:00:17 719500 -- [-1298.072] (-1297.521) (-1298.146) (-1297.918) * (-1299.478) [-1301.788] (-1304.619) (-1301.343) -- 0:00:17 720000 -- (-1298.322) (-1298.804) [-1299.781] (-1302.874) * (-1301.304) (-1302.059) [-1300.146] (-1297.728) -- 0:00:17 Average standard deviation of split frequencies: 0.009771 720500 -- [-1298.206] (-1299.158) (-1298.493) (-1298.482) * (-1301.279) [-1303.431] (-1303.389) (-1297.926) -- 0:00:17 721000 -- (-1300.324) [-1302.087] (-1298.695) (-1300.193) * (-1300.353) (-1304.172) (-1300.906) [-1298.625] -- 0:00:17 721500 -- (-1300.153) [-1299.873] (-1300.013) (-1299.377) * [-1300.159] (-1302.442) (-1303.856) (-1298.600) -- 0:00:17 722000 -- (-1298.848) (-1302.818) (-1299.858) [-1299.310] * (-1297.710) [-1300.966] (-1298.644) (-1299.644) -- 0:00:17 722500 -- (-1299.041) (-1300.071) (-1302.314) [-1302.732] * (-1298.300) [-1301.591] (-1302.931) (-1298.370) -- 0:00:17 723000 -- [-1298.071] (-1303.960) (-1298.142) (-1298.578) * (-1300.026) (-1301.396) [-1297.584] (-1298.735) -- 0:00:17 723500 -- (-1298.630) [-1299.855] (-1298.069) (-1298.019) * (-1298.674) (-1305.170) [-1297.121] (-1300.885) -- 0:00:17 724000 -- (-1299.037) (-1297.967) (-1301.335) [-1297.567] * (-1300.726) (-1298.215) [-1301.177] (-1303.916) -- 0:00:17 724500 -- (-1298.069) (-1298.986) [-1299.126] (-1298.292) * (-1298.293) (-1298.365) (-1299.818) [-1300.830] -- 0:00:17 725000 -- (-1299.187) (-1302.248) [-1300.049] (-1299.413) * (-1299.892) [-1299.180] (-1299.581) (-1300.819) -- 0:00:17 Average standard deviation of split frequencies: 0.009902 725500 -- [-1300.217] (-1301.170) (-1301.523) (-1299.968) * (-1298.660) [-1298.298] (-1301.470) (-1302.110) -- 0:00:17 726000 -- (-1303.256) [-1297.732] (-1298.935) (-1298.496) * (-1298.764) [-1298.947] (-1304.295) (-1299.881) -- 0:00:17 726500 -- (-1299.922) (-1297.571) [-1298.023] (-1300.145) * (-1297.529) (-1297.448) [-1301.991] (-1300.271) -- 0:00:17 727000 -- (-1301.265) (-1299.407) (-1299.083) [-1298.694] * [-1297.508] (-1298.025) (-1301.243) (-1297.914) -- 0:00:17 727500 -- [-1299.423] (-1298.497) (-1298.065) (-1297.609) * (-1298.345) (-1297.956) [-1298.583] (-1298.517) -- 0:00:17 728000 -- (-1299.171) (-1299.698) [-1297.835] (-1298.558) * (-1301.022) (-1299.835) [-1298.172] (-1298.506) -- 0:00:17 728500 -- (-1298.580) [-1298.311] (-1300.295) (-1298.277) * (-1299.580) (-1298.344) (-1297.303) [-1299.819] -- 0:00:17 729000 -- (-1299.568) (-1300.640) [-1298.594] (-1299.235) * (-1298.820) [-1299.157] (-1297.729) (-1297.887) -- 0:00:17 729500 -- (-1299.884) [-1298.326] (-1299.177) (-1299.541) * (-1298.368) (-1298.261) [-1297.589] (-1297.877) -- 0:00:17 730000 -- [-1301.485] (-1298.678) (-1304.770) (-1299.792) * [-1297.284] (-1301.833) (-1297.754) (-1297.356) -- 0:00:17 Average standard deviation of split frequencies: 0.009153 730500 -- (-1301.109) (-1297.993) (-1297.466) [-1302.533] * (-1298.101) [-1301.427] (-1299.628) (-1298.187) -- 0:00:16 731000 -- (-1299.212) [-1297.658] (-1298.297) (-1300.143) * (-1300.455) (-1298.647) [-1298.080] (-1299.419) -- 0:00:16 731500 -- (-1299.668) [-1297.284] (-1299.093) (-1304.070) * (-1297.944) (-1299.318) (-1300.307) [-1298.783] -- 0:00:16 732000 -- (-1299.374) (-1298.065) [-1300.239] (-1300.018) * [-1298.009] (-1301.871) (-1301.324) (-1300.001) -- 0:00:16 732500 -- (-1301.251) (-1299.048) [-1300.975] (-1301.001) * [-1297.431] (-1299.059) (-1298.143) (-1304.362) -- 0:00:16 733000 -- [-1299.502] (-1298.944) (-1300.017) (-1299.499) * [-1298.358] (-1297.074) (-1301.801) (-1303.555) -- 0:00:16 733500 -- (-1300.658) [-1298.035] (-1303.534) (-1301.915) * (-1297.921) (-1297.952) [-1302.569] (-1304.059) -- 0:00:16 734000 -- (-1300.142) (-1297.627) [-1298.136] (-1297.730) * (-1298.890) (-1297.831) [-1298.246] (-1304.147) -- 0:00:16 734500 -- (-1300.977) (-1298.505) [-1298.246] (-1297.826) * (-1298.583) (-1301.355) [-1300.920] (-1300.751) -- 0:00:16 735000 -- [-1298.073] (-1299.152) (-1298.176) (-1300.479) * (-1298.595) [-1301.451] (-1298.582) (-1303.825) -- 0:00:16 Average standard deviation of split frequencies: 0.009287 735500 -- (-1301.662) (-1299.139) [-1297.641] (-1298.341) * (-1299.078) (-1301.347) (-1297.632) [-1299.960] -- 0:00:16 736000 -- [-1298.341] (-1297.895) (-1299.690) (-1300.367) * [-1299.861] (-1298.468) (-1300.178) (-1300.220) -- 0:00:16 736500 -- (-1298.066) (-1297.794) (-1297.999) [-1298.788] * (-1300.468) (-1299.509) [-1298.092] (-1300.575) -- 0:00:16 737000 -- [-1299.999] (-1299.626) (-1298.069) (-1300.446) * (-1300.950) (-1300.088) (-1303.506) [-1299.057] -- 0:00:16 737500 -- (-1300.485) [-1298.584] (-1299.806) (-1301.465) * (-1299.097) (-1304.339) [-1300.717] (-1298.894) -- 0:00:16 738000 -- (-1302.153) (-1298.322) [-1300.693] (-1300.046) * (-1298.553) (-1303.298) [-1297.751] (-1299.433) -- 0:00:16 738500 -- (-1299.134) (-1299.738) [-1299.992] (-1303.318) * (-1298.502) [-1297.623] (-1300.122) (-1300.462) -- 0:00:16 739000 -- [-1298.451] (-1297.353) (-1299.950) (-1297.113) * (-1298.749) (-1298.250) [-1299.746] (-1300.158) -- 0:00:16 739500 -- (-1300.766) [-1297.851] (-1301.994) (-1297.897) * (-1298.419) (-1303.942) (-1298.921) [-1298.363] -- 0:00:16 740000 -- (-1300.584) [-1299.483] (-1299.734) (-1299.232) * (-1299.322) (-1300.915) [-1297.147] (-1299.181) -- 0:00:16 Average standard deviation of split frequencies: 0.009268 740500 -- (-1299.167) [-1297.550] (-1301.187) (-1303.123) * (-1298.840) (-1297.220) [-1298.243] (-1299.990) -- 0:00:16 741000 -- [-1297.927] (-1297.433) (-1297.084) (-1301.983) * [-1297.398] (-1300.366) (-1299.637) (-1300.634) -- 0:00:16 741500 -- [-1298.249] (-1297.774) (-1297.332) (-1301.068) * [-1297.203] (-1297.160) (-1301.108) (-1300.592) -- 0:00:16 742000 -- (-1298.794) [-1297.861] (-1300.471) (-1299.707) * (-1299.162) [-1299.233] (-1298.852) (-1298.443) -- 0:00:16 742500 -- [-1299.940] (-1297.479) (-1299.569) (-1300.443) * (-1300.127) (-1299.424) (-1302.624) [-1297.781] -- 0:00:16 743000 -- (-1298.533) [-1300.871] (-1299.247) (-1298.015) * [-1297.199] (-1301.492) (-1302.103) (-1297.794) -- 0:00:16 743500 -- (-1298.010) [-1297.202] (-1300.645) (-1297.939) * [-1297.286] (-1300.373) (-1301.407) (-1302.204) -- 0:00:16 744000 -- (-1301.571) (-1298.838) (-1297.508) [-1298.077] * (-1299.254) (-1300.567) (-1302.038) [-1300.598] -- 0:00:16 744500 -- (-1297.730) [-1298.493] (-1299.388) (-1298.093) * (-1301.298) [-1298.969] (-1299.442) (-1300.792) -- 0:00:16 745000 -- (-1297.110) (-1299.813) [-1297.330] (-1303.792) * (-1299.854) [-1298.840] (-1300.902) (-1299.828) -- 0:00:16 Average standard deviation of split frequencies: 0.008810 745500 -- (-1297.688) (-1299.327) (-1297.330) [-1297.566] * [-1298.394] (-1299.149) (-1300.365) (-1302.229) -- 0:00:16 746000 -- (-1300.037) (-1298.749) [-1297.887] (-1297.161) * (-1298.790) [-1299.690] (-1298.539) (-1305.271) -- 0:00:16 746500 -- (-1299.257) [-1300.824] (-1301.084) (-1300.730) * (-1299.859) (-1299.899) [-1297.480] (-1300.854) -- 0:00:15 747000 -- (-1297.735) (-1299.589) (-1299.766) [-1302.443] * (-1298.598) [-1299.892] (-1298.829) (-1297.848) -- 0:00:15 747500 -- [-1298.712] (-1299.601) (-1299.099) (-1298.391) * (-1298.057) (-1301.116) [-1299.498] (-1300.531) -- 0:00:15 748000 -- [-1298.004] (-1299.676) (-1301.544) (-1297.754) * (-1302.124) (-1303.388) (-1297.651) [-1297.070] -- 0:00:15 748500 -- (-1297.712) (-1300.192) [-1299.023] (-1298.687) * (-1303.369) (-1298.126) (-1298.492) [-1297.946] -- 0:00:15 749000 -- (-1297.712) (-1298.299) [-1300.354] (-1298.809) * (-1298.162) (-1300.123) (-1303.001) [-1298.837] -- 0:00:15 749500 -- (-1300.550) (-1298.327) (-1302.482) [-1301.128] * (-1298.722) (-1300.289) (-1297.860) [-1298.359] -- 0:00:15 750000 -- (-1300.193) (-1298.377) [-1297.883] (-1297.270) * (-1297.498) [-1300.906] (-1300.395) (-1301.225) -- 0:00:15 Average standard deviation of split frequencies: 0.009184 750500 -- (-1303.322) [-1297.566] (-1302.388) (-1297.603) * (-1297.314) [-1301.462] (-1300.618) (-1299.889) -- 0:00:15 751000 -- (-1299.495) (-1301.468) (-1298.889) [-1298.613] * (-1300.339) (-1298.081) (-1299.143) [-1298.424] -- 0:00:15 751500 -- (-1298.802) (-1299.550) (-1299.339) [-1298.731] * (-1303.995) (-1298.358) (-1300.349) [-1298.740] -- 0:00:15 752000 -- (-1301.207) (-1298.392) (-1297.745) [-1298.001] * (-1299.584) (-1297.987) [-1297.400] (-1299.445) -- 0:00:15 752500 -- (-1302.347) (-1299.127) [-1299.251] (-1298.918) * [-1299.532] (-1299.190) (-1297.282) (-1299.649) -- 0:00:15 753000 -- (-1303.202) (-1298.926) [-1299.785] (-1297.608) * (-1299.583) (-1300.714) [-1298.599] (-1298.614) -- 0:00:15 753500 -- (-1301.477) (-1298.231) [-1300.697] (-1299.613) * (-1298.858) (-1299.111) (-1298.291) [-1301.455] -- 0:00:15 754000 -- [-1300.081] (-1300.126) (-1299.063) (-1298.179) * (-1297.738) (-1299.886) (-1297.666) [-1298.696] -- 0:00:15 754500 -- [-1298.594] (-1298.070) (-1300.416) (-1299.099) * (-1300.613) (-1298.664) (-1300.914) [-1297.895] -- 0:00:15 755000 -- (-1297.770) [-1299.780] (-1300.802) (-1298.563) * (-1297.188) [-1299.304] (-1299.030) (-1302.077) -- 0:00:15 Average standard deviation of split frequencies: 0.009275 755500 -- [-1300.186] (-1298.733) (-1298.041) (-1298.331) * (-1299.744) [-1299.888] (-1299.626) (-1302.716) -- 0:00:15 756000 -- (-1299.886) (-1299.490) (-1298.405) [-1298.251] * (-1301.859) (-1300.990) [-1300.200] (-1299.259) -- 0:00:15 756500 -- (-1300.081) (-1300.301) (-1302.165) [-1298.479] * (-1302.462) [-1299.597] (-1301.767) (-1299.157) -- 0:00:15 757000 -- (-1299.943) (-1300.100) (-1298.329) [-1301.560] * [-1297.812] (-1300.976) (-1299.745) (-1299.954) -- 0:00:15 757500 -- (-1300.421) (-1300.305) [-1298.489] (-1299.193) * (-1300.345) (-1298.253) [-1297.704] (-1300.579) -- 0:00:15 758000 -- (-1300.958) [-1298.356] (-1300.426) (-1298.038) * [-1300.871] (-1298.625) (-1303.600) (-1299.155) -- 0:00:15 758500 -- (-1300.034) (-1300.666) [-1298.037] (-1298.011) * [-1298.915] (-1298.742) (-1300.637) (-1297.796) -- 0:00:15 759000 -- [-1300.160] (-1302.270) (-1297.648) (-1300.400) * (-1299.582) [-1298.531] (-1298.724) (-1297.264) -- 0:00:15 759500 -- (-1299.479) (-1297.786) [-1298.822] (-1299.325) * (-1299.631) [-1299.281] (-1298.892) (-1299.260) -- 0:00:15 760000 -- (-1299.517) [-1303.263] (-1298.230) (-1300.093) * [-1300.616] (-1300.449) (-1298.736) (-1299.451) -- 0:00:15 Average standard deviation of split frequencies: 0.009172 760500 -- (-1298.109) (-1299.455) [-1298.962] (-1298.388) * (-1298.374) (-1299.813) (-1298.500) [-1299.367] -- 0:00:15 761000 -- (-1299.637) (-1297.481) [-1298.513] (-1297.910) * [-1299.002] (-1298.170) (-1298.407) (-1298.004) -- 0:00:15 761500 -- (-1300.291) (-1297.743) [-1298.477] (-1297.244) * (-1301.519) (-1299.369) (-1299.112) [-1299.781] -- 0:00:15 762000 -- (-1299.241) (-1297.568) (-1301.110) [-1298.230] * (-1298.639) (-1301.490) [-1300.989] (-1299.538) -- 0:00:14 762500 -- (-1299.594) (-1299.818) (-1298.634) [-1298.241] * (-1298.963) (-1305.114) [-1298.684] (-1305.200) -- 0:00:14 763000 -- [-1301.056] (-1298.147) (-1297.341) (-1300.735) * (-1299.687) (-1306.944) (-1300.566) [-1300.222] -- 0:00:14 763500 -- (-1300.526) (-1299.903) [-1297.486] (-1301.238) * (-1298.005) [-1300.433] (-1298.591) (-1312.519) -- 0:00:14 764000 -- (-1307.866) [-1298.258] (-1298.690) (-1297.821) * [-1300.907] (-1302.474) (-1299.695) (-1300.783) -- 0:00:14 764500 -- [-1299.359] (-1301.953) (-1299.049) (-1300.221) * (-1300.419) (-1303.781) [-1299.713] (-1298.760) -- 0:00:14 765000 -- (-1300.354) [-1299.874] (-1299.357) (-1299.143) * [-1298.792] (-1298.248) (-1297.619) (-1298.320) -- 0:00:14 Average standard deviation of split frequencies: 0.009723 765500 -- (-1297.863) [-1301.509] (-1299.034) (-1299.945) * (-1298.209) (-1297.366) [-1301.207] (-1300.672) -- 0:00:14 766000 -- (-1299.241) (-1299.717) (-1299.524) [-1297.491] * (-1299.741) (-1301.031) [-1299.865] (-1297.789) -- 0:00:14 766500 -- [-1299.168] (-1300.396) (-1297.847) (-1297.903) * (-1299.537) [-1298.452] (-1297.838) (-1299.375) -- 0:00:14 767000 -- (-1298.802) [-1299.718] (-1300.388) (-1297.961) * [-1297.438] (-1299.989) (-1298.550) (-1298.260) -- 0:00:14 767500 -- (-1297.735) [-1298.157] (-1303.505) (-1297.367) * (-1297.278) [-1297.974] (-1311.339) (-1300.315) -- 0:00:14 768000 -- [-1300.793] (-1299.988) (-1302.612) (-1297.535) * (-1297.858) (-1298.896) [-1298.656] (-1298.851) -- 0:00:14 768500 -- [-1299.992] (-1297.972) (-1300.512) (-1298.617) * (-1298.500) [-1297.800] (-1298.894) (-1307.655) -- 0:00:14 769000 -- (-1299.953) (-1298.121) (-1298.280) [-1298.915] * (-1303.480) (-1300.405) (-1298.676) [-1298.900] -- 0:00:14 769500 -- (-1299.548) (-1298.752) [-1301.055] (-1298.184) * (-1298.533) (-1300.270) (-1297.850) [-1299.403] -- 0:00:14 770000 -- (-1300.106) [-1301.530] (-1300.134) (-1299.279) * [-1298.085] (-1299.162) (-1300.437) (-1303.518) -- 0:00:14 Average standard deviation of split frequencies: 0.008602 770500 -- (-1301.539) (-1303.264) [-1300.007] (-1299.998) * [-1299.436] (-1299.235) (-1302.299) (-1303.346) -- 0:00:14 771000 -- (-1300.241) [-1299.857] (-1297.272) (-1299.259) * (-1302.579) (-1300.294) (-1302.820) [-1302.188] -- 0:00:14 771500 -- (-1299.317) (-1298.497) (-1297.263) [-1299.709] * [-1299.655] (-1298.890) (-1299.159) (-1298.922) -- 0:00:14 772000 -- (-1302.149) (-1297.430) [-1298.816] (-1298.846) * (-1298.164) (-1301.221) [-1298.867] (-1302.583) -- 0:00:14 772500 -- (-1304.616) [-1297.155] (-1302.099) (-1297.866) * (-1297.527) (-1299.268) [-1299.431] (-1301.197) -- 0:00:14 773000 -- (-1298.783) (-1300.261) (-1298.099) [-1298.262] * (-1299.524) (-1298.793) (-1298.746) [-1299.757] -- 0:00:14 773500 -- (-1298.763) (-1299.054) [-1300.827] (-1299.410) * (-1297.617) (-1298.559) (-1301.167) [-1299.565] -- 0:00:14 774000 -- [-1299.316] (-1297.639) (-1299.780) (-1298.319) * [-1296.897] (-1297.947) (-1300.181) (-1300.967) -- 0:00:14 774500 -- (-1298.489) [-1298.840] (-1301.662) (-1299.756) * (-1297.959) [-1298.070] (-1298.277) (-1298.912) -- 0:00:14 775000 -- (-1300.981) (-1297.113) (-1297.935) [-1299.829] * (-1303.088) [-1297.698] (-1297.499) (-1298.386) -- 0:00:14 Average standard deviation of split frequencies: 0.008788 775500 -- (-1298.123) (-1297.406) (-1302.823) [-1298.853] * [-1300.200] (-1298.583) (-1300.736) (-1297.635) -- 0:00:14 776000 -- (-1299.753) (-1299.899) [-1299.658] (-1299.012) * [-1297.695] (-1298.611) (-1301.480) (-1298.549) -- 0:00:14 776500 -- (-1299.732) (-1297.146) [-1301.757] (-1299.719) * [-1299.961] (-1297.988) (-1300.231) (-1298.868) -- 0:00:14 777000 -- (-1300.034) (-1298.544) (-1297.584) [-1301.485] * (-1301.063) (-1298.850) (-1298.543) [-1300.491] -- 0:00:14 777500 -- (-1298.755) (-1300.619) [-1301.673] (-1305.187) * (-1299.268) (-1297.885) (-1298.017) [-1298.839] -- 0:00:14 778000 -- (-1301.721) (-1302.125) [-1299.377] (-1310.680) * [-1299.383] (-1303.035) (-1299.014) (-1297.947) -- 0:00:13 778500 -- (-1299.438) (-1299.743) [-1298.364] (-1297.770) * [-1298.727] (-1297.493) (-1299.351) (-1300.075) -- 0:00:13 779000 -- (-1301.981) [-1298.679] (-1299.621) (-1301.327) * (-1298.034) (-1301.825) (-1299.554) [-1297.634] -- 0:00:13 779500 -- [-1298.617] (-1299.064) (-1299.918) (-1298.533) * (-1299.878) (-1298.579) [-1298.546] (-1299.598) -- 0:00:13 780000 -- (-1300.611) (-1302.326) [-1298.429] (-1298.217) * [-1298.789] (-1298.419) (-1301.101) (-1301.157) -- 0:00:13 Average standard deviation of split frequencies: 0.009501 780500 -- (-1301.067) (-1298.713) (-1298.482) [-1301.328] * (-1299.894) (-1298.729) [-1300.338] (-1302.020) -- 0:00:13 781000 -- (-1299.034) (-1298.133) [-1299.166] (-1301.277) * (-1299.544) (-1301.051) [-1297.145] (-1300.864) -- 0:00:13 781500 -- [-1298.359] (-1297.801) (-1298.833) (-1299.364) * (-1300.042) (-1297.880) [-1298.305] (-1297.705) -- 0:00:13 782000 -- (-1298.391) [-1299.093] (-1297.518) (-1297.304) * [-1298.193] (-1297.936) (-1299.277) (-1299.243) -- 0:00:13 782500 -- (-1300.637) (-1298.448) [-1302.919] (-1303.258) * (-1298.259) (-1301.036) (-1302.069) [-1301.203] -- 0:00:13 783000 -- (-1302.966) (-1298.124) (-1299.181) [-1299.377] * [-1298.145] (-1298.069) (-1307.078) (-1303.428) -- 0:00:13 783500 -- (-1302.374) [-1298.174] (-1302.505) (-1298.654) * (-1302.908) [-1297.270] (-1305.174) (-1306.084) -- 0:00:13 784000 -- (-1300.674) [-1298.173] (-1303.156) (-1300.340) * [-1303.683] (-1297.495) (-1301.717) (-1300.354) -- 0:00:13 784500 -- [-1299.301] (-1300.588) (-1297.800) (-1299.211) * (-1298.777) (-1298.056) (-1300.954) [-1299.289] -- 0:00:13 785000 -- (-1301.824) [-1298.555] (-1299.676) (-1302.579) * (-1299.598) (-1298.754) [-1298.213] (-1299.918) -- 0:00:13 Average standard deviation of split frequencies: 0.009596 785500 -- [-1298.342] (-1298.208) (-1299.493) (-1298.226) * (-1299.618) (-1301.630) [-1300.963] (-1300.625) -- 0:00:13 786000 -- (-1298.888) [-1298.511] (-1297.915) (-1298.439) * (-1300.724) (-1299.200) [-1297.711] (-1297.840) -- 0:00:13 786500 -- (-1298.949) (-1297.311) (-1299.008) [-1298.759] * (-1300.028) [-1304.817] (-1298.583) (-1297.920) -- 0:00:13 787000 -- (-1301.169) (-1299.217) (-1299.488) [-1299.708] * [-1301.569] (-1299.195) (-1300.137) (-1297.346) -- 0:00:13 787500 -- (-1299.211) [-1303.904] (-1300.598) (-1302.712) * (-1302.240) (-1298.162) (-1299.386) [-1297.341] -- 0:00:13 788000 -- [-1298.772] (-1299.455) (-1298.976) (-1298.720) * (-1298.074) (-1298.469) (-1301.670) [-1297.164] -- 0:00:13 788500 -- (-1297.252) [-1299.910] (-1298.273) (-1300.137) * (-1300.493) [-1299.084] (-1301.378) (-1303.852) -- 0:00:13 789000 -- (-1299.401) [-1297.620] (-1299.595) (-1300.898) * (-1301.141) (-1299.617) [-1299.341] (-1297.582) -- 0:00:13 789500 -- (-1298.029) [-1300.791] (-1297.786) (-1300.250) * (-1298.793) (-1298.107) (-1298.765) [-1298.897] -- 0:00:13 790000 -- (-1300.191) [-1299.138] (-1298.328) (-1297.786) * [-1299.714] (-1300.150) (-1297.716) (-1302.671) -- 0:00:13 Average standard deviation of split frequencies: 0.009579 790500 -- (-1297.643) (-1298.202) (-1298.017) [-1297.611] * (-1298.254) [-1300.055] (-1301.096) (-1299.165) -- 0:00:13 791000 -- (-1298.658) [-1299.194] (-1302.355) (-1298.318) * [-1299.693] (-1298.577) (-1301.054) (-1300.770) -- 0:00:13 791500 -- (-1301.915) (-1298.814) [-1299.490] (-1301.423) * [-1303.728] (-1299.385) (-1298.637) (-1297.754) -- 0:00:13 792000 -- (-1297.779) (-1298.525) (-1299.831) [-1298.752] * [-1298.366] (-1297.564) (-1300.135) (-1298.637) -- 0:00:13 792500 -- (-1305.859) (-1299.319) [-1297.550] (-1303.049) * (-1298.313) (-1299.233) [-1297.268] (-1301.928) -- 0:00:13 793000 -- (-1301.754) [-1299.676] (-1298.716) (-1306.256) * (-1297.848) (-1300.373) [-1299.933] (-1298.239) -- 0:00:13 793500 -- (-1299.510) (-1299.064) [-1298.046] (-1301.035) * (-1299.172) (-1300.903) (-1299.745) [-1299.746] -- 0:00:13 794000 -- [-1301.402] (-1300.655) (-1299.101) (-1297.675) * [-1297.473] (-1302.180) (-1301.328) (-1299.681) -- 0:00:12 794500 -- [-1298.057] (-1300.098) (-1298.915) (-1299.849) * (-1297.826) (-1298.920) [-1304.253] (-1300.156) -- 0:00:12 795000 -- (-1297.843) (-1297.548) (-1297.999) [-1299.736] * (-1298.009) (-1299.848) (-1303.707) [-1300.319] -- 0:00:12 Average standard deviation of split frequencies: 0.009475 795500 -- [-1298.952] (-1302.460) (-1300.254) (-1299.128) * (-1300.916) [-1301.471] (-1299.256) (-1298.282) -- 0:00:12 796000 -- (-1299.899) [-1299.026] (-1300.080) (-1301.453) * (-1302.057) (-1301.167) [-1297.797] (-1298.277) -- 0:00:12 796500 -- (-1298.785) [-1300.286] (-1298.156) (-1298.781) * (-1298.433) (-1298.376) (-1297.888) [-1298.128] -- 0:00:12 797000 -- (-1304.785) (-1300.495) (-1303.094) [-1299.258] * (-1298.366) (-1299.269) [-1297.952] (-1298.394) -- 0:00:12 797500 -- [-1300.176] (-1308.495) (-1300.180) (-1300.044) * [-1297.743] (-1300.250) (-1298.964) (-1304.828) -- 0:00:12 798000 -- (-1298.737) (-1305.361) (-1301.356) [-1297.412] * (-1297.763) [-1298.573] (-1299.393) (-1304.153) -- 0:00:12 798500 -- (-1301.653) (-1298.290) [-1301.339] (-1299.188) * (-1298.553) (-1297.919) [-1301.356] (-1306.449) -- 0:00:12 799000 -- (-1300.409) (-1298.189) [-1301.782] (-1297.408) * [-1298.112] (-1297.712) (-1302.155) (-1299.038) -- 0:00:12 799500 -- (-1301.933) (-1298.524) (-1299.315) [-1299.137] * (-1298.183) (-1297.991) [-1297.660] (-1298.949) -- 0:00:12 800000 -- (-1300.939) (-1299.799) (-1298.187) [-1298.698] * (-1300.290) (-1299.589) (-1297.562) [-1300.756] -- 0:00:12 Average standard deviation of split frequencies: 0.009734 800500 -- (-1300.613) [-1298.197] (-1297.901) (-1301.661) * (-1302.645) [-1302.605] (-1297.475) (-1299.068) -- 0:00:12 801000 -- (-1300.058) [-1303.984] (-1300.960) (-1300.124) * (-1302.324) (-1300.232) (-1300.930) [-1299.838] -- 0:00:12 801500 -- (-1301.929) [-1299.123] (-1297.870) (-1300.979) * (-1307.426) (-1299.715) [-1297.718] (-1297.803) -- 0:00:12 802000 -- [-1298.531] (-1300.334) (-1300.771) (-1299.580) * (-1306.561) [-1297.821] (-1301.506) (-1300.952) -- 0:00:12 802500 -- [-1300.504] (-1303.843) (-1302.097) (-1298.912) * (-1297.537) (-1304.759) (-1300.188) [-1299.055] -- 0:00:12 803000 -- [-1299.265] (-1299.704) (-1300.022) (-1299.666) * [-1296.865] (-1301.464) (-1300.773) (-1299.768) -- 0:00:12 803500 -- [-1301.296] (-1301.112) (-1299.513) (-1297.069) * (-1297.975) [-1299.496] (-1301.887) (-1302.294) -- 0:00:12 804000 -- (-1304.433) (-1299.910) [-1299.522] (-1301.996) * (-1298.841) (-1301.839) [-1301.793] (-1301.735) -- 0:00:12 804500 -- (-1299.486) (-1302.272) [-1301.075] (-1297.887) * (-1298.627) (-1297.616) (-1297.810) [-1299.952] -- 0:00:12 805000 -- (-1298.105) (-1302.888) [-1299.011] (-1298.036) * [-1300.123] (-1297.806) (-1298.028) (-1299.876) -- 0:00:12 Average standard deviation of split frequencies: 0.009175 805500 -- [-1298.099] (-1303.694) (-1299.613) (-1301.133) * [-1297.965] (-1297.528) (-1298.687) (-1299.441) -- 0:00:12 806000 -- (-1299.079) (-1300.586) (-1300.960) [-1300.671] * (-1302.667) (-1304.396) [-1301.084] (-1300.577) -- 0:00:12 806500 -- (-1297.975) [-1298.045] (-1299.676) (-1299.059) * (-1300.668) (-1297.862) [-1297.620] (-1299.654) -- 0:00:12 807000 -- [-1299.413] (-1298.942) (-1300.018) (-1302.083) * (-1300.267) (-1301.441) [-1297.775] (-1297.445) -- 0:00:12 807500 -- (-1299.378) (-1297.799) [-1301.066] (-1300.317) * (-1298.763) [-1299.032] (-1301.094) (-1301.998) -- 0:00:12 808000 -- [-1297.700] (-1302.896) (-1299.388) (-1299.239) * (-1298.299) (-1300.783) [-1301.328] (-1302.418) -- 0:00:12 808500 -- (-1297.711) [-1298.405] (-1299.149) (-1303.963) * (-1299.264) (-1297.383) [-1298.312] (-1302.021) -- 0:00:12 809000 -- [-1297.653] (-1298.404) (-1298.744) (-1302.006) * (-1298.889) [-1299.989] (-1301.507) (-1298.772) -- 0:00:12 809500 -- [-1301.348] (-1304.769) (-1300.119) (-1299.823) * (-1299.714) [-1302.578] (-1297.435) (-1302.341) -- 0:00:12 810000 -- (-1301.975) (-1298.025) [-1302.440] (-1299.477) * (-1298.606) (-1297.339) [-1297.539] (-1298.292) -- 0:00:11 Average standard deviation of split frequencies: 0.008395 810500 -- (-1299.339) (-1299.712) (-1302.714) [-1298.326] * [-1298.399] (-1298.510) (-1299.424) (-1297.478) -- 0:00:11 811000 -- (-1300.174) (-1302.445) (-1298.967) [-1300.016] * (-1297.851) (-1300.547) [-1298.579] (-1297.501) -- 0:00:11 811500 -- [-1302.203] (-1300.620) (-1298.203) (-1297.167) * [-1297.492] (-1301.915) (-1300.017) (-1300.017) -- 0:00:11 812000 -- [-1300.781] (-1304.003) (-1297.401) (-1298.705) * (-1297.857) (-1300.609) (-1302.862) [-1297.264] -- 0:00:11 812500 -- (-1299.132) (-1301.456) [-1300.415] (-1300.506) * (-1298.609) (-1298.627) (-1303.836) [-1300.033] -- 0:00:11 813000 -- (-1300.371) (-1305.065) (-1297.716) [-1299.671] * (-1299.564) (-1300.908) (-1299.909) [-1299.550] -- 0:00:11 813500 -- (-1301.749) (-1297.802) [-1297.223] (-1298.029) * [-1298.125] (-1301.898) (-1300.142) (-1299.295) -- 0:00:11 814000 -- (-1297.775) [-1300.674] (-1299.411) (-1297.441) * (-1298.951) (-1299.543) (-1297.237) [-1297.899] -- 0:00:11 814500 -- [-1301.619] (-1299.967) (-1298.931) (-1297.639) * (-1299.979) [-1300.746] (-1297.684) (-1299.100) -- 0:00:11 815000 -- (-1312.505) (-1300.473) [-1298.922] (-1301.675) * (-1299.185) [-1299.932] (-1300.427) (-1299.644) -- 0:00:11 Average standard deviation of split frequencies: 0.008326 815500 -- (-1306.225) (-1297.732) (-1298.606) [-1297.666] * (-1298.037) [-1300.073] (-1302.918) (-1298.430) -- 0:00:11 816000 -- (-1298.623) [-1299.485] (-1297.585) (-1299.597) * (-1298.219) [-1298.166] (-1302.237) (-1297.655) -- 0:00:11 816500 -- (-1300.785) [-1298.857] (-1299.516) (-1300.287) * (-1299.924) (-1300.773) (-1298.992) [-1297.744] -- 0:00:11 817000 -- (-1301.820) [-1301.309] (-1297.136) (-1300.396) * (-1301.909) [-1299.600] (-1298.803) (-1302.870) -- 0:00:11 817500 -- (-1299.161) (-1299.470) (-1301.628) [-1299.192] * (-1299.224) (-1299.830) [-1297.135] (-1302.375) -- 0:00:11 818000 -- [-1298.798] (-1298.074) (-1300.328) (-1298.901) * [-1302.273] (-1300.032) (-1297.248) (-1298.364) -- 0:00:11 818500 -- (-1297.315) (-1299.612) (-1298.930) [-1298.626] * (-1300.247) [-1299.949] (-1297.230) (-1300.405) -- 0:00:11 819000 -- (-1300.309) (-1298.325) (-1300.724) [-1298.760] * (-1300.869) (-1298.313) (-1298.741) [-1300.149] -- 0:00:11 819500 -- (-1298.101) (-1299.464) [-1297.524] (-1302.867) * (-1298.022) [-1299.038] (-1299.639) (-1299.671) -- 0:00:11 820000 -- (-1299.892) (-1299.573) [-1298.795] (-1298.505) * (-1302.644) [-1298.610] (-1299.733) (-1303.524) -- 0:00:11 Average standard deviation of split frequencies: 0.008481 820500 -- (-1299.971) (-1299.163) (-1300.213) [-1302.355] * [-1302.887] (-1299.206) (-1300.838) (-1298.302) -- 0:00:11 821000 -- (-1299.690) (-1303.705) (-1300.469) [-1303.734] * [-1298.506] (-1302.762) (-1298.741) (-1298.919) -- 0:00:11 821500 -- [-1298.417] (-1298.684) (-1301.955) (-1300.520) * (-1299.422) (-1300.718) (-1298.488) [-1303.320] -- 0:00:11 822000 -- (-1298.132) [-1299.413] (-1298.406) (-1301.028) * (-1302.633) (-1299.087) [-1298.999] (-1298.185) -- 0:00:11 822500 -- (-1300.831) (-1302.920) (-1298.134) [-1302.115] * (-1300.638) (-1299.417) (-1299.109) [-1298.878] -- 0:00:11 823000 -- (-1298.286) (-1302.552) [-1300.293] (-1298.432) * [-1299.882] (-1297.902) (-1301.357) (-1301.538) -- 0:00:11 823500 -- (-1298.230) (-1303.974) (-1297.317) [-1300.748] * [-1299.241] (-1298.967) (-1306.865) (-1299.252) -- 0:00:11 824000 -- (-1298.228) (-1299.939) (-1298.362) [-1299.158] * (-1301.400) [-1298.993] (-1304.397) (-1300.251) -- 0:00:11 824500 -- (-1298.772) (-1298.760) [-1298.646] (-1298.814) * (-1301.183) (-1298.195) [-1299.133] (-1301.172) -- 0:00:11 825000 -- (-1300.194) (-1297.971) [-1300.631] (-1298.863) * (-1301.610) [-1302.323] (-1298.891) (-1301.288) -- 0:00:11 Average standard deviation of split frequencies: 0.008989 825500 -- (-1300.509) [-1298.360] (-1298.850) (-1298.041) * (-1301.527) (-1297.889) (-1299.687) [-1301.117] -- 0:00:10 826000 -- (-1302.241) [-1300.577] (-1297.691) (-1300.412) * (-1298.220) [-1297.312] (-1300.271) (-1300.760) -- 0:00:10 826500 -- [-1297.974] (-1298.806) (-1300.960) (-1298.503) * [-1298.885] (-1298.527) (-1300.636) (-1300.997) -- 0:00:10 827000 -- [-1297.774] (-1297.970) (-1301.759) (-1299.989) * (-1299.386) [-1299.367] (-1297.804) (-1301.956) -- 0:00:10 827500 -- (-1298.955) (-1297.314) [-1303.188] (-1298.236) * [-1297.755] (-1298.505) (-1297.137) (-1297.981) -- 0:00:10 828000 -- (-1300.001) [-1297.353] (-1297.664) (-1299.124) * (-1297.858) (-1301.012) (-1298.713) [-1298.652] -- 0:00:10 828500 -- (-1304.073) [-1298.469] (-1301.348) (-1298.946) * (-1298.643) (-1301.440) (-1299.259) [-1298.865] -- 0:00:10 829000 -- (-1301.951) (-1297.470) (-1301.291) [-1297.418] * (-1298.406) (-1301.451) (-1298.436) [-1298.493] -- 0:00:10 829500 -- (-1305.331) (-1299.038) [-1298.024] (-1297.447) * (-1298.060) (-1301.612) [-1299.753] (-1300.479) -- 0:00:10 830000 -- (-1300.170) [-1298.470] (-1299.545) (-1297.916) * (-1299.965) (-1303.329) [-1300.137] (-1298.233) -- 0:00:10 Average standard deviation of split frequencies: 0.008796 830500 -- [-1299.821] (-1299.250) (-1300.602) (-1298.204) * (-1300.775) (-1298.425) (-1301.826) [-1298.230] -- 0:00:10 831000 -- [-1297.586] (-1297.360) (-1299.186) (-1298.217) * (-1298.715) (-1297.922) (-1301.994) [-1297.911] -- 0:00:10 831500 -- (-1298.815) (-1298.970) [-1299.813] (-1298.184) * (-1303.109) (-1298.270) [-1297.737] (-1298.846) -- 0:00:10 832000 -- (-1299.708) (-1301.531) [-1301.990] (-1297.594) * (-1301.731) (-1301.626) (-1297.737) [-1300.666] -- 0:00:10 832500 -- [-1299.853] (-1299.811) (-1299.729) (-1297.292) * (-1302.212) [-1308.072] (-1298.655) (-1297.722) -- 0:00:10 833000 -- (-1299.226) (-1301.617) [-1299.685] (-1297.422) * (-1301.875) (-1306.064) [-1298.448] (-1298.649) -- 0:00:10 833500 -- (-1298.511) (-1301.622) (-1302.066) [-1299.160] * (-1300.244) (-1301.109) [-1299.895] (-1301.709) -- 