--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:47:08 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1362/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1298.59         -1302.21
2      -1298.60         -1302.37
--------------------------------------
TOTAL    -1298.60         -1302.30
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.890307    0.086857    0.353797    1.463774    0.860875   1411.34   1456.17    1.000
r(A<->C){all}   0.168782    0.020702    0.000004    0.457504    0.131405    258.05    281.30    1.004
r(A<->G){all}   0.161899    0.018213    0.000023    0.435417    0.126509    313.61    362.39    1.000
r(A<->T){all}   0.167996    0.021641    0.000031    0.469807    0.126515    144.72    210.87    1.016
r(C<->G){all}   0.169573    0.020031    0.000018    0.454038    0.135228    246.29    253.81    1.026
r(C<->T){all}   0.171178    0.020364    0.000001    0.453531    0.136769    112.42    169.54    1.006
r(G<->T){all}   0.160572    0.019233    0.000189    0.443232    0.125355    149.01    169.82    1.000
pi(A){all}      0.194895    0.000168    0.168027    0.218265    0.194667   1230.80   1365.90    1.000
pi(C){all}      0.296325    0.000223    0.265570    0.323945    0.296177    971.08   1074.05    1.000
pi(G){all}      0.308530    0.000224    0.277460    0.335232    0.308663   1313.46   1333.41    1.000
pi(T){all}      0.200249    0.000169    0.173838    0.224891    0.200536   1141.40   1269.16    1.000
alpha{1,2}      0.418368    0.228368    0.000103    1.398596    0.258876   1064.62   1161.81    1.000
alpha{3}        0.457350    0.236499    0.000155    1.396338    0.301567   1084.45   1133.53    1.000
pinvar{all}     0.998405    0.000003    0.994945    0.999998    0.998992   1203.38   1332.76    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1246.502131
Model 2: PositiveSelection	-1246.502111
Model 0: one-ratio	-1246.502129
Model 7: beta	-1246.502201
Model 8: beta&w>1	-1246.502079


Model 0 vs 1	3.999999989900971E-6

Model 2 vs 1	3.999999989900971E-5

Model 8 vs 7	2.4399999983870657E-4
>C1
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ
>C2
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ
>C3
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ
>C4
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ
>C5
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ
>C6
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=317 

C1              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
C2              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
C3              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
C4              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
C5              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
C6              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
                **************************************************

C1              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
C2              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
C3              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
C4              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
C5              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
C6              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
                **************************************************

C1              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
C2              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
C3              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
C4              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
C5              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
C6              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
                **************************************************

C1              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
C2              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
C3              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
C4              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
C5              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
C6              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
                **************************************************

C1              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
C2              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
C3              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
C4              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
C5              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
C6              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
                **************************************************

C1              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
C2              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
C3              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
C4              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
C5              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
C6              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
                **************************************************

C1              TGQYGVGHGATSITVPQ
C2              TGQYGVGHGATSITVPQ
C3              TGQYGVGHGATSITVPQ
C4              TGQYGVGHGATSITVPQ
C5              TGQYGVGHGATSITVPQ
C6              TGQYGVGHGATSITVPQ
                *****************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  317 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  317 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [9510]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [9510]--->[9510]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.511 Mb, Max= 30.882 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
C2              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
C3              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
C4              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
C5              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
C6              MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
                **************************************************

C1              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
C2              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
C3              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
C4              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
C5              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
C6              LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
                **************************************************

C1              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
C2              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
C3              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
C4              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
C5              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
C6              AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
                **************************************************

C1              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
C2              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
C3              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
C4              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
C5              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
C6              LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
                **************************************************

C1              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
C2              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
C3              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
C4              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
C5              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
C6              NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
                **************************************************

C1              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
C2              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
C3              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
C4              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
C5              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
C6              DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
                **************************************************

C1              TGQYGVGHGATSITVPQ
C2              TGQYGVGHGATSITVPQ
C3              TGQYGVGHGATSITVPQ
C4              TGQYGVGHGATSITVPQ
C5              TGQYGVGHGATSITVPQ
C6              TGQYGVGHGATSITVPQ
                *****************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
C2              ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
C3              ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
C4              ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
C5              ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
C6              ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
                **************************************************

C1              GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
C2              GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
C3              GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
C4              GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
C5              GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
C6              GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
                **************************************************