0:00:10 834000 -- (-1303.920) (-1301.393) [-1302.758] (-1300.903) * (-1303.046) (-1297.594) [-1302.360] (-1298.651) -- 0:00:10 834500 -- [-1300.674] (-1299.592) (-1297.543) (-1298.304) * [-1301.138] (-1298.184) (-1299.174) (-1300.559) -- 0:00:10 835000 -- (-1299.083) (-1301.460) [-1298.967] (-1301.340) * (-1303.024) (-1297.532) (-1299.973) [-1299.524] -- 0:00:10 Average standard deviation of split frequencies: 0.008881 835500 -- (-1299.108) (-1301.179) [-1301.250] (-1300.382) * (-1300.869) (-1298.760) (-1300.714) [-1297.768] -- 0:00:10 836000 -- [-1298.014] (-1299.491) (-1298.920) (-1303.680) * (-1299.825) [-1299.314] (-1300.544) (-1298.535) -- 0:00:10 836500 -- (-1299.869) (-1300.263) [-1299.364] (-1298.844) * [-1300.338] (-1299.969) (-1299.140) (-1300.302) -- 0:00:10 837000 -- (-1301.616) (-1301.390) (-1300.189) [-1299.605] * (-1298.977) [-1299.313] (-1298.679) (-1301.345) -- 0:00:10 837500 -- (-1302.867) (-1299.900) (-1298.759) [-1297.285] * (-1300.455) [-1299.405] (-1299.038) (-1297.559) -- 0:00:10 838000 -- [-1302.745] (-1299.940) (-1297.526) (-1299.949) * (-1298.158) (-1299.366) [-1300.635] (-1302.474) -- 0:00:10 838500 -- [-1304.269] (-1302.455) (-1299.831) (-1298.496) * (-1299.795) (-1297.364) (-1298.142) [-1299.348] -- 0:00:10 839000 -- (-1304.816) (-1300.376) (-1297.820) [-1298.279] * (-1298.390) (-1302.861) (-1297.858) [-1297.952] -- 0:00:10 839500 -- (-1306.382) [-1301.401] (-1297.048) (-1298.260) * (-1298.223) (-1300.232) [-1299.101] (-1298.063) -- 0:00:10 840000 -- (-1302.552) [-1302.310] (-1298.062) (-1300.818) * [-1297.903] (-1300.620) (-1299.207) (-1300.550) -- 0:00:10 Average standard deviation of split frequencies: 0.008376 840500 -- (-1298.495) [-1300.297] (-1302.808) (-1300.126) * [-1299.315] (-1299.218) (-1300.750) (-1298.305) -- 0:00:10 841000 -- (-1297.379) [-1296.912] (-1298.529) (-1302.374) * (-1297.510) (-1301.664) (-1300.490) [-1298.257] -- 0:00:10 841500 -- (-1302.238) [-1303.705] (-1299.607) (-1301.022) * [-1299.393] (-1299.480) (-1299.584) (-1300.941) -- 0:00:09 842000 -- [-1299.285] (-1299.170) (-1299.788) (-1299.090) * (-1298.807) (-1301.766) [-1296.863] (-1299.759) -- 0:00:09 842500 -- (-1298.916) (-1298.767) [-1299.949] (-1297.410) * (-1301.284) (-1300.544) [-1300.671] (-1298.476) -- 0:00:09 843000 -- [-1299.517] (-1301.476) (-1304.295) (-1299.057) * (-1300.480) (-1300.331) (-1298.579) [-1297.848] -- 0:00:09 843500 -- [-1298.506] (-1299.902) (-1297.295) (-1298.719) * (-1297.576) [-1298.095] (-1300.401) (-1299.850) -- 0:00:09 844000 -- (-1298.527) (-1301.596) (-1297.756) [-1303.265] * [-1299.243] (-1297.724) (-1298.756) (-1304.443) -- 0:00:09 844500 -- (-1298.108) (-1302.302) [-1298.708] (-1302.637) * (-1299.158) (-1300.587) (-1299.023) [-1298.567] -- 0:00:09 845000 -- [-1298.762] (-1299.349) (-1300.416) (-1299.668) * (-1297.923) (-1301.772) (-1298.827) [-1298.250] -- 0:00:09 Average standard deviation of split frequencies: 0.008149 845500 -- (-1297.377) (-1297.469) [-1298.409] (-1298.687) * (-1297.920) [-1298.080] (-1298.219) (-1298.259) -- 0:00:09 846000 -- [-1297.703] (-1299.626) (-1298.352) (-1298.055) * (-1300.818) [-1297.552] (-1299.758) (-1298.206) -- 0:00:09 846500 -- [-1298.391] (-1302.970) (-1298.666) (-1301.053) * (-1300.291) [-1298.384] (-1299.952) (-1297.806) -- 0:00:09 847000 -- (-1297.482) [-1299.274] (-1299.272) (-1298.950) * (-1301.372) (-1302.039) (-1298.660) [-1299.995] -- 0:00:09 847500 -- (-1302.231) (-1297.851) (-1297.990) [-1300.589] * [-1300.872] (-1299.872) (-1299.594) (-1300.283) -- 0:00:09 848000 -- (-1297.593) (-1299.637) [-1296.946] (-1297.667) * (-1297.719) [-1298.151] (-1298.145) (-1298.282) -- 0:00:09 848500 -- [-1299.854] (-1298.505) (-1301.765) (-1299.939) * (-1299.323) [-1298.760] (-1299.059) (-1300.012) -- 0:00:09 849000 -- (-1301.839) [-1297.372] (-1301.810) (-1297.165) * (-1298.547) [-1301.131] (-1300.598) (-1298.928) -- 0:00:09 849500 -- (-1300.249) (-1299.008) [-1298.892] (-1300.750) * (-1300.633) [-1300.520] (-1300.924) (-1300.325) -- 0:00:09 850000 -- (-1303.341) [-1298.107] (-1297.998) (-1303.279) * (-1300.027) [-1298.032] (-1301.070) (-1298.918) -- 0:00:09 Average standard deviation of split frequencies: 0.008278 850500 -- [-1302.032] (-1302.503) (-1301.625) (-1301.760) * (-1301.484) (-1298.702) (-1300.917) [-1299.927] -- 0:00:09 851000 -- (-1299.705) (-1303.244) [-1299.796] (-1298.228) * (-1298.841) (-1297.947) [-1302.347] (-1299.802) -- 0:00:09 851500 -- (-1300.886) (-1299.805) [-1298.883] (-1299.124) * (-1297.790) (-1298.133) [-1301.288] (-1301.961) -- 0:00:09 852000 -- (-1298.742) (-1297.357) (-1301.847) [-1301.027] * (-1299.994) [-1297.746] (-1300.181) (-1300.453) -- 0:00:09 852500 -- (-1298.923) (-1299.563) [-1300.726] (-1301.521) * (-1298.810) (-1302.209) [-1300.378] (-1301.484) -- 0:00:09 853000 -- (-1299.361) (-1299.615) [-1299.528] (-1308.218) * [-1298.898] (-1299.257) (-1298.085) (-1304.400) -- 0:00:09 853500 -- (-1303.953) (-1299.714) [-1304.869] (-1299.037) * (-1300.957) (-1300.155) [-1297.704] (-1298.461) -- 0:00:09 854000 -- (-1298.754) (-1297.732) (-1309.793) [-1298.750] * [-1298.820] (-1299.766) (-1297.885) (-1301.219) -- 0:00:09 854500 -- (-1298.112) [-1300.175] (-1301.351) (-1298.649) * (-1297.224) (-1297.508) (-1298.343) [-1303.132] -- 0:00:09 855000 -- [-1303.970] (-1300.282) (-1298.298) (-1297.580) * (-1297.824) [-1298.816] (-1300.458) (-1301.776) -- 0:00:09 Average standard deviation of split frequencies: 0.008605 855500 -- (-1298.624) (-1297.603) (-1299.668) [-1298.611] * [-1299.149] (-1298.912) (-1300.462) (-1297.902) -- 0:00:09 856000 -- (-1300.792) (-1297.372) (-1299.532) [-1297.175] * [-1299.310] (-1301.723) (-1307.636) (-1298.863) -- 0:00:09 856500 -- (-1299.782) [-1299.260] (-1300.461) (-1297.435) * (-1297.766) (-1298.124) (-1298.726) [-1298.268] -- 0:00:09 857000 -- (-1300.633) [-1299.632] (-1302.651) (-1298.298) * (-1297.766) [-1298.811] (-1300.132) (-1300.925) -- 0:00:09 857500 -- [-1302.333] (-1301.686) (-1300.390) (-1299.906) * (-1299.782) (-1298.471) (-1299.599) [-1297.527] -- 0:00:08 858000 -- [-1299.992] (-1302.383) (-1300.992) (-1299.358) * [-1299.553] (-1299.502) (-1299.461) (-1298.361) -- 0:00:08 858500 -- (-1298.182) [-1298.446] (-1298.418) (-1297.214) * (-1299.819) (-1299.555) [-1303.484] (-1301.127) -- 0:00:08 859000 -- (-1297.857) (-1298.826) [-1299.318] (-1298.029) * [-1298.768] (-1298.972) (-1301.516) (-1302.156) -- 0:00:08 859500 -- (-1298.598) (-1298.864) [-1299.275] (-1299.415) * (-1296.979) (-1299.551) [-1299.329] (-1297.929) -- 0:00:08 860000 -- (-1298.923) [-1299.384] (-1297.728) (-1297.899) * (-1297.452) (-1297.838) (-1303.098) [-1302.075] -- 0:00:08 Average standard deviation of split frequencies: 0.008524 860500 -- [-1299.643] (-1299.563) (-1299.328) (-1299.949) * (-1298.532) (-1297.956) (-1300.244) [-1299.327] -- 0:00:08 861000 -- (-1297.963) (-1298.493) [-1299.305] (-1304.792) * (-1297.217) (-1299.345) (-1298.475) [-1299.807] -- 0:00:08 861500 -- (-1299.819) [-1297.783] (-1297.366) (-1304.374) * (-1298.568) (-1300.811) [-1297.978] (-1301.502) -- 0:00:08 862000 -- [-1299.499] (-1298.112) (-1299.143) (-1303.249) * (-1301.509) (-1298.195) (-1301.231) [-1297.402] -- 0:00:08 862500 -- (-1297.840) (-1298.281) (-1300.522) [-1298.554] * (-1300.618) [-1299.787] (-1302.901) (-1300.324) -- 0:00:08 863000 -- (-1298.861) (-1298.984) (-1297.244) [-1301.656] * (-1308.279) [-1299.734] (-1302.938) (-1301.843) -- 0:00:08 863500 -- (-1298.842) (-1302.724) [-1298.470] (-1303.016) * [-1298.400] (-1299.947) (-1304.538) (-1299.837) -- 0:00:08 864000 -- (-1299.215) (-1300.157) (-1300.482) [-1299.073] * (-1297.833) [-1299.931] (-1297.847) (-1299.073) -- 0:00:08 864500 -- (-1297.547) [-1297.431] (-1302.756) (-1298.237) * (-1299.162) (-1298.301) [-1300.938] (-1298.935) -- 0:00:08 865000 -- (-1297.810) (-1299.742) [-1301.705] (-1299.007) * [-1298.446] (-1298.396) (-1301.410) (-1300.144) -- 0:00:08 Average standard deviation of split frequencies: 0.008369 865500 -- (-1298.898) (-1298.814) (-1299.728) [-1298.982] * (-1299.315) [-1299.204] (-1297.697) (-1298.550) -- 0:00:08 866000 -- (-1300.021) (-1301.052) [-1300.041] (-1300.356) * (-1298.043) [-1301.880] (-1301.048) (-1298.378) -- 0:00:08 866500 -- (-1298.694) [-1298.598] (-1298.687) (-1299.833) * [-1298.713] (-1298.713) (-1299.477) (-1300.468) -- 0:00:08 867000 -- (-1298.627) [-1298.729] (-1299.049) (-1298.286) * (-1302.381) (-1299.687) [-1300.242] (-1299.945) -- 0:00:08 867500 -- (-1297.778) (-1300.115) (-1302.148) [-1297.797] * (-1297.850) (-1298.772) [-1298.026] (-1300.599) -- 0:00:08 868000 -- (-1297.642) [-1299.324] (-1306.806) (-1300.999) * [-1298.585] (-1297.291) (-1299.154) (-1301.547) -- 0:00:08 868500 -- [-1297.112] (-1298.162) (-1300.476) (-1301.173) * (-1299.521) (-1305.963) [-1298.918] (-1300.616) -- 0:00:08 869000 -- (-1297.577) [-1300.092] (-1298.366) (-1297.676) * (-1299.527) (-1300.233) [-1298.193] (-1299.762) -- 0:00:08 869500 -- (-1300.086) [-1298.978] (-1298.486) (-1297.375) * [-1299.270] (-1297.417) (-1303.174) (-1299.087) -- 0:00:08 870000 -- (-1298.343) (-1301.393) (-1299.180) [-1298.203] * (-1297.233) [-1297.239] (-1307.108) (-1299.448) -- 0:00:08 Average standard deviation of split frequencies: 0.008528 870500 -- (-1297.234) [-1297.378] (-1299.302) (-1303.567) * (-1298.806) (-1300.673) (-1306.994) [-1298.563] -- 0:00:08 871000 -- [-1300.406] (-1298.073) (-1298.805) (-1298.490) * (-1304.483) (-1297.894) [-1302.415] (-1297.852) -- 0:00:08 871500 -- (-1300.042) (-1299.042) (-1300.544) [-1301.254] * (-1297.410) (-1298.058) [-1298.378] (-1299.250) -- 0:00:08 872000 -- [-1299.093] (-1300.716) (-1297.706) (-1298.438) * [-1301.376] (-1298.588) (-1298.800) (-1303.269) -- 0:00:08 872500 -- (-1301.145) (-1304.886) (-1300.379) [-1300.370] * (-1297.577) [-1297.519] (-1300.822) (-1297.837) -- 0:00:08 873000 -- (-1297.865) (-1302.561) (-1300.292) [-1298.818] * [-1297.829] (-1299.682) (-1299.864) (-1300.113) -- 0:00:08 873500 -- (-1301.991) (-1299.721) [-1299.098] (-1299.846) * [-1298.264] (-1300.205) (-1299.125) (-1301.250) -- 0:00:07 874000 -- (-1306.190) (-1303.680) [-1300.435] (-1305.067) * (-1298.057) (-1298.404) [-1299.897] (-1303.232) -- 0:00:07 874500 -- (-1302.203) (-1303.219) (-1299.830) [-1297.974] * (-1298.756) (-1301.594) (-1297.949) [-1299.182] -- 0:00:07 875000 -- (-1297.684) (-1300.694) (-1299.221) [-1298.031] * (-1297.684) (-1299.935) [-1298.226] (-1298.432) -- 0:00:07 Average standard deviation of split frequencies: 0.008442 875500 -- (-1299.604) (-1300.618) (-1297.808) [-1298.294] * (-1300.956) (-1298.958) [-1298.019] (-1301.123) -- 0:00:07 876000 -- (-1298.665) (-1300.117) [-1298.595] (-1300.653) * (-1298.294) (-1299.601) (-1300.609) [-1299.109] -- 0:00:07 876500 -- [-1299.326] (-1300.307) (-1298.808) (-1297.082) * (-1299.794) [-1300.969] (-1301.757) (-1298.342) -- 0:00:07 877000 -- [-1299.521] (-1299.017) (-1303.488) (-1298.909) * (-1300.821) [-1298.724] (-1304.072) (-1298.314) -- 0:00:07 877500 -- (-1302.396) [-1299.136] (-1299.852) (-1300.011) * (-1300.387) (-1300.747) (-1300.427) [-1300.781] -- 0:00:07 878000 -- (-1300.261) (-1299.506) (-1300.315) [-1297.746] * [-1300.287] (-1299.683) (-1299.942) (-1297.240) -- 0:00:07 878500 -- [-1300.647] (-1298.198) (-1299.040) (-1298.233) * [-1297.615] (-1298.361) (-1300.413) (-1298.441) -- 0:00:07 879000 -- (-1305.578) (-1299.799) (-1303.068) [-1297.803] * (-1301.941) [-1298.795] (-1302.788) (-1300.408) -- 0:00:07 879500 -- (-1303.979) (-1300.306) (-1299.348) [-1298.027] * (-1298.030) (-1300.235) (-1299.827) [-1297.657] -- 0:00:07 880000 -- [-1300.805] (-1297.991) (-1298.623) (-1298.115) * (-1298.447) [-1301.227] (-1298.521) (-1302.624) -- 0:00:07 Average standard deviation of split frequencies: 0.008565 880500 -- (-1298.732) [-1299.543] (-1297.932) (-1298.918) * (-1301.527) [-1298.992] (-1298.136) (-1302.107) -- 0:00:07 881000 -- (-1297.296) (-1297.908) (-1298.142) [-1299.114] * (-1302.605) (-1300.790) (-1297.226) [-1299.675] -- 0:00:07 881500 -- (-1299.919) [-1301.481] (-1298.417) (-1302.731) * (-1299.262) (-1302.550) [-1298.013] (-1300.341) -- 0:00:07 882000 -- [-1298.259] (-1300.822) (-1298.877) (-1299.613) * (-1302.574) (-1297.970) (-1300.300) [-1301.089] -- 0:00:07 882500 -- (-1299.638) [-1298.440] (-1299.536) (-1301.703) * [-1300.066] (-1299.381) (-1299.363) (-1301.082) -- 0:00:07 883000 -- [-1299.808] (-1299.607) (-1297.935) (-1299.985) * (-1298.462) (-1299.780) [-1297.791] (-1303.528) -- 0:00:07 883500 -- [-1297.729] (-1299.717) (-1301.162) (-1299.587) * [-1299.393] (-1301.023) (-1300.634) (-1297.258) -- 0:00:07 884000 -- (-1300.186) (-1298.026) [-1299.003] (-1299.463) * (-1300.728) [-1298.422] (-1298.500) (-1298.765) -- 0:00:07 884500 -- (-1302.476) (-1298.318) (-1299.732) [-1297.540] * [-1301.427] (-1301.636) (-1298.185) (-1297.948) -- 0:00:07 885000 -- (-1301.668) (-1306.858) [-1299.016] (-1298.942) * [-1298.666] (-1299.687) (-1297.899) (-1303.776) -- 0:00:07 Average standard deviation of split frequencies: 0.008613 885500 -- [-1298.087] (-1301.381) (-1299.566) (-1303.230) * [-1298.285] (-1299.549) (-1297.455) (-1302.061) -- 0:00:07 886000 -- (-1303.982) (-1297.847) [-1299.372] (-1300.766) * [-1297.359] (-1301.028) (-1298.978) (-1304.981) -- 0:00:07 886500 -- [-1301.759] (-1301.457) (-1299.573) (-1302.315) * [-1297.323] (-1298.421) (-1300.982) (-1301.523) -- 0:00:07 887000 -- (-1300.525) (-1299.387) [-1300.489] (-1298.490) * (-1297.323) (-1300.733) [-1301.528] (-1302.794) -- 0:00:07 887500 -- (-1300.370) (-1299.579) [-1298.682] (-1301.489) * (-1302.590) [-1301.438] (-1303.644) (-1300.283) -- 0:00:07 888000 -- (-1299.609) [-1299.516] (-1300.995) (-1299.050) * (-1301.154) (-1299.210) [-1300.159] (-1301.145) -- 0:00:07 888500 -- (-1300.153) (-1299.112) (-1303.652) [-1298.032] * (-1299.163) (-1301.643) [-1300.763] (-1299.418) -- 0:00:07 889000 -- [-1301.040] (-1302.525) (-1301.528) (-1297.379) * [-1300.510] (-1303.646) (-1298.381) (-1298.931) -- 0:00:06 889500 -- [-1300.885] (-1300.968) (-1301.337) (-1298.444) * (-1299.549) (-1300.065) [-1299.074] (-1298.493) -- 0:00:06 890000 -- (-1298.819) (-1299.358) [-1298.081] (-1297.819) * (-1298.874) (-1299.282) [-1300.390] (-1298.369) -- 0:00:06 Average standard deviation of split frequencies: 0.008931 890500 -- (-1300.529) (-1301.545) (-1297.506) [-1297.871] * [-1298.332] (-1302.585) (-1297.614) (-1297.317) -- 0:00:06 891000 -- (-1301.947) [-1299.687] (-1299.450) (-1299.200) * (-1301.781) (-1307.061) (-1298.718) [-1297.627] -- 0:00:06 891500 -- [-1299.843] (-1303.189) (-1299.551) (-1298.173) * (-1298.833) [-1299.717] (-1298.375) (-1297.733) -- 0:00:06 892000 -- [-1298.117] (-1298.807) (-1299.715) (-1302.694) * (-1299.089) (-1300.046) (-1300.500) [-1300.700] -- 0:00:06 892500 -- (-1298.340) (-1297.697) [-1298.364] (-1299.548) * (-1299.170) (-1301.020) [-1297.799] (-1298.551) -- 0:00:06 893000 -- (-1300.175) (-1300.033) [-1301.330] (-1299.924) * (-1299.616) [-1300.889] (-1298.168) (-1298.484) -- 0:00:06 893500 -- (-1299.984) [-1297.786] (-1299.275) (-1298.353) * (-1300.816) (-1298.536) (-1298.307) [-1300.506] -- 0:00:06 894000 -- [-1298.024] (-1298.932) (-1301.551) (-1299.341) * (-1302.727) (-1301.559) [-1298.157] (-1298.244) -- 0:00:06 894500 -- (-1301.713) [-1298.790] (-1306.852) (-1299.954) * (-1299.169) (-1300.664) [-1299.220] (-1300.390) -- 0:00:06 895000 -- [-1302.137] (-1301.294) (-1302.150) (-1299.811) * (-1300.922) [-1300.744] (-1303.658) (-1300.117) -- 0:00:06 Average standard deviation of split frequencies: 0.008878 895500 -- [-1298.225] (-1301.931) (-1302.548) (-1300.400) * (-1300.332) (-1303.848) [-1297.374] (-1297.750) -- 0:00:06 896000 -- (-1304.049) (-1300.019) [-1299.491] (-1304.801) * (-1298.524) (-1297.604) [-1297.565] (-1297.541) -- 0:00:06 896500 -- (-1299.012) (-1300.494) [-1299.218] (-1299.590) * [-1303.981] (-1298.089) (-1297.405) (-1297.375) -- 0:00:06 897000 -- (-1297.980) (-1298.990) (-1301.102) [-1300.405] * [-1301.649] (-1297.330) (-1299.063) (-1304.583) -- 0:00:06 897500 -- (-1299.225) (-1299.776) (-1297.293) [-1300.670] * (-1300.010) [-1300.722] (-1301.600) (-1302.066) -- 0:00:06 898000 -- (-1297.435) [-1297.241] (-1298.672) (-1298.807) * (-1298.924) (-1301.634) (-1299.203) [-1304.611] -- 0:00:06 898500 -- [-1297.490] (-1298.434) (-1305.309) (-1299.785) * (-1299.702) (-1298.354) [-1300.790] (-1298.697) -- 0:00:06 899000 -- (-1303.347) [-1299.163] (-1298.813) (-1299.362) * (-1300.349) [-1297.253] (-1299.792) (-1302.467) -- 0:00:06 899500 -- (-1301.307) (-1298.604) [-1299.332] (-1300.314) * (-1301.296) [-1301.017] (-1299.292) (-1299.467) -- 0:00:06 900000 -- [-1299.298] (-1299.307) (-1298.938) (-1301.115) * (-1299.210) (-1300.669) [-1301.740] (-1299.781) -- 0:00:06 Average standard deviation of split frequencies: 0.008930 900500 -- (-1301.085) [-1298.741] (-1299.021) (-1299.221) * (-1300.668) [-1302.246] (-1300.023) (-1300.711) -- 0:00:06 901000 -- (-1300.897) (-1299.868) [-1297.346] (-1301.087) * (-1298.522) (-1299.084) [-1298.999] (-1301.131) -- 0:00:06 901500 -- [-1303.255] (-1298.864) (-1297.923) (-1298.718) * [-1297.494] (-1298.705) (-1299.939) (-1298.134) -- 0:00:06 902000 -- (-1300.353) [-1298.647] (-1299.062) (-1302.552) * (-1298.374) (-1299.541) [-1298.001] (-1298.619) -- 0:00:06 902500 -- (-1301.184) (-1299.804) (-1298.882) [-1298.539] * (-1300.696) (-1299.251) (-1300.216) [-1300.297] -- 0:00:06 903000 -- (-1300.342) [-1298.687] (-1300.260) (-1297.740) * (-1297.826) [-1299.783] (-1299.027) (-1299.688) -- 0:00:06 903500 -- (-1305.426) [-1300.175] (-1298.863) (-1297.607) * (-1299.830) (-1302.576) (-1304.549) [-1301.193] -- 0:00:06 904000 -- (-1298.425) [-1299.075] (-1300.331) (-1297.705) * [-1297.602] (-1299.495) (-1300.022) (-1300.313) -- 0:00:06 904500 -- (-1297.607) (-1300.782) (-1300.588) [-1298.568] * (-1298.953) (-1297.258) [-1301.027] (-1298.754) -- 0:00:06 905000 -- [-1297.768] (-1299.739) (-1301.224) (-1298.597) * (-1301.592) [-1297.512] (-1298.649) (-1300.667) -- 0:00:05 Average standard deviation of split frequencies: 0.009138 905500 -- (-1300.252) (-1301.529) [-1299.904] (-1301.614) * (-1300.750) [-1300.500] (-1297.630) (-1299.905) -- 0:00:05 906000 -- [-1300.678] (-1299.624) (-1302.002) (-1298.022) * (-1298.014) [-1298.546] (-1297.527) (-1301.367) -- 0:00:05 906500 -- (-1307.602) (-1299.428) [-1303.713] (-1299.609) * (-1297.971) (-1299.107) (-1300.501) [-1299.808] -- 0:00:05 907000 -- (-1300.767) (-1297.765) (-1299.933) [-1298.764] * (-1298.007) (-1301.188) (-1300.073) [-1301.811] -- 0:00:05 907500 -- (-1306.110) (-1301.059) (-1299.273) [-1300.058] * [-1297.904] (-1304.182) (-1297.682) (-1300.044) -- 0:00:05 908000 -- (-1299.453) (-1301.158) (-1298.452) [-1300.039] * [-1299.820] (-1300.951) (-1299.333) (-1298.486) -- 0:00:05 908500 -- [-1300.882] (-1299.307) (-1299.807) (-1299.017) * (-1300.770) (-1299.871) (-1304.323) [-1298.542] -- 0:00:05 909000 -- (-1304.668) (-1301.802) (-1297.886) [-1302.609] * (-1298.810) (-1300.711) (-1302.059) [-1297.693] -- 0:00:05 909500 -- [-1298.556] (-1304.299) (-1300.261) (-1302.515) * (-1297.649) (-1299.612) [-1298.489] (-1298.169) -- 0:00:05 910000 -- (-1296.967) (-1300.891) (-1300.800) [-1298.123] * [-1297.598] (-1305.524) (-1298.040) (-1298.240) -- 0:00:05 Average standard deviation of split frequencies: 0.009156 910500 -- (-1299.503) (-1300.175) [-1298.322] (-1299.630) * (-1299.152) (-1300.401) [-1301.384] (-1299.368) -- 0:00:05 911000 -- [-1297.917] (-1299.588) (-1298.614) (-1304.597) * (-1300.095) (-1302.625) (-1299.232) [-1298.545] -- 0:00:05 911500 -- [-1300.506] (-1298.339) (-1297.537) (-1298.553) * (-1297.823) (-1299.113) (-1299.719) [-1298.425] -- 0:00:05 912000 -- (-1302.104) [-1298.200] (-1302.258) (-1299.248) * (-1298.020) [-1300.779] (-1299.962) (-1298.360) -- 0:00:05 912500 -- [-1301.324] (-1297.698) (-1301.588) (-1297.458) * (-1298.253) (-1298.951) (-1299.719) [-1298.357] -- 0:00:05 913000 -- (-1299.778) (-1300.423) [-1303.877] (-1301.537) * [-1298.766] (-1298.983) (-1300.144) (-1298.693) -- 0:00:05 913500 -- (-1302.826) [-1300.821] (-1298.567) (-1299.655) * (-1300.985) (-1302.144) (-1301.310) [-1300.970] -- 0:00:05 914000 -- (-1302.063) [-1300.230] (-1298.696) (-1302.435) * (-1297.607) [-1300.221] (-1299.255) (-1298.669) -- 0:00:05 914500 -- (-1302.901) (-1297.871) [-1299.535] (-1299.690) * (-1300.970) (-1300.462) (-1298.890) [-1299.520] -- 0:00:05 915000 -- (-1302.348) [-1300.460] (-1300.867) (-1301.621) * [-1298.614] (-1300.467) (-1301.845) (-1299.914) -- 0:00:05 Average standard deviation of split frequencies: 0.008974 915500 -- (-1298.492) [-1300.916] (-1300.905) (-1300.561) * (-1298.713) (-1299.187) [-1297.374] (-1299.216) -- 0:00:05 916000 -- (-1297.447) (-1301.440) [-1300.802] (-1297.976) * (-1299.753) (-1299.345) [-1297.901] (-1299.266) -- 0:00:05 916500 -- (-1299.068) [-1297.750] (-1298.835) (-1300.481) * (-1300.820) [-1297.728] (-1297.557) (-1300.812) -- 0:00:05 917000 -- (-1299.507) (-1299.113) [-1298.498] (-1298.843) * [-1298.950] (-1299.568) (-1299.269) (-1300.127) -- 0:00:05 917500 -- [-1299.168] (-1297.483) (-1301.072) (-1299.503) * [-1297.410] (-1298.138) (-1298.472) (-1300.818) -- 0:00:05 918000 -- [-1297.662] (-1297.386) (-1300.274) (-1299.104) * (-1299.297) (-1298.039) [-1300.661] (-1299.036) -- 0:00:05 918500 -- (-1299.266) [-1298.412] (-1298.500) (-1298.582) * [-1297.893] (-1299.013) (-1300.282) (-1299.742) -- 0:00:05 919000 -- (-1300.002) [-1300.073] (-1299.777) (-1299.019) * [-1298.474] (-1298.620) (-1297.565) (-1299.057) -- 0:00:05 919500 -- (-1300.209) [-1301.331] (-1297.928) (-1298.342) * [-1298.387] (-1299.635) (-1297.452) (-1297.451) -- 0:00:05 920000 -- (-1299.734) [-1298.166] (-1299.916) (-1300.377) * (-1297.067) (-1299.242) (-1300.423) [-1298.556] -- 0:00:05 Average standard deviation of split frequencies: 0.009376 920500 -- (-1302.000) [-1299.997] (-1302.868) (-1303.924) * (-1299.624) [-1297.921] (-1301.069) (-1299.827) -- 0:00:05 921000 -- [-1298.494] (-1299.727) (-1305.474) (-1298.458) * (-1299.885) [-1299.067] (-1303.122) (-1304.024) -- 0:00:04 921500 -- (-1302.574) [-1298.426] (-1298.950) (-1303.428) * (-1299.005) (-1300.796) (-1299.942) [-1306.271] -- 0:00:04 922000 -- [-1300.382] (-1300.555) (-1297.445) (-1300.351) * (-1297.568) [-1298.240] (-1298.697) (-1301.722) -- 0:00:04 922500 -- (-1298.844) (-1298.400) [-1298.016] (-1297.477) * (-1302.142) [-1298.911] (-1298.351) (-1297.681) -- 0:00:04 923000 -- (-1301.495) (-1298.149) [-1297.786] (-1300.297) * [-1299.456] (-1301.701) (-1297.369) (-1299.372) -- 0:00:04 923500 -- [-1299.465] (-1298.836) (-1297.933) (-1298.647) * (-1299.632) [-1298.589] (-1298.256) (-1300.820) -- 0:00:04 924000 -- (-1299.319) (-1298.435) [-1300.699] (-1299.720) * [-1304.088] (-1297.925) (-1298.215) (-1299.717) -- 0:00:04 924500 -- [-1299.512] (-1301.490) (-1303.440) (-1302.972) * (-1300.456) (-1303.133) [-1301.877] (-1302.417) -- 0:00:04 925000 -- (-1303.947) (-1300.505) (-1299.299) [-1298.539] * (-1298.897) (-1299.169) [-1301.174] (-1297.946) -- 0:00:04 Average standard deviation of split frequencies: 0.009291 925500 -- (-1302.854) [-1298.157] (-1300.196) (-1298.456) * (-1299.872) [-1297.481] (-1299.009) (-1297.797) -- 0:00:04 926000 -- (-1300.202) (-1299.540) (-1300.075) [-1299.601] * (-1297.305) (-1297.545) (-1298.897) [-1298.043] -- 0:00:04 926500 -- (-1300.849) [-1300.087] (-1298.374) (-1300.276) * [-1298.513] (-1299.544) (-1297.588) (-1298.315) -- 0:00:04 927000 -- (-1303.238) [-1302.374] (-1299.066) (-1299.627) * [-1299.236] (-1299.017) (-1297.668) (-1300.487) -- 0:00:04 927500 -- [-1302.007] (-1299.654) (-1300.327) (-1298.392) * [-1300.559] (-1299.191) (-1297.655) (-1296.928) -- 0:00:04 928000 -- [-1298.976] (-1300.611) (-1301.309) (-1299.360) * (-1305.831) (-1299.866) [-1297.731] (-1297.627) -- 0:00:04 928500 -- (-1297.480) [-1297.734] (-1299.524) (-1299.635) * (-1301.055) (-1298.258) (-1299.960) [-1297.591] -- 0:00:04 929000 -- (-1298.955) [-1298.640] (-1299.333) (-1300.491) * (-1299.119) (-1301.526) [-1300.921] (-1301.468) -- 0:00:04 929500 -- (-1301.093) (-1301.600) [-1300.994] (-1297.990) * (-1297.489) [-1299.441] (-1301.164) (-1299.715) -- 0:00:04 930000 -- (-1301.912) (-1302.267) [-1299.787] (-1297.879) * (-1298.398) (-1300.613) (-1302.474) [-1298.785] -- 0:00:04 Average standard deviation of split frequencies: 0.009181 930500 -- [-1299.144] (-1297.740) (-1299.534) (-1299.981) * [-1299.680] (-1297.308) (-1301.283) (-1297.167) -- 0:00:04 931000 -- (-1297.469) [-1297.717] (-1300.701) (-1303.984) * (-1300.810) (-1297.836) (-1298.605) [-1299.399] -- 0:00:04 931500 -- (-1299.502) [-1298.008] (-1302.015) (-1298.977) * [-1299.235] (-1297.727) (-1298.101) (-1299.204) -- 0:00:04 932000 -- (-1297.773) (-1301.161) [-1299.256] (-1298.440) * (-1299.726) [-1298.117] (-1298.413) (-1299.112) -- 0:00:04 932500 -- (-1303.059) (-1301.575) [-1298.873] (-1302.204) * [-1297.865] (-1299.313) (-1299.660) (-1302.766) -- 0:00:04 933000 -- [-1301.012] (-1297.900) (-1299.002) (-1301.756) * (-1296.923) (-1300.652) [-1298.745] (-1303.509) -- 0:00:04 933500 -- (-1302.354) (-1298.965) [-1298.661] (-1298.123) * (-1298.761) (-1300.633) [-1297.636] (-1299.940) -- 0:00:04 934000 -- [-1300.099] (-1299.631) (-1306.506) (-1303.017) * [-1301.031] (-1304.844) (-1299.509) (-1300.218) -- 0:00:04 934500 -- (-1299.417) (-1299.406) [-1298.230] (-1300.553) * (-1302.506) [-1297.950] (-1298.325) (-1301.327) -- 0:00:04 935000 -- (-1299.083) (-1299.420) [-1298.512] (-1300.257) * (-1301.637) [-1298.858] (-1299.099) (-1299.411) -- 0:00:04 Average standard deviation of split frequencies: 0.009128 935500 -- (-1299.284) (-1298.773) (-1299.238) [-1299.023] * (-1301.932) [-1301.432] (-1297.916) (-1297.243) -- 0:00:04 936000 -- [-1298.884] (-1297.964) (-1300.094) (-1299.637) * (-1304.961) [-1300.395] (-1297.604) (-1298.765) -- 0:00:04 936500 -- (-1300.106) [-1298.530] (-1298.597) (-1298.424) * [-1300.310] (-1298.070) (-1299.003) (-1301.656) -- 0:00:04 937000 -- (-1306.172) (-1299.480) (-1297.922) [-1300.428] * (-1299.211) (-1299.269) [-1298.910] (-1298.541) -- 0:00:03 937500 -- (-1304.643) [-1298.578] (-1299.070) (-1301.682) * (-1299.519) (-1302.102) [-1298.238] (-1298.929) -- 0:00:03 938000 -- (-1297.841) (-1298.469) (-1299.479) [-1299.450] * (-1304.412) (-1300.102) (-1301.409) [-1298.940] -- 0:00:03 938500 -- [-1298.247] (-1301.281) (-1299.648) (-1297.653) * [-1303.415] (-1298.521) (-1298.899) (-1297.932) -- 0:00:03 939000 -- (-1297.141) (-1297.615) (-1298.094) [-1297.584] * (-1300.004) [-1299.683] (-1300.638) (-1299.628) -- 0:00:03 939500 -- [-1297.405] (-1298.417) (-1298.443) (-1298.302) * (-1300.095) [-1300.359] (-1298.325) (-1301.590) -- 0:00:03 940000 -- (-1299.868) [-1298.942] (-1299.047) (-1300.106) * (-1299.881) [-1300.819] (-1302.953) (-1299.066) -- 0:00:03 Average standard deviation of split frequencies: 0.009428 940500 -- (-1302.383) (-1296.991) (-1298.533) [-1299.575] * (-1298.413) (-1298.627) (-1301.569) [-1299.918] -- 0:00:03 941000 -- (-1302.174) [-1298.587] (-1299.027) (-1301.995) * [-1298.164] (-1298.419) (-1300.503) (-1300.960) -- 0:00:03 941500 -- (-1299.913) [-1299.362] (-1300.040) (-1299.947) * (-1300.636) [-1298.326] (-1301.772) (-1299.836) -- 0:00:03 942000 -- (-1300.416) (-1297.247) [-1298.710] (-1300.427) * (-1299.949) [-1304.095] (-1299.977) (-1300.357) -- 0:00:03 942500 -- (-1299.250) (-1297.261) [-1299.234] (-1301.515) * (-1300.453) (-1299.785) (-1299.622) [-1297.595] -- 0:00:03 943000 -- (-1299.704) [-1297.278] (-1297.749) (-1298.321) * [-1298.967] (-1298.916) (-1298.051) (-1297.568) -- 0:00:03 943500 -- [-1298.058] (-1297.323) (-1299.927) (-1297.545) * [-1299.136] (-1299.792) (-1297.924) (-1297.578) -- 0:00:03 944000 -- (-1297.404) [-1298.664] (-1298.605) (-1300.404) * [-1298.046] (-1300.877) (-1297.436) (-1298.018) -- 0:00:03 944500 -- (-1297.366) (-1299.874) (-1301.223) [-1300.835] * (-1298.075) [-1297.838] (-1300.198) (-1299.415) -- 0:00:03 945000 -- (-1298.510) (-1299.569) (-1300.411) [-1297.207] * (-1302.010) [-1299.342] (-1301.326) (-1298.149) -- 0:00:03 Average standard deviation of split frequencies: 0.009406 945500 -- [-1299.864] (-1300.059) (-1299.118) (-1297.366) * (-1299.391) (-1303.919) [-1301.309] (-1302.061) -- 0:00:03 946000 -- (-1299.991) [-1299.111] (-1299.591) (-1297.447) * [-1299.583] (-1306.346) (-1301.512) (-1300.033) -- 0:00:03 946500 -- [-1299.260] (-1298.454) (-1301.486) (-1297.492) * (-1298.024) (-1302.754) (-1302.622) [-1299.039] -- 0:00:03 947000 -- [-1301.091] (-1297.555) (-1301.177) (-1297.171) * (-1298.285) (-1298.475) (-1299.711) [-1299.868] -- 0:00:03 947500 -- [-1301.892] (-1300.688) (-1299.654) (-1302.538) * (-1300.925) (-1300.424) [-1297.721] (-1300.024) -- 0:00:03 948000 -- (-1301.352) (-1299.935) (-1298.361) [-1299.761] * (-1298.755) (-1300.302) [-1297.764] (-1299.935) -- 0:00:03 948500 -- [-1299.432] (-1299.124) (-1298.131) (-1304.406) * (-1300.628) (-1300.418) [-1297.363] (-1298.533) -- 0:00:03 949000 -- (-1298.695) [-1298.900] (-1297.363) (-1298.912) * [-1299.659] (-1298.371) (-1298.329) (-1298.683) -- 0:00:03 949500 -- (-1298.891) (-1305.655) (-1297.451) [-1298.934] * [-1299.221] (-1298.885) (-1302.325) (-1300.117) -- 0:00:03 950000 -- (-1297.727) [-1299.444] (-1297.660) (-1300.330) * [-1299.042] (-1300.005) (-1298.543) (-1306.073) -- 0:00:03 Average standard deviation of split frequencies: 0.009545 950500 -- [-1297.847] (-1303.445) (-1300.890) (-1298.677) * [-1299.404] (-1298.172) (-1298.782) (-1301.026) -- 0:00:03 951000 -- (-1298.939) (-1304.670) [-1298.255] (-1299.402) * (-1299.541) (-1300.126) (-1297.865) [-1300.283] -- 0:00:03 951500 -- [-1299.745] (-1303.164) (-1302.514) (-1299.454) * [-1299.109] (-1300.308) (-1298.604) (-1299.725) -- 0:00:03 952000 -- [-1300.205] (-1299.882) (-1298.932) (-1300.588) * (-1299.411) [-1298.458] (-1299.939) (-1300.090) -- 0:00:03 952500 -- (-1300.709) (-1298.075) (-1299.958) [-1300.335] * (-1302.291) (-1298.433) (-1297.311) [-1299.629] -- 0:00:02 953000 -- (-1301.067) [-1298.905] (-1299.099) (-1302.688) * (-1298.180) [-1299.945] (-1298.249) (-1299.297) -- 0:00:02 953500 -- (-1303.023) [-1301.151] (-1297.710) (-1300.602) * (-1299.276) (-1297.558) [-1302.404] (-1298.576) -- 0:00:02 954000 -- (-1298.939) (-1302.209) (-1297.541) [-1297.368] * [-1297.583] (-1298.961) (-1300.669) (-1300.067) -- 0:00:02 954500 -- [-1298.254] (-1301.785) (-1297.758) (-1300.390) * (-1298.609) [-1298.771] (-1298.797) (-1299.021) -- 0:00:02 955000 -- (-1298.074) [-1298.908] (-1301.581) (-1299.141) * (-1298.294) (-1298.720) [-1299.819] (-1299.487) -- 0:00:02 Average standard deviation of split frequencies: 0.009500 955500 -- (-1300.608) (-1298.886) [-1300.422] (-1299.753) * (-1300.513) [-1298.378] (-1299.028) (-1298.359) -- 0:00:02 956000 -- (-1300.191) (-1302.696) [-1300.340] (-1298.168) * [-1303.040] (-1299.370) (-1298.796) (-1299.631) -- 0:00:02 956500 -- (-1300.326) (-1299.490) [-1298.540] (-1299.219) * (-1298.340) [-1298.544] (-1298.132) (-1301.534) -- 0:00:02 957000 -- [-1297.673] (-1299.331) (-1299.025) (-1298.144) * (-1297.165) [-1297.855] (-1298.182) (-1302.665) -- 0:00:02 957500 -- [-1298.705] (-1300.372) (-1299.009) (-1298.908) * (-1298.561) (-1297.922) (-1297.703) [-1299.145] -- 0:00:02 958000 -- (-1297.558) (-1300.979) [-1299.287] (-1297.510) * [-1298.996] (-1298.375) (-1297.232) (-1300.859) -- 0:00:02 958500 -- (-1299.980) (-1300.592) [-1302.758] (-1298.167) * (-1300.161) (-1299.777) (-1302.074) [-1300.865] -- 0:00:02 959000 -- (-1298.073) (-1298.011) [-1298.941] (-1301.062) * [-1301.939] (-1297.341) (-1297.569) (-1297.064) -- 0:00:02 959500 -- [-1298.170] (-1299.970) (-1299.300) (-1304.298) * (-1301.304) (-1304.225) [-1299.387] (-1298.348) -- 0:00:02 960000 -- (-1299.302) (-1300.707) [-1299.003] (-1301.541) * [-1299.760] (-1298.076) (-1298.296) (-1305.146) -- 0:00:02 Average standard deviation of split frequencies: 0.009415 960500 -- (-1297.144) (-1298.276) [-1300.860] (-1298.200) * (-1300.434) [-1298.226] (-1304.042) (-1298.880) -- 0:00:02 961000 -- (-1299.869) (-1298.284) [-1299.775] (-1303.216) * (-1299.377) (-1298.048) [-1301.618] (-1297.899) -- 0:00:02 961500 -- (-1297.317) [-1298.598] (-1299.445) (-1306.423) * (-1298.429) (-1298.636) [-1298.203] (-1298.967) -- 0:00:02 962000 -- (-1298.554) [-1298.078] (-1300.465) (-1304.018) * (-1303.746) [-1298.837] (-1301.028) (-1304.594) -- 0:00:02 962500 -- (-1300.086) (-1299.792) (-1301.955) [-1299.672] * (-1303.935) (-1299.886) [-1298.242] (-1300.221) -- 0:00:02 963000 -- (-1299.101) (-1299.067) [-1298.308] (-1303.612) * (-1298.435) (-1297.455) [-1298.632] (-1303.386) -- 0:00:02 963500 -- (-1300.491) [-1301.084] (-1298.916) (-1301.327) * (-1298.207) (-1299.688) (-1297.299) [-1299.130] -- 0:00:02 964000 -- [-1300.437] (-1303.137) (-1298.675) (-1299.202) * (-1300.861) [-1299.984] (-1298.043) (-1298.863) -- 0:00:02 964500 -- (-1298.932) (-1300.743) (-1299.123) [-1298.356] * (-1300.136) (-1301.604) [-1300.278] (-1299.857) -- 0:00:02 965000 -- [-1298.486] (-1300.953) (-1299.057) (-1302.428) * (-1299.917) [-1306.991] (-1297.808) (-1299.555) -- 0:00:02 Average standard deviation of split frequencies: 0.009302 965500 -- (-1301.219) (-1298.927) [-1300.798] (-1298.041) * (-1299.449) (-1300.228) [-1297.898] (-1299.524) -- 0:00:02 966000 -- (-1300.876) [-1298.252] (-1298.835) (-1298.899) * (-1299.554) (-1299.694) [-1299.400] (-1299.656) -- 0:00:02 966500 -- [-1299.896] (-1299.430) (-1298.427) (-1300.040) * [-1298.746] (-1301.292) (-1298.897) (-1298.111) -- 0:00:02 967000 -- (-1302.862) (-1301.053) (-1298.078) [-1299.437] * (-1302.178) (-1299.291) (-1298.811) [-1300.014] -- 0:00:02 967500 -- (-1302.909) (-1298.896) [-1300.181] (-1298.642) * (-1297.348) (-1298.433) (-1298.271) [-1298.473] -- 0:00:02 968000 -- (-1297.761) (-1299.937) (-1299.905) [-1301.225] * (-1298.906) [-1300.858] (-1299.852) (-1298.552) -- 0:00:02 968500 -- (-1298.243) [-1298.972] (-1299.135) (-1298.657) * (-1298.298) (-1299.808) (-1298.912) [-1301.037] -- 0:00:01 969000 -- [-1299.029] (-1298.617) (-1299.721) (-1301.007) * (-1298.127) [-1301.808] (-1301.878) (-1301.237) -- 0:00:01 969500 -- (-1300.565) (-1297.675) (-1299.023) [-1298.096] * [-1299.135] (-1299.290) (-1303.760) (-1298.016) -- 0:00:01 970000 -- (-1305.097) (-1300.298) (-1297.926) [-1298.539] * (-1298.624) (-1298.067) (-1297.764) [-1303.445] -- 0:00:01 Average standard deviation of split frequencies: 0.008863 970500 -- (-1301.746) (-1297.805) [-1298.910] (-1298.784) * [-1297.939] (-1298.568) (-1298.149) (-1299.196) -- 0:00:01 971000 -- (-1298.991) (-1299.030) [-1298.824] (-1298.574) * (-1297.138) [-1302.488] (-1298.933) (-1305.457) -- 0:00:01 971500 -- (-1298.490) (-1300.950) [-1298.058] (-1297.680) * (-1298.366) [-1297.373] (-1297.768) (-1300.958) -- 0:00:01 972000 -- (-1298.628) (-1302.676) [-1300.224] (-1298.164) * (-1298.842) (-1298.971) (-1301.827) [-1298.965] -- 0:00:01 972500 -- (-1297.880) (-1299.394) (-1299.423) [-1299.273] * (-1297.268) (-1298.631) (-1297.609) [-1297.580] -- 0:00:01 973000 -- (-1297.859) [-1302.269] (-1308.294) (-1298.016) * [-1299.213] (-1299.501) (-1300.041) (-1300.511) -- 0:00:01 973500 -- (-1299.320) [-1298.858] (-1303.035) (-1300.541) * (-1298.445) (-1298.653) (-1301.421) [-1298.225] -- 0:00:01 974000 -- [-1299.191] (-1299.893) (-1298.541) (-1298.702) * (-1301.464) (-1301.024) (-1300.413) [-1298.205] -- 0:00:01 974500 -- (-1298.409) (-1299.636) [-1299.793] (-1299.083) * (-1299.287) [-1299.576] (-1297.823) (-1300.030) -- 0:00:01 975000 -- (-1298.326) [-1301.063] (-1298.779) (-1301.249) * (-1308.491) (-1298.725) (-1299.443) [-1297.588] -- 0:00:01 Average standard deviation of split frequencies: 0.009056 975500 -- (-1298.604) [-1300.892] (-1302.230) (-1298.060) * (-1302.416) (-1300.212) (-1302.121) [-1298.304] -- 0:00:01 976000 -- [-1300.280] (-1297.823) (-1299.538) (-1300.353) * [-1299.868] (-1298.203) (-1300.891) (-1304.181) -- 0:00:01 976500 -- (-1298.137) (-1298.435) [-1301.099] (-1298.664) * [-1299.895] (-1297.820) (-1298.950) (-1300.351) -- 0:00:01 977000 -- (-1297.989) [-1300.456] (-1299.173) (-1298.217) * (-1299.055) [-1297.501] (-1300.745) (-1302.725) -- 0:00:01 977500 -- (-1301.887) (-1302.082) [-1297.598] (-1298.606) * (-1297.670) (-1306.647) (-1300.218) [-1299.822] -- 0:00:01 978000 -- (-1298.626) (-1299.896) (-1299.384) [-1297.856] * [-1298.157] (-1301.081) (-1302.535) (-1298.964) -- 0:00:01 978500 -- (-1298.765) (-1299.787) [-1299.845] (-1298.652) * (-1303.575) (-1297.872) [-1298.138] (-1298.874) -- 0:00:01 979000 -- (-1303.068) [-1298.078] (-1299.215) (-1298.592) * (-1301.394) (-1298.587) (-1299.425) [-1298.092] -- 0:00:01 979500 -- [-1302.702] (-1303.246) (-1301.064) (-1300.303) * (-1299.806) [-1298.786] (-1300.318) (-1298.162) -- 0:00:01 980000 -- (-1303.992) (-1299.772) [-1299.449] (-1298.477) * [-1299.176] (-1297.350) (-1299.171) (-1297.353) -- 0:00:01 Average standard deviation of split frequencies: 0.009794 980500 -- (-1298.379) (-1302.009) [-1298.919] (-1300.508) * (-1299.269) [-1299.015] (-1298.716) (-1297.350) -- 0:00:01 981000 -- (-1299.999) (-1300.089) [-1300.075] (-1298.344) * (-1299.272) (-1307.235) [-1299.073] (-1298.299) -- 0:00:01 981500 -- (-1298.076) (-1303.556) (-1299.881) [-1299.511] * (-1297.520) (-1300.520) (-1298.265) [-1300.252] -- 0:00:01 982000 -- [-1298.230] (-1300.119) (-1300.454) (-1298.572) * (-1297.818) (-1301.356) (-1301.476) [-1299.412] -- 0:00:01 982500 -- (-1299.709) [-1298.317] (-1300.966) (-1299.895) * [-1300.163] (-1298.346) (-1302.848) (-1299.255) -- 0:00:01 983000 -- (-1299.277) (-1298.782) [-1300.446] (-1301.042) * [-1301.642] (-1298.626) (-1298.622) (-1300.167) -- 0:00:01 983500 -- [-1300.565] (-1298.049) (-1300.481) (-1302.091) * (-1298.458) [-1299.339] (-1300.119) (-1303.316) -- 0:00:01 984000 -- (-1299.924) (-1298.246) [-1300.815] (-1300.910) * (-1299.186) (-1300.545) [-1301.796] (-1299.217) -- 0:00:01 984500 -- (-1300.126) (-1300.519) (-1296.995) [-1297.998] * [-1299.573] (-1300.612) (-1297.535) (-1303.790) -- 0:00:00 985000 -- [-1299.234] (-1305.215) (-1297.817) (-1299.628) * (-1303.026) (-1302.780) (-1299.057) [-1299.416] -- 0:00:00 Average standard deviation of split frequencies: 0.009741 985500 -- [-1299.163] (-1303.885) (-1297.817) (-1300.297) * [-1298.504] (-1298.965) (-1298.838) (-1299.121) -- 0:00:00 986000 -- (-1297.561) (-1302.631) (-1302.686) [-1299.176] * (-1302.436) (-1299.432) (-1297.525) [-1298.279] -- 0:00:00 986500 -- (-1302.718) (-1299.803) (-1298.685) [-1298.579] * (-1298.586) (-1304.464) [-1298.851] (-1300.700) -- 0:00:00 987000 -- (-1300.634) [-1298.926] (-1300.747) (-1300.951) * (-1297.294) [-1300.661] (-1297.658) (-1297.749) -- 0:00:00 987500 -- (-1302.135) (-1299.409) (-1303.980) [-1299.407] * (-1300.986) (-1298.240) [-1297.896] (-1298.349) -- 0:00:00 988000 -- (-1299.293) (-1298.493) [-1300.479] (-1301.278) * [-1300.240] (-1300.298) (-1298.012) (-1298.553) -- 0:00:00 988500 -- [-1298.555] (-1298.396) (-1300.720) (-1298.583) * (-1297.652) (-1300.076) [-1297.559] (-1298.767) -- 0:00:00 989000 -- (-1299.388) (-1297.931) (-1304.552) [-1299.461] * [-1300.300] (-1300.387) (-1300.999) (-1306.222) -- 0:00:00 989500 -- (-1298.814) (-1301.106) [-1301.002] (-1298.912) * (-1298.645) [-1298.281] (-1300.016) (-1299.784) -- 0:00:00 990000 -- (-1302.195) (-1301.745) [-1299.977] (-1298.678) * (-1297.675) [-1298.333] (-1301.051) (-1297.586) -- 0:00:00 Average standard deviation of split frequencies: 0.009785 990500 -- (-1299.467) (-1299.770) (-1304.015) [-1298.734] * [-1299.762] (-1302.307) (-1301.201) (-1298.024) -- 0:00:00 991000 -- [-1301.936] (-1299.722) (-1299.058) (-1300.618) * (-1298.974) [-1301.869] (-1299.756) (-1297.509) -- 0:00:00 991500 -- [-1299.599] (-1301.031) (-1303.783) (-1299.487) * (-1299.022) (-1297.426) (-1299.526) [-1298.154] -- 0:00:00 992000 -- [-1297.134] (-1300.455) (-1299.178) (-1298.883) * [-1298.786] (-1298.402) (-1299.067) (-1299.676) -- 0:00:00 992500 -- (-1297.134) [-1299.509] (-1298.771) (-1304.613) * (-1297.794) [-1297.957] (-1298.732) (-1300.382) -- 0:00:00 993000 -- [-1297.112] (-1299.762) (-1299.798) (-1298.386) * (-1300.058) (-1299.445) [-1301.415] (-1298.608) -- 0:00:00 993500 -- (-1296.960) (-1300.635) [-1299.434] (-1297.184) * [-1299.792] (-1300.757) (-1306.983) (-1298.604) -- 0:00:00 994000 -- (-1296.913) [-1300.129] (-1300.479) (-1297.669) * [-1298.687] (-1301.524) (-1300.814) (-1304.918) -- 0:00:00 994500 -- [-1297.019] (-1297.885) (-1299.259) (-1300.560) * (-1297.165) (-1301.081) [-1298.934] (-1302.543) -- 0:00:00 995000 -- (-1299.679) [-1298.675] (-1298.623) (-1299.905) * (-1298.095) [-1298.736] (-1301.010) (-1297.656) -- 0:00:00 Average standard deviation of split frequencies: 0.009327 995500 -- (-1297.230) (-1302.784) [-1298.943] (-1298.027) * (-1298.561) (-1298.297) [-1299.044] (-1300.922) -- 0:00:00 996000 -- (-1297.313) (-1303.046) (-1299.099) [-1299.690] * (-1299.743) [-1300.567] (-1301.252) (-1303.402) -- 0:00:00 996500 -- (-1298.476) (-1298.261) [-1299.460] (-1299.252) * (-1300.280) [-1298.930] (-1300.205) (-1300.990) -- 0:00:00 997000 -- (-1297.975) (-1298.873) [-1299.019] (-1300.542) * (-1299.536) (-1299.223) [-1298.217] (-1300.085) -- 0:00:00 997500 -- (-1298.524) (-1300.150) (-1298.739) [-1301.304] * (-1299.535) (-1301.142) (-1299.237) [-1301.529] -- 0:00:00 998000 -- [-1300.429] (-1298.882) (-1300.378) (-1298.574) * (-1298.438) (-1302.520) (-1298.445) [-1299.182] -- 0:00:00 998500 -- (-1300.522) (-1297.090) (-1301.884) [-1298.234] * [-1302.703] (-1301.240) (-1298.649) (-1301.253) -- 0:00:00 999000 -- [-1300.134] (-1297.978) (-1302.386) (-1297.304) * (-1299.532) (-1308.320) [-1297.307] (-1304.449) -- 0:00:00 999500 -- [-1300.931] (-1299.132) (-1304.437) (-1299.182) * (-1298.541) (-1298.045) [-1298.622] (-1298.716) -- 0:00:00 1000000 -- [-1300.122] (-1301.049) (-1299.364) (-1297.919) * (-1299.981) [-1299.846] (-1300.810) (-1305.793) -- 0:00:00 Average standard deviation of split frequencies: 0.009893 Analysis completed in 1 mins 3 seconds Analysis used 62.33 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1296.83 Likelihood of best state for "cold" chain of run 2 was -1296.83 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.0 % ( 76 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.8 % ( 24 %) Dirichlet(Pi{all}) 27.9 % ( 25 %) Slider(Pi{all}) 78.7 % ( 56 %) Multiplier(Alpha{1,2}) 77.3 % ( 55 %) Multiplier(Alpha{3}) 18.2 % ( 17 %) Slider(Pinvar{all}) 98.6 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.4 % ( 88 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 23 %) Multiplier(V{all}) 97.5 % ( 94 %) Nodeslider(V{all}) 30.4 % ( 20 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.6 % ( 74 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.0 % ( 23 %) Dirichlet(Pi{all}) 27.9 % ( 26 %) Slider(Pi{all}) 79.3 % ( 54 %) Multiplier(Alpha{1,2}) 77.5 % ( 53 %) Multiplier(Alpha{3}) 18.9 % ( 33 %) Slider(Pinvar{all}) 98.7 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 64 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.6 % ( 87 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 27 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.6 % ( 28 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166210 0.82 0.67 3 | 166722 166228 0.84 4 | 166462 167546 166832 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166636 0.82 0.67 3 | 166837 166530 0.84 4 | 167124 167085 165788 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1298.45 | 1 2 | | | | | | 2 1 1 2 1 | | 22 1 1 1 2 11 2 | | 1 1 2 2 1 * 2 1 1 1 1 | | 2 2 12 22 *21 2 1 2 | |1 1 1 21 2 2 2 1* * 1 212 2| | 121 1 211 12 2* 2 2 21*1 1 2 1 1| | 2 2 2 21 12 1 1 1 2 2 1 2 1 | | 1 2 1 2 1 1 1 1 | |2 1 2 2 1 2 2 | | 1 | | 2 2 2 2 | | 2 1 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1300.19 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1298.59 -1302.21 2 -1298.60 -1302.37 -------------------------------------- TOTAL -1298.60 -1302.30 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.890307 0.086857 0.353797 1.463774 0.860875 1411.34 1456.17 1.000 r(A<->C){all} 0.168782 0.020702 0.000004 0.457504 0.131405 258.05 281.30 1.004 r(A<->G){all} 0.161899 0.018213 0.000023 0.435417 0.126509 313.61 362.39 1.000 r(A<->T){all} 0.167996 0.021641 0.000031 0.469807 0.126515 144.72 210.87 1.016 r(C<->G){all} 0.169573 0.020031 0.000018 0.454038 0.135228 246.29 253.81 1.026 r(C<->T){all} 0.171178 0.020364 0.000001 0.453531 0.136769 112.42 169.54 1.006 r(G<->T){all} 0.160572 0.019233 0.000189 0.443232 0.125355 149.01 169.82 1.000 pi(A){all} 0.194895 0.000168 0.168027 0.218265 0.194667 1230.80 1365.90 1.000 pi(C){all} 0.296325 0.000223 0.265570 0.323945 0.296177 971.08 1074.05 1.000 pi(G){all} 0.308530 0.000224 0.277460 0.335232 0.308663 1313.46 1333.41 1.000 pi(T){all} 0.200249 0.000169 0.173838 0.224891 0.200536 1141.40 1269.16 1.000 alpha{1,2} 0.418368 0.228368 0.000103 1.398596 0.258876 1064.62 1161.81 1.000 alpha{3} 0.457350 0.236499 0.000155 1.396338 0.301567 1084.45 1133.53 1.000 pinvar{all} 0.998405 0.000003 0.994945 0.999998 0.998992 1203.38 1332.76 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .**... 8 -- .**.** 9 -- .****. 10 -- ...*.* 11 -- .***.* 12 -- ...**. 13 -- ..*.*. 14 -- ..**.. 15 -- .*.*.. 16 -- .*...* 17 -- .*.*** 18 -- .*..*. 19 -- ..**** 20 -- ..*..* 21 -- ....** 22 -- .**..* ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 502 0.167222 0.004711 0.163891 0.170553 2 8 455 0.151566 0.010835 0.143904 0.159227 2 9 449 0.149567 0.014604 0.139241 0.159893 2 10 439 0.146236 0.013662 0.136576 0.155896 2 11 438 0.145903 0.002827 0.143904 0.147901 2 12 434 0.144570 0.012248 0.135909 0.153231 2 13 425 0.141572 0.016488 0.129913 0.153231 2 14 424 0.141239 0.003769 0.138574 0.143904 2 15 422 0.140573 0.004711 0.137242 0.143904 2 16 421 0.140240 0.016488 0.128581 0.151899 2 17 418 0.139241 0.016017 0.127915 0.150566 2 18 409 0.136243 0.021199 0.121252 0.151233 2 19 401 0.133578 0.009893 0.126582 0.140573 2 20 400 0.133245 0.000942 0.132578 0.133911 2 21 391 0.130247 0.004240 0.127249 0.133245 2 22 298 0.099267 0.005653 0.095270 0.103264 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.098576 0.009768 0.000024 0.295725 0.067550 1.000 2 length{all}[2] 0.096210 0.009634 0.000020 0.289073 0.064535 1.000 2 length{all}[3] 0.099577 0.009660 0.000030 0.291303 0.070874 1.000 2 length{all}[4] 0.103484 0.010966 0.000031 0.321324 0.070043 1.000 2 length{all}[5] 0.098545 0.009711 0.000014 0.282476 0.067825 1.000 2 length{all}[6] 0.099667 0.010051 0.000003 0.300563 0.069378 1.001 2 length{all}[7] 0.097527 0.010002 0.000011 0.293267 0.068365 1.000 2 length{all}[8] 0.103120 0.009087 0.000614 0.298547 0.072945 1.000 2 length{all}[9] 0.094528 0.008677 0.000025 0.273669 0.067482 0.998 2 length{all}[10] 0.101582 0.009730 0.000738 0.302519 0.068011 0.998 2 length{all}[11] 0.096026 0.008595 0.000101 0.279746 0.065016 1.000 2 length{all}[12] 0.103128 0.011635 0.000004 0.312874 0.065729 1.002 2 length{all}[13] 0.100202 0.009646 0.000124 0.297865 0.068199 0.998 2 length{all}[14] 0.095585 0.010411 0.000090 0.302308 0.058921 0.998 2 length{all}[15] 0.100440 0.010492 0.000266 0.311340 0.066792 1.001 2 length{all}[16] 0.090555 0.007223 0.000079 0.257030 0.065886 0.998 2 length{all}[17] 0.093026 0.009014 0.000382 0.275211 0.063224 0.999 2 length{all}[18] 0.098967 0.010383 0.000127 0.296579 0.063009 1.009 2 length{all}[19] 0.094456 0.009865 0.000206 0.315295 0.059352 0.998 2 length{all}[20] 0.093093 0.009445 0.000144 0.264596 0.064635 1.002 2 length{all}[21] 0.107206 0.011948 0.000458 0.309976 0.078139 0.998 2 length{all}[22] 0.102128 0.009204 0.000051 0.290043 0.072596 0.999 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.009893 Maximum standard deviation of split frequencies = 0.021199 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.009 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /--------------------------------------------------------------------- C1 (1) | |------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |----------------------------------------------------------------------- C4 (4) | |--------------------------------------------------------------------- C5 (5) | \---------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 45 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 951 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 54 patterns at 317 / 317 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 54 patterns at 317 / 317 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 52704 bytes for conP 4752 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.090252 0.024568 0.095252 0.086475 0.027466 0.068733 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1368.734088 Iterating by ming2 Initial: fx= 1368.734088 x= 0.09025 0.02457 0.09525 0.08647 0.02747 0.06873 0.30000 1.30000 1 h-m-p 0.0000 0.0001 758.6962 ++ 1323.325108 m 0.0001 13 | 1/8 2 h-m-p 0.0007 0.0034 70.5364 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 694.6724 ++ 1318.840112 m 0.0000 44 | 2/8 4 h-m-p 0.0001 0.0061 54.6713 ----------.. | 2/8 5 h-m-p 0.0000 0.0001 620.3323 ++ 1267.343838 m 0.0001 74 | 3/8 6 h-m-p 0.0018 0.0092 37.7130 ------------.. | 3/8 7 h-m-p 0.0000 0.0001 540.7800 ++ 1250.498805 m 0.0001 106 | 4/8 8 h-m-p 0.0014 0.0252 18.7145 -----------.. | 4/8 9 h-m-p 0.0000 0.0000 442.8217 ++ 1248.095342 m 0.0000 137 | 5/8 10 h-m-p 0.0004 0.0622 10.8471 ----------.. | 5/8 11 h-m-p 0.0000 0.0000 313.1959 ++ 1246.502129 m 0.0000 167 | 6/8 12 h-m-p 0.1144 8.0000 0.0000 Y 1246.502129 0 0.2461 178 | 6/8 13 h-m-p 0.6472 8.0000 0.0000 ------------Y 1246.502129 0 0.0000 203 Out.. lnL = -1246.502129 204 lfun, 204 eigenQcodon, 1224 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.025594 0.093065 0.043770 0.083655 0.064181 0.047745 0.299908 0.845217 0.358049 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 12.521871 np = 9 lnL0 = -1356.507056 Iterating by ming2 Initial: fx= 1356.507056 x= 0.02559 0.09307 0.04377 0.08365 0.06418 0.04774 0.29991 0.84522 0.35805 1 h-m-p 0.0000 0.0001 737.3620 ++ 1310.245438 m 0.0001 14 | 1/9 2 h-m-p 0.0000 0.0001 525.1401 ++ 1282.045812 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0000 258564.9244 ++ 1277.132458 m 0.0000 38 | 3/9 4 h-m-p 0.0000 0.0001 1816.3354 ++ 1261.262977 m 0.0001 50 | 4/9 5 h-m-p 0.0000 0.0000 109168.1603 ++ 1249.271423 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0001 1371.5126 ++ 1246.502162 m 0.0001 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0001 ++ 1246.502162 m 8.0000 86 | 6/9 8 h-m-p 0.0013 0.0734 0.6787 ---------Y 1246.502162 0 0.0000 110 | 6/9 9 h-m-p 0.0160 8.0000 0.0007 +++++ 1246.502162 m 8.0000 128 | 6/9 10 h-m-p 0.0184 2.2403 0.3013 ++++ 1246.502131 m 2.2403 145 | 7/9 11 h-m-p 0.0857 0.4287 0.0830 ++ 1246.502131 m 0.4287 160 | 8/9 12 h-m-p 1.0000 8.0000 0.0202 -C 1246.502131 0 0.0625 175 | 8/9 13 h-m-p 0.0008 0.4222 1.8322 ---Y 1246.502131 0 0.0000 191 | 8/9 14 h-m-p 1.6000 8.0000 0.0000 Y 1246.502131 0 1.6000 203 | 8/9 15 h-m-p 0.0160 8.0000 0.0000 Y 1246.502131 0 0.0160 216 Out.. lnL = -1246.502131 217 lfun, 651 eigenQcodon, 2604 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.046825 0.080584 0.088352 0.095646 0.010801 0.065210 0.000100 1.455597 0.315076 0.171890 1.391353 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 13.337419 np = 11 lnL0 = -1358.490924 Iterating by ming2 Initial: fx= 1358.490924 x= 0.04683 0.08058 0.08835 0.09565 0.01080 0.06521 0.00011 1.45560 0.31508 0.17189 1.39135 1 h-m-p 0.0000 0.0000 656.8686 ++ 1357.864818 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0001 476.4768 ++ 1339.722353 m 0.0001 30 | 2/11 3 h-m-p 0.0001 0.0004 164.2175 ++ 1298.602109 m 0.0004 44 | 3/11 4 h-m-p 0.0006 0.0032 61.7193 ++ 1276.006105 m 0.0032 58 | 4/11 5 h-m-p 0.0003 0.0017 54.4403 ++ 1272.233967 m 0.0017 72 | 5/11 6 h-m-p 0.0000 0.0001 351.7290 ++ 1260.291480 m 0.0001 86 | 6/11 7 h-m-p 0.0003 0.0015 32.5991 ++ 1260.003725 m 0.0015 100 | 7/11 8 h-m-p 0.0150 7.5243 21.0468 -------------.. | 7/11 9 h-m-p 0.0000 0.0001 297.7449 ++ 1246.502152 m 0.0001 139 | 8/11 10 h-m-p 1.3934 8.0000 0.0000 ++ 1246.502152 m 8.0000 153 | 8/11 11 h-m-p 0.0160 8.0000 0.0495 +++++ 1246.502145 m 8.0000 173 | 8/11 12 h-m-p 0.2006 8.0000 1.9759 ++Y 1246.502125 0 3.2090 192 | 8/11 13 h-m-p 1.6000 8.0000 0.1975 ++ 1246.502125 m 8.0000 206 | 8/11 14 h-m-p 1.6000 8.0000 0.1863 Y 1246.502125 0 0.6417 223 | 8/11 15 h-m-p 1.6000 8.0000 0.0010 ++ 1246.502125 m 8.0000 240 | 8/11 16 h-m-p 0.0758 8.0000 0.1041 +Y 1246.502125 0 0.2200 258 | 8/11 17 h-m-p 1.6000 8.0000 0.0034 ++ 1246.502125 m 8.0000 275 | 8/11 18 h-m-p 0.1861 8.0000 0.1470 ++Y 1246.502125 0 2.3241 294 | 8/11 19 h-m-p 1.6000 8.0000 0.0175 ++ 1246.502124 m 8.0000 311 | 8/11 20 h-m-p 0.0021 0.1418 65.5373 ++Y 1246.502119 0 0.0563 330 | 8/11 21 h-m-p 1.6000 8.0000 1.0473 ++ 1246.502113 m 8.0000 344 | 8/11 22 h-m-p 1.6000 8.0000 1.7316 ++ 1246.502111 m 8.0000 358 | 8/11 23 h-m-p 1.6000 8.0000 0.6638 ++ 1246.502111 m 8.0000 372 | 8/11 24 h-m-p 0.4158 2.2116 12.7709 ---------C 1246.502111 0 0.0000 398 | 8/11 25 h-m-p 0.0160 8.0000 0.2609 +++++ 1246.502111 m 8.0000 415 | 8/11 26 h-m-p 0.1709 8.0000 12.2157 +Y 1246.502111 0 0.4541 433 | 8/11 27 h-m-p 0.7532 4.2317 7.3651 ---------Y 1246.502111 0 0.0000 456 | 8/11 28 h-m-p 1.6000 8.0000 0.0000 --------------Y 1246.502111 0 0.0000 484 Out.. lnL = -1246.502111 485 lfun, 1940 eigenQcodon, 8730 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1246.495607 S = -1246.494735 -0.000333 Calculating f(w|X), posterior probabilities of site classes. did 10 / 54 patterns 0:04 did 20 / 54 patterns 0:04 did 30 / 54 patterns 0:04 did 40 / 54 patterns 0:04 did 50 / 54 patterns 0:04 did 54 / 54 patterns 0:04 Time used: 0:04 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.027138 0.094598 0.042110 0.095805 0.109227 0.013769 0.000100 0.751047 1.237461 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 16.228217 np = 9 lnL0 = -1361.024561 Iterating by ming2 Initial: fx= 1361.024561 x= 0.02714 0.09460 0.04211 0.09581 0.10923 0.01377 0.00011 0.75105 1.23746 1 h-m-p 0.0000 0.0000 703.4875 ++ 1360.326765 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0048 82.8732 +++++ 1333.834466 m 0.0048 29 | 2/9 3 h-m-p 0.0000 0.0001 213.9087 ++ 1325.449170 m 0.0001 41 | 3/9 4 h-m-p 0.0002 0.0023 104.3805 ++ 1292.863237 m 0.0023 53 | 4/9 5 h-m-p 0.0001 0.0007 273.0265 ++ 1262.562792 m 0.0007 65 | 5/9 6 h-m-p 0.0000 0.0001 515.5005 ++ 1261.257373 m 0.0001 77 | 6/9 7 h-m-p 0.0000 0.0001 658.4451 ++ 1257.565346 m 0.0001 89 | 7/9 8 h-m-p 0.0059 0.5298 2.3390 ------------.. | 7/9 9 h-m-p 0.0000 0.0001 304.4565 ++ 1246.502201 m 0.0001 123 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 N 1246.502201 0 1.6000 135 | 7/9 11 h-m-p 0.0160 8.0000 0.0000 +Y 1246.502201 0 0.1979 149 QuantileBeta(0.15, 0.00494, 1.05986) = 3.769077e-162 2000 rounds | 7/9 12 h-m-p 0.0443 0.2213 0.0000 ---Y 1246.502201 0 0.0002 166 Out.. lnL = -1246.502201 167 lfun, 1837 eigenQcodon, 10020 P(t) Time used: 0:06 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.032623 0.043126 0.061752 0.057986 0.082042 0.052529 0.000100 0.900000 0.377949 1.754667 1.300055 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 18.678000 np = 11 lnL0 = -1342.063414 Iterating by ming2 Initial: fx= 1342.063414 x= 0.03262 0.04313 0.06175 0.05799 0.08204 0.05253 0.00011 0.90000 0.37795 1.75467 1.30006 1 h-m-p 0.0000 0.0000 658.3136 ++ 1341.482685 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0005 369.6755 +++ 1286.979323 m 0.0005 31 | 2/11 3 h-m-p 0.0000 0.0000 15429.9657 ++ 1271.425975 m 0.0000 45 | 3/11 4 h-m-p 0.0006 0.0030 51.6466 ++ 1265.324105 m 0.0030 59 | 4/11 5 h-m-p 0.0000 0.0000 7820.1444 ++ 1262.035869 m 0.0000 73 | 5/11 6 h-m-p 0.0000 0.0000 62229.2119 ++ 1260.864692 m 0.0000 87 | 6/11 7 h-m-p 0.0000 0.0000 20051.4825 ++ 1260.856705 m 0.0000 101 | 7/11 8 h-m-p 0.0000 0.0127 27.1185 +++++ 1253.883103 m 0.0127 118 | 7/11 9 h-m-p 0.0000 0.0000 55.9048 h-m-p: 0.00000000e+00 0.00000000e+00 5.59047522e+01 1253.883103 .. | 7/11 10 h-m-p 0.0000 0.0001 308.5006 ++ 1246.502201 m 0.0001 143 | 8/11 11 h-m-p 1.6000 8.0000 0.0000 ++ 1246.502201 m 8.0000 157 | 7/11 12 h-m-p 0.0160 8.0000 0.0267 +++++ 1246.502188 m 8.0000 177 | 7/11 13 h-m-p 0.2560 1.8420 0.8351 ++ 1246.502130 m 1.8420 195 | 8/11 14 h-m-p 1.6000 8.0000 0.0127 ++ 1246.502129 m 8.0000 213 | 8/11 15 h-m-p 1.6000 8.0000 0.0521 ++ 1246.502128 m 8.0000 230 | 8/11 16 h-m-p 0.4982 2.4911 0.0931 +C 1246.502128 0 1.9997 248 | 8/11 17 h-m-p 1.6000 8.0000 0.0003 ++ 1246.502128 m 8.0000 265 | 8/11 18 h-m-p 0.0271 0.5077 0.0844 +++ 1246.502128 m 0.5077 283 | 9/11 19 h-m-p 0.0354 0.8725 0.3513 +++ 1246.502127 m 0.8725 301 | 9/11 20 h-m-p 0.0000 0.0000 2.5024 h-m-p: 3.62352642e-19 1.81176321e-18 2.50241123e+00 1246.502127 .. | 9/11 21 h-m-p 0.0160 8.0000 0.0000 +++++ 1246.502127 m 8.0000 331 | 9/11 22 h-m-p 0.1026 8.0000 0.0010 ++++ 1246.502127 m 8.0000 349 | 9/11 23 h-m-p 0.0160 8.0000 0.8632 +++++ 1246.502113 m 8.0000 368 | 9/11 24 h-m-p 1.6000 8.0000 0.2480 ++ 1246.502112 m 8.0000 384 | 9/11 25 h-m-p 0.5158 8.0000 3.8472 ++ 1246.502110 m 8.0000 400 | 9/11 26 h-m-p 1.1785 5.8924 6.7799 ----------Y 1246.502110 0 0.0000 424 | 9/11 27 h-m-p 0.5714 8.0000 0.0000 ---------Y 1246.502110 0 0.0000 447 | 8/11 28 h-m-p 0.0160 8.0000 0.0003 +++++ 1246.502110 m 8.0000 466 | 8/11 29 h-m-p 0.0013 0.0067 0.3970 -----Y 1246.502110 0 0.0000 488 | 8/11 30 h-m-p 0.0160 8.0000 0.0001 +++++ 1246.502110 m 