C1              TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
C2              TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
C3              TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
C4              TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
C5              TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
C6              TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
                **************************************************

C1              CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
C2              CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
C3              CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
C4              CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
C5              CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
C6              CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
                **************************************************

C1              CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
C2              CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
C3              CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
C4              CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
C5              CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
C6              CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
                **************************************************

C1              CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
C2              CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
C3              CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
C4              CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
C5              CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
C6              CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
                **************************************************

C1              GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
C2              GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
C3              GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
C4              GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
C5              GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
C6              GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
                **************************************************

C1              GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
C2              GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
C3              GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
C4              GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
C5              GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
C6              GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
                **************************************************

C1              GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
C2              GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
C3              GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
C4              GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
C5              GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
C6              GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
                **************************************************

C1              CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
C2              CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
C3              CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
C4              CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
C5              CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
C6              CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
                **************************************************

C1              GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
C2              GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
C3              GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
C4              GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
C5              GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
C6              GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
                **************************************************

C1              CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
C2              CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
C3              CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
C4              CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
C5              CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
C6              CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
                **************************************************

C1              AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
C2              AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
C3              AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
C4              AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
C5              AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
C6              AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
                **************************************************

C1              CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
C2              CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
C3              CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
C4              CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
C5              CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
C6              CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
                **************************************************

C1              TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
C2              TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
C3              TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
C4              TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
C5              TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
C6              TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
                **************************************************

C1              GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
C2              GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
C3              GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
C4              GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
C5              GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
C6              GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
                **************************************************

C1              TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
C2              TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
C3              TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
C4              TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
C5              TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
C6              TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
                **************************************************

C1              GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
C2              GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
C3              GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
C4              GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
C5              GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
C6              GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
                **************************************************

C1              ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
C2              ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
C3              ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
C4              ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
C5              ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
C6              ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
                **************************************************

C1              G
C2              G
C3              G
C4              G
C5              G
C6              G
                *



>C1
ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
G
>C2
ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
G
>C3
ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
G
>C4
ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
G
>C5
ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
G
>C6
ATGATCTCGTTACGCCAACATGCGTTCTCCCTGGCTGCAGTCTTCTTGGC
GTTGGCCGTGGGAGTTGTACTGGGTTCCGGATTTTTGTCAGACACTTTGT
TGTCCAGTCTGCGTGACGAGAAGCGGGACCTATACACGCAGATCAGTGGG
CTCAACGACCAGAAGAACATGCTGAACGAGAAAGTCAGTGCAGCAAATAA
CTTCGATAACCAGCTACTAGGTCGGATCGTGCACGACGTGCTTGGGGGCA
CGTCGGTGGTGGTCTTCCGCACTCCGGATGCAAAAGATGACGATGTCGCG
GCGGTGTCGAAAATCGTGGTCCAGGCCGGCGGGACGGTCACCGGAACGGT
GTCGCTGACGCAGGAATTTGTCGATGCCAACTCCACGGAAAAGCTTCGCA
GCGTCGTGAATTCGTCGATTCTGCCAGCCGGTGCACAGTTGAGCACCAAG
CTCGTCGACCAAGGTTCGCAGGCTGGCGACCTGCTGGGGATCACATTGCT
GGTCAACGCTAACCCGGCCGTCCCCAATGTCGGAGATGCTCAGCGCAGTA
CCGTCCTAGTGGCACTGCGTGACACAGGTTTCATCACTTACCAGACCTAC
AATCGAAATGATCACCTGGGGGCGGCGAACGCCGCGCTAGTCATTACCGG
CGGTTTACTACCCCAAGATGCCGGCAATCAAGGGGTCAGCGTGGCCCGGT
TTTCCGCCGCACTCGCTCCGCATGGTTCTGGCACCCTGCTTGCTGGCCGG
GACGGCTCGGCGACGGGAGTCGCCGCCGTGGCGGTAGCCCGCGCCGATGC
TGGCATGGCCGCCACGATCAGCACCGTCGATAACGTCGATGCCGAACCTG
GGCGGATCACCGCGATCCTGGGTCTGCACGACTTGCTCAGTGGCGGCCAT
ACCGGGCAGTACGGCGTCGGACACGGGGCTACCTCGATCACCGTGCCCCA
G
>C1
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ
>C2
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ
>C3
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ
>C4
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ
>C5
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ
>C6
MISLRQHAFSLAAVFLALAVGVVLGSGFLSDTLLSSLRDEKRDLYTQISG
LNDQKNMLNEKVSAANNFDNQLLGRIVHDVLGGTSVVVFRTPDAKDDDVA
AVSKIVVQAGGTVTGTVSLTQEFVDANSTEKLRSVVNSSILPAGAQLSTK
LVDQGSQAGDLLGITLLVNANPAVPNVGDAQRSTVLVALRDTGFITYQTY
NRNDHLGAANAALVITGGLLPQDAGNQGVSVARFSAALAPHGSGTLLAGR
DGSATGVAAVAVARADAGMAATISTVDNVDAEPGRITAILGLHDLLSGGH
TGQYGVGHGATSITVPQ


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 951 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859143
      Setting output file names to "/data/6res/ML1362/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 379291310
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5273140855
      Seed = 1179730744
      Swapseed = 1579859143
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2128.383592 -- -24.965149
         Chain 2 -- -2128.383469 -- -24.965149
         Chain 3 -- -2128.383469 -- -24.965149
         Chain 4 -- -2128.383592 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2128.383592 -- -24.965149
         Chain 2 -- -2128.383592 -- -24.965149
         Chain 3 -- -2128.383469 -- -24.965149
         Chain 4 -- -2128.383267 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2128.384] (-2128.383) (-2128.383) (-2128.384) * [-2128.384] (-2128.384) (-2128.383) (-2128.383) 
        500 -- (-1321.970) (-1303.681) [-1306.398] (-1304.921) * (-1304.056) (-1308.728) (-1313.149) [-1308.493] -- 0:00:00
       1000 -- (-1315.120) (-1306.226) (-1311.866) [-1304.916] * (-1308.674) [-1309.587] (-1305.035) (-1313.539) -- 0:00:00
       1500 -- [-1312.340] (-1309.541) (-1311.557) (-1310.875) * (-1304.412) (-1309.230) (-1306.730) [-1302.496] -- 0:00:00
       2000 -- [-1307.111] (-1312.798) (-1313.190) (-1308.325) * (-1309.402) (-1309.273) [-1304.130] (-1307.931) -- 0:00:00
       2500 -- (-1307.904) (-1302.542) [-1307.753] (-1303.991) * (-1308.778) (-1308.158) [-1308.748] (-1308.928) -- 0:00:00
       3000 -- (-1302.938) [-1316.747] (-1315.905) (-1310.766) * (-1306.087) (-1306.324) [-1307.589] (-1303.423) -- 0:00:00
       3500 -- (-1313.097) [-1312.083] (-1308.793) (-1307.933) * [-1308.542] (-1311.038) (-1304.604) (-1308.392) -- 0:00:00
       4000 -- (-1307.654) (-1311.604) [-1308.328] (-1311.155) * [-1303.970] (-1307.223) (-1311.028) (-1302.642) -- 0:00:00
       4500 -- (-1307.246) (-1311.885) (-1305.614) [-1306.857] * [-1305.455] (-1303.501) (-1309.219) (-1311.974) -- 0:00:00
       5000 -- (-1315.905) (-1310.396) (-1303.277) [-1306.913] * (-1311.177) (-1307.793) (-1317.086) [-1301.964] -- 0:00:00