8.0000 508 | 8/11 31 h-m-p 0.0160 8.0000 0.9843 +++++ 1246.502094 m 8.0000 528 | 8/11 32 h-m-p 0.7197 3.5986 8.9595 +Y 1246.502080 0 1.8174 546 | 8/11 33 h-m-p 0.5803 2.9015 5.5000 Y 1246.502079 0 0.5803 560 | 8/11 34 h-m-p 1.6000 8.0000 1.3356 -C 1246.502079 0 0.1058 575 | 8/11 35 h-m-p 1.6000 8.0000 0.0100 Y 1246.502079 0 0.2679 589 | 8/11 36 h-m-p 1.6000 8.0000 0.0002 C 1246.502079 0 1.5000 606 | 8/11 37 h-m-p 1.6000 8.0000 0.0000 Y 1246.502079 0 0.8333 623 | 8/11 38 h-m-p 1.5118 8.0000 0.0000 ---------------Y 1246.502079 0 0.0000 655 Out.. lnL = -1246.502079 656 lfun, 7872 eigenQcodon, 43296 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1246.496511 S = -1246.494831 -0.000735 Calculating f(w|X), posterior probabilities of site classes. did 10 / 54 patterns 0:17 did 20 / 54 patterns 0:18 did 30 / 54 patterns 0:18 did 40 / 54 patterns 0:18 did 50 / 54 patterns 0:18 did 54 / 54 patterns 0:18 Time used: 0:18 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=317 NC_011896_1_WP_010908293_1_1434_MLBR_RS06770 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG NC_002677_1_NP_301972_1_844_ML1362 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG ************************************************** NC_011896_1_WP_010908293_1_1434_MLBR_RS06770 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA NC_002677_1_NP_301972_1_844_ML1362 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA ************************************************** NC_011896_1_WP_010908293_1_1434_MLBR_RS06770 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK NC_002677_1_NP_301972_1_844_ML1362 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK ************************************************** NC_011896_1_WP_010908293_1_1434_MLBR_RS06770 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NC_002677_1_NP_301972_1_844_ML1362 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY ************************************************** NC_011896_1_WP_010908293_1_1434_MLBR_RS06770 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR NC_002677_1_NP_301972_1_844_ML1362 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR ************************************************** NC_011896_1_WP_010908293_1_1434_MLBR_RS06770 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH NC_002677_1_NP_301972_1_844_ML1362 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH ************************************************** NC_011896_1_WP_010908293_1_1434_MLBR_RS06770 TGQYGVGHGATSITVPQ NC_002677_1_NP_301972_1_844_ML1362 TGQYGVGHGATSITVPQ NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410 TGQYGVGHGATSITVPQ NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420 TGQYGVGHGATSITVPQ NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410 TGQYGVGHGATSITVPQ NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 TGQYGVGHGATSITVPQ *****************
>NC_011896_1_WP_010908293_1_1434_MLBR_RS06770 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G >NC_002677_1_NP_301972_1_844_ML1362 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G >NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G >NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G >NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G >NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA G
>NC_011896_1_WP_010908293_1_1434_MLBR_RS06770 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >NC_002677_1_NP_301972_1_844_ML1362 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ >NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH TGQYGVGHGATSITVPQ
#NEXUS [ID: 5273140855] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908293_1_1434_MLBR_RS06770 NC_002677_1_NP_301972_1_844_ML1362 NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410 NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420 NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410 NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 ; end; begin trees; translate 1 NC_011896_1_WP_010908293_1_1434_MLBR_RS06770, 2 NC_002677_1_NP_301972_1_844_ML1362, 3 NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410, 4 NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420, 5 NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410, 6 NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06754954,2:0.06453489,3:0.07087381,4:0.07004318,5:0.06782497,6:0.06937817); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06754954,2:0.06453489,3:0.07087381,4:0.07004318,5:0.06782497,6:0.06937817); end;
Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1298.59 -1302.21 2 -1298.60 -1302.37 -------------------------------------- TOTAL -1298.60 -1302.30 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.890307 0.086857 0.353797 1.463774 0.860875 1411.34 1456.17 1.000 r(A<->C){all} 0.168782 0.020702 0.000004 0.457504 0.131405 258.05 281.30 1.004 r(A<->G){all} 0.161899 0.018213 0.000023 0.435417 0.126509 313.61 362.39 1.000 r(A<->T){all} 0.167996 0.021641 0.000031 0.469807 0.126515 144.72 210.87 1.016 r(C<->G){all} 0.169573 0.020031 0.000018 0.454038 0.135228 246.29 253.81 1.026 r(C<->T){all} 0.171178 0.020364 0.000001 0.453531 0.136769 112.42 169.54 1.006 r(G<->T){all} 0.160572 0.019233 0.000189 0.443232 0.125355 149.01 169.82 1.000 pi(A){all} 0.194895 0.000168 0.168027 0.218265 0.194667 1230.80 1365.90 1.000 pi(C){all} 0.296325 0.000223 0.265570 0.323945 0.296177 971.08 1074.05 1.000 pi(G){all} 0.308530 0.000224 0.277460 0.335232 0.308663 1313.46 1333.41 1.000 pi(T){all} 0.200249 0.000169 0.173838 0.224891 0.200536 1141.40 1269.16 1.000 alpha{1,2} 0.418368 0.228368 0.000103 1.398596 0.258876 1064.62 1161.81 1.000 alpha{3} 0.457350 0.236499 0.000155 1.396338 0.301567 1084.45 1133.53 1.000 pinvar{all} 0.998405 0.000003 0.994945 0.999998 0.998992 1203.38 1332.76 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1362/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 317 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 3 3 3 3 3 3 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0 TTC 5 5 5 5 5 5 | TCC 5 5 5 5 5 5 | TAC 4 4 4 4 4 4 | TGC 0 0 0 0 0 0 Leu TTA 2 2 2 2 2 2 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 8 8 8 8 8 8 | TCG 9 9 9 9 9 9 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 3 3 3 3 3 3 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 2 2 2 2 2 2 CTC 4 4 4 4 4 4 | CCC 3 3 3 3 3 3 | CAC 4 4 4 4 4 4 | CGC 5 5 5 5 5 5 CTA 6 6 6 6 6 6 | CCA 1 1 1 1 1 1 | Gln CAA 4 4 4 4 4 4 | CGA 1 1 1 1 1 1 CTG 14 14 14 14 14 14 | CCG 3 3 3 3 3 3 | CAG 11 11 11 11 11 11 | CGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 2 2 2 2 2 2 | Thr ACT 3 3 3 3 3 3 | Asn AAT 6 6 6 6 6 6 | Ser AGT 5 5 5 5 5 5 ATC 10 10 10 10 10 10 | ACC 11 11 11 11 11 11 | AAC 10 10 10 10 10 10 | AGC 4 4 4 4 4 4 ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0 Met ATG 3 3 3 3 3 3 | ACG 8 8 8 8 8 8 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 1 1 1 1 1 1 | Ala GCT 8 8 8 8 8 8 | Asp GAT 11 11 11 11 11 11 | Gly GGT 8 8 8 8 8 8 GTC 19 19 19 19 19 19 | GCC 16 16 16 16 16 16 | GAC 11 11 11 11 11 11 | GGC 12 12 12 12 12 12 GTA 2 2 2 2 2 2 | GCA 7 7 7 7 7 7 | Glu GAA 3 3 3 3 3 3 | GGA 6 6 6 6 6 6 GTG 13 13 13 13 13 13 | GCG 10 10 10 10 10 10 | GAG 2 2 2 2 2 2 | GGG 9 9 9 9 9 9 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908293_1_1434_MLBR_RS06770 position 1: T:0.11987 C:0.22082 A:0.22397 G:0.43533 position 2: T:0.29968 C:0.28076 A:0.23975 G:0.17981 position 3: T:0.17981 C:0.38801 A:0.11987 G:0.31230 Average T:0.19979 C:0.29653 A:0.19453 G:0.30915 #2: NC_002677_1_NP_301972_1_844_ML1362 position 1: T:0.11987 C:0.22082 A:0.22397 G:0.43533 position 2: T:0.29968 C:0.28076 A:0.23975 G:0.17981 position 3: T:0.17981 C:0.38801 A:0.11987 G:0.31230 Average T:0.19979 C:0.29653 A:0.19453 G:0.30915 #3: NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410 position 1: T:0.11987 C:0.22082 A:0.22397 G:0.43533 position 2: T:0.29968 C:0.28076 A:0.23975 G:0.17981 position 3: T:0.17981 C:0.38801 A:0.11987 G:0.31230 Average T:0.19979 C:0.29653 A:0.19453 G:0.30915 #4: NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420 position 1: T:0.11987 C:0.22082 A:0.22397 G:0.43533 position 2: T:0.29968 C:0.28076 A:0.23975 G:0.17981 position 3: T:0.17981 C:0.38801 A:0.11987 G:0.31230 Average T:0.19979 C:0.29653 A:0.19453 G:0.30915 #5: NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410 position 1: T:0.11987 C:0.22082 A:0.22397 G:0.43533 position 2: T:0.29968 C:0.28076 A:0.23975 G:0.17981 position 3: T:0.17981 C:0.38801 A:0.11987 G:0.31230 Average T:0.19979 C:0.29653 A:0.19453 G:0.30915 #6: NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575 position 1: T:0.11987 C:0.22082 A:0.22397 G:0.43533 position 2: T:0.29968 C:0.28076 A:0.23975 G:0.17981 position 3: T:0.17981 C:0.38801 A:0.11987 G:0.31230 Average T:0.19979 C:0.29653 A:0.19453 G:0.30915 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 18 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0 TTC 30 | TCC 30 | TAC 24 | TGC 0 Leu L TTA 12 | TCA 6 | *** * TAA 0 | *** * TGA 0 TTG 48 | TCG 54 | TAG 0 | Trp W TGG 0 ------------------------------------------------------------------------------ Leu L CTT 18 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 12 CTC 24 | CCC 18 | CAC 24 | CGC 30 CTA 36 | CCA 6 | Gln Q CAA 24 | CGA 6 CTG 84 | CCG 18 | CAG 66 | CGG 30 ------------------------------------------------------------------------------ Ile I ATT 12 | Thr T ACT 18 | Asn N AAT 36 | Ser S AGT 30 ATC 60 | ACC 66 | AAC 60 | AGC 24 ATA 0 | ACA 12 | Lys K AAA 18 | Arg R AGA 0 Met M ATG 18 | ACG 48 | AAG 24 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 6 | Ala A GCT 48 | Asp D GAT 66 | Gly G GGT 48 GTC 114 | GCC 96 | GAC 66 | GGC 72 GTA 12 | GCA 42 | Glu E GAA 18 | GGA 36 GTG 78 | GCG 60 | GAG 12 | GGG 54 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.11987 C:0.22082 A:0.22397 G:0.43533 position 2: T:0.29968 C:0.28076 A:0.23975 G:0.17981 position 3: T:0.17981 C:0.38801 A:0.11987 G:0.31230 Average T:0.19979 C:0.29653 A:0.19453 G:0.30915 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1246.502129 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299908 1.300055 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908293_1_1434_MLBR_RS06770: 0.000004, NC_002677_1_NP_301972_1_844_ML1362: 0.000004, NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410: 0.000004, NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420: 0.000004, NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410: 0.000004, NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29991 omega (dN/dS) = 1.30006 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 719.2 231.8 1.3001 0.0000 0.0000 0.0 0.0 7..2 0.000 719.2 231.8 1.3001 0.0000 0.0000 0.0 0.0 7..3 0.000 719.2 231.8 1.3001 0.0000 0.0000 0.0 0.0 7..4 0.000 719.2 231.8 1.3001 0.0000 0.0000 0.0 0.0 7..5 0.000 719.2 231.8 1.3001 0.0000 0.0000 0.0 0.0 7..6 0.000 719.2 231.8 1.3001 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1246.502131 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.226506 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908293_1_1434_MLBR_RS06770: 0.000004, NC_002677_1_NP_301972_1_844_ML1362: 0.000004, NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410: 0.000004, NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420: 0.000004, NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410: 0.000004, NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.00001 0.99999 w: 0.22651 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 726.1 224.9 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 726.1 224.9 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 726.1 224.9 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 726.1 224.9 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 726.1 224.9 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 726.1 224.9 1.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1246.502111 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.026350 0.000001 21.298535 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908293_1_1434_MLBR_RS06770: 0.000004, NC_002677_1_NP_301972_1_844_ML1362: 0.000004, NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410: 0.000004, NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420: 0.000004, NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410: 0.000004, NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.00000 0.02635 0.97365 w: 0.00000 1.00000 21.29853 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 726.1 224.9 20.7637 0.0000 0.0000 0.0 0.0 7..2 0.000 726.1 224.9 20.7637 0.0000 0.0000 0.0 0.0 7..3 0.000 726.1 224.9 20.7637 0.0000 0.0000 0.0 0.0 7..4 0.000 726.1 224.9 20.7637 0.0000 0.0000 0.0 0.0 7..5 0.000 726.1 224.9 20.7637 0.0000 0.0000 0.0 0.0 7..6 0.000 726.1 224.9 20.7637 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908293_1_1434_MLBR_RS06770) Pr(w>1) post mean +- SE for w 1 M 0.974* 20.764 2 I 0.974* 20.764 3 S 0.974* 20.764 4 L 0.974* 20.764 5 R 0.974* 20.764 6 Q 0.974* 20.764 7 H 0.974* 20.764 8 A 0.974* 20.764 9 F 0.974* 20.764 10 S 0.974* 20.764 11 L 0.974* 20.764 12 A 0.974* 20.764 13 A 0.974* 20.764 14 V 0.974* 20.764 15 F 0.974* 20.764 16 L 0.974* 20.764 17 A 0.974* 20.764 18 L 0.974* 20.764 19 A 0.974* 20.764 20 V 0.974* 20.764 21 G 0.974* 20.764 22 V 0.974* 20.764 23 V 0.974* 20.764 24 L 0.974* 20.764 25 G 0.974* 20.764 26 S 0.974* 20.764 27 G 0.974* 20.764 28 F 0.974* 20.764 29 L 0.974* 20.764 30 S 0.974* 20.764 31 D 0.974* 20.764 32 T 0.974* 20.764 33 L 0.974* 20.764 34 L 0.974* 20.764 35 S 0.974* 20.764 36 S 0.974* 20.764 37 L 0.974* 20.764 38 R 0.974* 20.764 39 D 0.974* 20.764 40 E 0.974* 20.764 41 K 0.974* 20.764 42 R 0.974* 20.764 43 D 0.974* 20.764 44 L 0.974* 20.764 45 Y 0.974* 20.764 46 T 0.974* 20.764 47 Q 0.974* 20.764 48 I 0.974* 20.764 49 S 0.974* 20.764 50 G 0.974* 20.764 51 L 0.974* 20.764 52 N 0.974* 20.764 53 D 0.974* 20.764 54 Q 0.974* 20.764 55 K 0.974* 20.764 56 N 0.974* 20.764 57 M 0.974* 20.764 58 L 0.974* 20.764 59 N 0.974* 20.764 60 E 0.974* 20.764 61 K 0.974* 20.764 62 V 0.974* 20.764 63 S 0.974* 20.764 64 A 0.974* 20.764 65 A 0.974* 20.764 66 N 0.974* 20.764 67 N 0.974* 20.764 68 F 0.974* 20.764 69 D 0.974* 20.764 70 N 0.974* 20.764 71 Q 0.974* 20.764 72 L 0.974* 20.764 73 L 0.974* 20.764 74 G 0.974* 20.764 75 R 0.974* 20.764 76 I 0.974* 20.764 77 V 0.974* 20.764 78 H 0.974* 20.764 79 D 0.974* 20.764 80 V 0.974* 20.764 81 L 0.974* 20.764 82 G 0.974* 20.764 83 G 0.974* 20.764 84 T 0.974* 20.764 85 S 0.974* 20.764 86 V 0.974* 20.764 87 V 0.974* 20.764 88 V 0.974* 20.764 89 F 0.974* 20.764 90 R 0.974* 20.764 91 T 0.974* 20.764 92 P 0.974* 20.764 93 D 0.974* 20.764 94 A 0.974* 20.764 95 K 0.974* 20.764 96 D 0.974* 20.764 97 D 0.974* 20.764 98 D 0.974* 20.764 99 V 0.974* 20.764 100 A 0.974* 20.764 101 A 0.974* 20.764 102 V 0.974* 20.764 103 S 0.974* 20.764 104 K 0.974* 20.764 105 I 0.974* 20.764 106 V 0.974* 20.764 107 V 0.974* 20.764 108 Q 0.974* 20.764 109 A 0.974* 20.764 110 G 0.974* 20.764 111 G 0.974* 20.764 112 T 0.974* 20.764 113 V 0.974* 20.764 114 T 0.974* 20.764 115 G 0.974* 20.764 116 T 0.974* 20.764 117 V 0.974* 20.764 118 S 0.974* 20.764 119 L 0.974* 20.764 120 T 0.974* 20.764 121 Q 0.974* 20.764 122 E 0.974* 20.764 123 F 0.974* 20.764 124 V 0.974* 20.764 125 D 0.974* 20.764 126 A 0.974* 20.764 127 N 0.974* 20.764 128 S 0.974* 20.764 129 T 0.974* 20.764 130 E 0.974* 20.764 131 K 0.974* 20.764 132 L 0.974* 20.764 133 R 0.974* 20.764 134 S 0.974* 20.764 135 V 0.974* 20.764 136 V 0.974* 20.764 137 N 0.974* 20.764 138 S 0.974* 20.764 139 S 0.974* 20.764 140 I 0.974* 20.764 141 L 0.974* 20.764 142 P 0.974* 20.764 143 A 0.974* 20.764 144 G 0.974* 20.764 145 A 0.974* 20.764 146 Q 0.974* 20.764 147 L 0.974* 20.764 148 S 0.974* 20.764 149 T 0.974* 20.764 150 K 0.974* 20.764 151 L 0.974* 20.764 152 V 0.974* 20.764 153 D 0.974* 20.764 154 Q 0.974* 20.764 155 G 0.974* 20.764 156 S 0.974* 20.764 157 Q 0.974* 20.764 158 A 0.974* 20.764 159 G 0.974* 20.764 160 D 0.974* 20.764 161 L 0.974* 20.764 162 L 0.974* 20.764 163 G 0.974* 20.764 164 I 0.974* 20.764 165 T 0.974* 20.764 166 L 0.974* 20.764 167 L 0.974* 20.764 168 V 0.974* 20.764 169 N 0.974* 20.764 170 A 0.974* 20.764 171 N 0.974* 20.764 172 P 0.974* 20.764 173 A 0.974* 20.764 174 V 0.974* 20.764 175 P 0.974* 20.764 176 N 0.974* 20.764 177 V 0.974* 20.764 178 G 0.974* 20.764 179 D 0.974* 20.764 180 A 0.974* 20.764 181 Q 0.974* 20.764 182 R 0.974* 20.764 183 S 0.974* 20.764 184 T 0.974* 20.764 185 V 0.974* 20.764 186 L 0.974* 20.764 187 V 0.974* 20.764 188 A 0.974* 20.764 189 L 0.974* 20.764 190 R 0.974* 20.764 191 D 0.974* 20.764 192 T 0.974* 20.764 193 G 0.974* 20.764 194 F 0.974* 20.764 195 I 0.974* 20.764 196 T 0.974* 20.764 197 Y 0.974* 20.764 198 Q 0.974* 20.764 199 T 0.974* 20.764 200 Y 0.974* 20.764 201 N 0.974* 20.764 202 R 0.974* 20.764 203 N 0.974* 20.764 204 D 0.974* 20.764 205 H 0.974* 20.764 206 L 0.974* 20.764 207 G 0.974* 20.764 208 A 0.974* 20.764 209 A 0.974* 20.764 210 N 0.974* 20.764 211 A 0.974* 20.764 212 A 0.974* 20.764 213 L 0.974* 20.764 214 V 0.974* 20.764 215 I 0.974* 20.764 216 T 0.974* 20.764 217 G 0.974* 20.764 218 G 0.974* 20.764 219 L 0.974* 20.764 220 L 0.974* 20.764 221 P 0.974* 20.764 222 Q 0.974* 20.764 223 D 0.974* 20.764 224 A 0.974* 20.764 225 G 0.974* 20.764 226 N 0.974* 20.764 227 Q 0.974* 20.764 228 G 0.974* 20.764 229 V 0.974* 20.764 230 S 0.974* 20.764 231 V 0.974* 20.764 232 A 0.974* 20.764 233 R 0.974* 20.764 234 F 0.974* 20.764 235 S 0.974* 20.764 236 A 0.974* 20.764 237 A 0.974* 20.764 238 L 0.974* 20.764 239 A 0.974* 20.764 240 P 0.974* 20.764 241 H 0.974* 20.764 242 G 0.974* 20.764 243 S 0.974* 20.764 244 G 0.974* 20.764 245 T 0.974* 20.764 246 L 0.974* 20.764 247 L 0.974* 20.764 248 A 0.974* 20.764 249 G 0.974* 20.764 250 R 0.974* 20.764 251 D 0.974* 20.764 252 G 0.974* 20.764 253 S 0.974* 20.764 254 A 0.974* 20.764 255 T 0.974* 20.764 256 G 0.974* 20.764 257 V 0.974* 20.764 258 A 0.974* 20.764 259 A 0.974* 20.764 260 V 0.974* 20.764 261 A 0.974* 20.764 262 V 0.974* 20.764 263 A 0.974* 20.764 264 R 0.974* 20.764 265 A 0.974* 20.764 266 D 0.974* 20.764 267 A 0.974* 20.764 268 G 0.974* 20.764 269 M 0.974* 20.764 270 A 0.974* 20.764 271 A 0.974* 20.764 272 T 0.974* 20.764 273 I 0.974* 20.764 274 S 0.974* 20.764 275 T 0.974* 20.764 276 V 0.974* 20.764 277 D 0.974* 20.764 278 N 0.974* 20.764 279 V 0.974* 20.764 280 D 0.974* 20.764 281 A 0.974* 20.764 282 E 0.974* 20.764 283 P 0.974* 20.764 284 G 0.974* 20.764 285 R 0.974* 20.764 286 I 0.974* 20.764 287 T 0.974* 20.764 288 A 0.974* 20.764 289 I 0.974* 20.764 290 L 0.974* 20.764 291 G 0.974* 20.764 292 L 0.974* 20.764 293 H 0.974* 20.764 294 D 0.974* 20.764 295 L 0.974* 20.764 296 L 0.974* 20.764 297 S 0.974* 20.764 298 G 0.974* 20.764 299 G 0.974* 20.764 300 H 0.974* 20.764 301 T 0.974* 20.764 302 G 0.974* 20.764 303 Q 0.974* 20.764 304 Y 0.974* 20.764 305 G 0.974* 20.764 306 V 0.974* 20.764 307 G 0.974* 20.764 308 H 0.974* 20.764 309 G 0.974* 20.764 310 A 0.974* 20.764 311 T 0.974* 20.764 312 S 0.974* 20.764 313 I 0.974* 20.764 314 T 0.974* 20.764 315 V 0.974* 20.764 316 P 0.974* 20.764 317 Q 0.974* 20.764 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908293_1_1434_MLBR_RS06770) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:04 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1246.502201 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.059859 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908293_1_1434_MLBR_RS06770: 0.000004, NC_002677_1_NP_301972_1_844_ML1362: 0.000004, NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410: 0.000004, NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420: 0.000004, NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410: 0.000004, NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.05986 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 726.1 224.9 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 726.1 224.9 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 726.1 224.9 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 726.1 224.9 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 726.1 224.9 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 726.1 224.9 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:06 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1246.502079 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 2.497637 0.000010 0.005000 0.005000 13.850682 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908293_1_1434_MLBR_RS06770: 0.000004, NC_002677_1_NP_301972_1_844_ML1362: 0.000004, NZ_LVXE01000016_1_WP_010908293_1_583_A3216_RS06410: 0.000004, NZ_LYPH01000019_1_WP_010908293_1_722_A8144_RS03420: 0.000004, NZ_CP029543_1_WP_010908293_1_1455_DIJ64_RS07410: 0.000004, NZ_AP014567_1_WP_010908293_1_1488_JK2ML_RS07575: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 2.49764 Parameters in M8 (beta&w>1): p0 = 0.00001 p = 0.00500 q = 0.00500 (p1 = 0.99999) w = 13.85068 MLEs of dN/dS (w) for site classes (K=11) p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999 w: 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000 1.00000 1.00000 1.00000 1.00000 13.85068 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 696.6 254.4 13.8505 0.0000 0.0000 0.0 0.0 7..2 0.000 696.6 254.4 13.8505 0.0000 0.0000 0.0 0.0 7..3 0.000 696.6 254.4 13.8505 0.0000 0.0000 0.0 0.0 7..4 0.000 696.6 254.4 13.8505 0.0000 0.0000 0.0 0.0 7..5 0.000 696.6 254.4 13.8505 0.0000 0.0000 0.0 0.0 7..6 0.000 696.6 254.4 13.8505 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908293_1_1434_MLBR_RS06770) Pr(w>1) post mean +- SE for w 1 M 1.000** 13.851 2 I 1.000** 13.851 3 S 1.000** 13.851 4 L 1.000** 13.851 5 R 1.000** 13.851 6 Q 1.000** 13.851 7 H 1.000** 13.851 8 A 1.000** 13.851 9 F 1.000** 13.851 10 S 1.000** 13.851 11 L 1.000** 13.851 12 A 1.000** 13.851 13 A 1.000** 13.851 14 V 1.000** 13.851 15 F 1.000** 13.851 16 L 1.000** 13.851 17 A 1.000** 13.851 18 L 1.000** 13.851 19 A 1.000** 13.851 20 V 1.000** 13.851 21 G 1.000** 13.851 22 V 1.000** 13.851 23 V 1.000** 13.851 24 L 1.000** 13.851 25 G 1.000** 13.851 26 S 1.000** 13.851 27 G 1.000** 13.851 28 F 1.000** 13.851 29 L 1.000** 13.851 30 S 1.000** 13.851 31 D 1.000** 13.851 32 T 1.000** 13.851 33 L 1.000** 13.851 34 L 1.000** 13.851 35 S 1.000** 13.851 36 S 1.000** 13.851 37 L 1.000** 13.851 38 R 1.000** 13.851 39 D 1.000** 13.851 40 E 1.000** 13.851 41 K 1.000** 13.851 42 R 1.000** 13.851 43 D 1.000** 13.851 44 L 1.000** 13.851 45 Y 1.000** 13.851 46 T 1.000** 13.851 47 Q 1.000** 13.851 48 I 1.000** 13.851 49 S 1.000** 13.851 50 G 1.000** 13.851 51 L 1.000** 13.851 52 N 1.000** 13.851 53 D 1.000** 13.851 54 Q 1.000** 13.851 55 K 1.000** 13.851 56 N 1.000** 13.851 57 M 1.000** 13.851 58 L 1.000** 13.851 59 N 1.000** 13.851 60 E 1.000** 13.851 61 K 1.000** 13.851 62 V 1.000** 13.851 63 S 1.000** 13.851 64 A 1.000** 13.851 65 A 1.000** 13.851 66 N 1.000** 13.851 67 N 1.000** 13.851 68 F 1.000** 13.851 69 D 1.000** 13.851 70 N 1.000** 13.851 71 Q 1.000** 13.851 72 L 1.000** 13.851 73 L 1.000** 13.851 74 G 1.000** 13.851 75 R 1.000** 13.851 76 I 1.000** 13.851 77 V 1.000** 13.851 78 H 1.000** 13.851 79 D 1.000** 13.851 80 V 1.000** 13.851 81 L 1.000** 13.851 82 G 1.000** 13.851 83 G 1.000** 13.851 84 T 1.000** 13.851 85 S 1.000** 13.851 86 V 1.000** 13.851 87 V 1.000** 13.851 88 V 1.000** 13.851 89 F 1.000** 13.851 90 R 1.000** 13.851 91 T 1.000** 13.851 92 P 1.000** 13.851 93 D 1.000** 13.851 94 A 1.000** 13.851 95 K 1.000** 13.851 96 D 1.000** 13.851 97 D 1.000** 13.851 98 D 1.000** 13.851 99 V 1.000** 13.851 100 A 1.000** 13.851 101 A 1.000** 13.851 102 V 1.000** 13.851 103 S 1.000** 13.851 104 K 1.000** 13.851 105 I 1.000** 13.851 106 V 1.000** 13.851 107 V 1.000** 13.851 108 Q 1.000** 13.851 109 A 1.000** 13.851 110 G 1.000** 13.851 111 G 1.000** 13.851 112 T 1.000** 13.851 113 V 1.000** 13.851 114 T 1.000** 13.851 115 G 1.000** 13.851 116 T 1.000** 13.851 117 V 1.000** 13.851 118 S 1.000** 13.851 119 L 1.000** 13.851 120 T 1.000** 13.851 121 Q 1.000** 13.851 122 E 1.000** 13.851 123 F 1.000** 13.851 124 V 1.000** 13.851 125 D 1.000** 13.851 126 A 1.000** 13.851 127 N 1.000** 13.851 128 S 1.000** 13.851 129 T 1.000** 13.851 130 E 1.000** 13.851 131 K 1.000** 13.851 132 L 1.000** 13.851 133 R 1.000** 13.851 134 S 1.000** 13.851 135 V 1.000** 13.851 136 V 1.000** 13.851 137 N 1.000** 13.851 138 S 1.000** 13.851 139 S 1.000** 13.851 140 I 1.000** 13.851 141 L 1.000** 13.851 142 P 1.000** 13.851 143 A 1.000** 13.851 144 G 1.000** 13.851 145 A 1.000** 13.851 146 Q 1.000** 13.851 147 L 1.000** 13.851 148 S 1.000** 13.851 149 T 1.000** 13.851 150 K 1.000** 13.851 151 L 1.000** 13.851 152 V 1.000** 13.851 153 D 1.000** 13.851 154 Q 1.000** 13.851 155 G 1.000** 13.851 156 S 1.000** 13.851 157 Q 1.000** 13.851 158 A 1.000** 13.851 159 G 1.000** 13.851 160 D 1.000** 13.851 161 L 1.000** 13.851 162 L 1.000** 13.851 163 G 1.000** 13.851 164 I 1.000** 13.851 165 T 1.000** 13.851 166 L 1.000** 13.851 167 L 1.000** 13.851 168 V 1.000** 13.851 169 N 1.000** 13.851 170 A 1.000** 13.851 171 N 1.000** 13.851 172 P 1.000** 13.851 173 A 1.000** 13.851 174 V 1.000** 13.851 175 P 1.000** 13.851 176 N 1.000** 13.851 177 V 1.000** 13.851 178 G 1.000** 13.851 179 D 1.000** 13.851 180 A 1.000** 13.851 181 Q 1.000** 13.851 182 R 1.000** 13.851 183 S 1.000** 13.851 184 T 1.000** 13.851 185 V 1.000** 13.851 186 L 1.000** 13.851 187 V 1.000** 13.851 188 A 1.000** 13.851 189 L 1.000** 13.851 190 R 1.000** 13.851 191 D 1.000** 13.851 192 T 1.000** 13.851 193 G 1.000** 13.851 194 F 1.000** 13.851 195 I 1.000** 13.851 196 T 1.000** 13.851 197 Y 1.000** 13.851 198 Q 1.000** 13.851 199 T 1.000** 13.851 200 Y 1.000** 13.851 201 N 1.000** 13.851 202 R 1.000** 13.851 203 N 1.000** 13.851 204 D 1.000** 13.851 205 H 1.000** 13.851 206 L 1.000** 13.851 207 G 1.000** 13.851 208 A 1.000** 13.851 209 A 1.000** 13.851 210 N 1.000** 13.851 211 A 1.000** 13.851 212 A 1.000** 13.851 213 L 1.000** 13.851 214 V 1.000** 13.851 215 I 1.000** 13.851 216 T 1.000** 13.851 217 G 1.000** 13.851 218 G 1.000** 13.851 219 L 1.000** 13.851 220 L 1.000** 13.851 221 P 1.000** 13.851 222 Q 1.000** 13.851 223 D 1.000** 13.851 224 A 1.000** 13.851 225 G 1.000** 13.851 226 N 1.000** 13.851 227 Q 1.000** 13.851 228 G 1.000** 13.851 229 V 1.000** 13.851 230 S 1.000** 13.851 231 V 1.000** 13.851 232 A 1.000** 13.851 233 R 1.000** 13.851 234 F 1.000** 13.851 235 S 1.000** 13.851 236 A 1.000** 13.851 237 A 1.000** 13.851 238 L 1.000** 13.851 239 A 1.000** 13.851 240 P 1.000** 13.851 241 H 1.000** 13.851 242 G 1.000** 13.851 243 S 1.000** 13.851 244 G 1.000** 13.851 245 T 1.000** 13.851 246 L 1.000** 13.851 247 L 1.000** 13.851 248 A 1.000** 13.851 249 G 1.000** 13.851 250 R 1.000** 13.851 251 D 1.000** 13.851 252 G 1.000** 13.851 253 S 1.000** 13.851 254 A 1.000** 13.851 255 T 1.000** 13.851 256 G 1.000** 13.851 257 V 1.000** 13.851 258 A 1.000** 13.851 259 A 1.000** 13.851 260 V 1.000** 13.851 261 A 1.000** 13.851 262 V 1.000** 13.851 263 A 1.000** 13.851 264 R 1.000** 13.851 265 A 1.000** 13.851 266 D 1.000** 13.851 267 A 1.000** 13.851 268 G 1.000** 13.851 269 M 1.000** 13.851 270 A 1.000** 13.851 271 A 1.000** 13.851 272 T 1.000** 13.851 273 I 1.000** 13.851 274 S 1.000** 13.851 275 T 1.000** 13.851 276 V 1.000** 13.851 277 D 1.000** 13.851 278 N 1.000** 13.851 279 V 1.000** 13.851 280 D 1.000** 13.851 281 A 1.000** 13.851 282 E 1.000** 13.851 283 P 1.000** 13.851 284 G 1.000** 13.851 285 R 1.000** 13.851 286 I 1.000** 13.851 287 T 1.000** 13.851 288 A 1.000** 13.851 289 I 1.000** 13.851 290 L 1.000** 13.851 291 G 1.000** 13.851 292 L 1.000** 13.851 293 H 1.000** 13.851 294 D 1.000** 13.851 295 L 1.000** 13.851 296 L 1.000** 13.851 297 S 1.000** 13.851 298 G 1.000** 13.851 299 G 1.000** 13.851 300 H 1.000** 13.851 301 T 1.000** 13.851 302 G 1.000** 13.851 303 Q 1.000** 13.851 304 Y 1.000** 13.851 305 G 1.000** 13.851 306 V 1.000** 13.851 307 G 1.000** 13.851 308 H 1.000** 13.851 309 G 1.000** 13.851 310 A 1.000** 13.851 311 T 1.000** 13.851 312 S 1.000** 13.851 313 I 1.000** 13.851 314 T 1.000** 13.851 315 V 1.000** 13.851 316 P 1.000** 13.851 317 Q 1.000** 13.851 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908293_1_1434_MLBR_RS06770) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Time used: 0:18
Model 1: NearlyNeutral -1246.502131 Model 2: PositiveSelection -1246.502111 Model 0: one-ratio -1246.502129 Model 7: beta -1246.502201 Model 8: beta&w>1 -1246.502079 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 3.999999989900971E-5 Model 8 vs 7 2.4399999983870657E-4