      Average standard deviation of split frequencies: 0.071425

       5500 -- (-1310.223) [-1303.696] (-1307.505) (-1305.831) * (-1306.599) [-1306.699] (-1305.776) (-1311.374) -- 0:00:00
       6000 -- (-1314.110) (-1304.651) (-1312.135) [-1304.377] * (-1304.193) (-1307.599) [-1310.798] (-1310.765) -- 0:00:00
       6500 -- (-1310.988) (-1311.132) (-1314.485) [-1306.835] * (-1304.637) [-1305.695] (-1308.589) (-1309.103) -- 0:00:00
       7000 -- (-1319.744) (-1309.727) (-1311.304) [-1301.880] * (-1309.715) (-1311.324) (-1307.991) [-1304.240] -- 0:00:00
       7500 -- (-1316.099) [-1304.936] (-1307.815) (-1311.731) * (-1303.688) (-1308.544) (-1306.353) [-1312.148] -- 0:00:00
       8000 -- (-1310.618) (-1303.576) [-1306.168] (-1306.883) * (-1305.414) (-1306.901) [-1304.628] (-1312.455) -- 0:02:04
       8500 -- (-1305.151) (-1311.496) (-1308.259) [-1304.346] * (-1305.903) [-1305.731] (-1310.358) (-1310.371) -- 0:01:56
       9000 -- [-1306.802] (-1306.820) (-1311.911) (-1310.760) * (-1311.187) (-1306.395) (-1314.378) [-1304.734] -- 0:01:50
       9500 -- [-1305.152] (-1311.789) (-1311.893) (-1307.274) * (-1308.214) [-1308.093] (-1308.765) (-1312.072) -- 0:01:44
      10000 -- (-1311.306) [-1310.780] (-1315.196) (-1316.942) * (-1315.777) [-1305.677] (-1312.798) (-1306.731) -- 0:01:39

      Average standard deviation of split frequencies: 0.074432

      10500 -- (-1314.747) (-1306.199) [-1306.567] (-1306.948) * (-1314.851) (-1303.170) [-1310.266] (-1314.620) -- 0:01:34
      11000 -- (-1304.968) (-1314.694) (-1309.960) [-1308.401] * [-1309.004] (-1312.145) (-1308.381) (-1307.249) -- 0:01:29
      11500 -- (-1311.032) [-1304.796] (-1316.332) (-1305.229) * (-1309.599) (-1305.392) (-1315.347) [-1306.125] -- 0:01:25
      12000 -- (-1313.128) (-1308.737) (-1312.379) [-1300.583] * (-1306.416) (-1307.069) [-1307.568] (-1310.055) -- 0:01:22
      12500 -- (-1310.892) (-1305.430) (-1317.652) [-1307.952] * (-1314.883) (-1309.393) [-1310.563] (-1306.054) -- 0:01:19
      13000 -- [-1308.104] (-1304.344) (-1318.472) (-1306.096) * (-1305.726) (-1308.024) (-1310.961) [-1305.625] -- 0:01:15
      13500 -- (-1307.365) (-1307.136) (-1311.938) [-1302.454] * (-1309.868) (-1306.807) (-1312.433) [-1305.450] -- 0:01:13
      14000 -- (-1304.701) [-1310.678] (-1307.517) (-1307.348) * [-1304.155] (-1308.711) (-1309.172) (-1309.677) -- 0:01:10
      14500 -- (-1303.826) [-1304.555] (-1307.717) (-1306.586) * (-1305.691) (-1316.307) [-1303.782] (-1312.861) -- 0:01:07
      15000 -- (-1307.977) (-1310.267) (-1309.017) [-1302.908] * [-1303.416] (-1303.190) (-1314.613) (-1310.440) -- 0:01:05

      Average standard deviation of split frequencies: 0.065473

      15500 -- (-1317.879) (-1313.541) [-1307.326] (-1302.211) * (-1304.155) (-1308.275) [-1307.735] (-1319.994) -- 0:01:03
      16000 -- (-1322.111) (-1315.353) (-1315.527) [-1308.314] * (-1304.519) [-1306.942] (-1313.728) (-1311.622) -- 0:01:01
      16500 -- (-1305.942) (-1308.522) [-1306.654] (-1314.499) * (-1311.836) [-1304.474] (-1307.266) (-1306.931) -- 0:00:59
      17000 -- [-1309.013] (-1301.807) (-1309.769) (-1308.414) * (-1305.440) (-1310.197) [-1302.590] (-1310.169) -- 0:00:57
      17500 -- (-1313.161) (-1309.422) (-1303.035) [-1313.020] * (-1303.079) (-1305.448) (-1311.478) [-1307.007] -- 0:00:56
      18000 -- (-1305.180) (-1305.600) [-1308.765] (-1308.704) * (-1308.368) [-1308.290] (-1309.270) (-1303.369) -- 0:00:54
      18500 -- (-1308.072) [-1305.986] (-1328.901) (-1307.064) * (-1309.593) (-1305.200) [-1305.411] (-1305.048) -- 0:00:53
      19000 -- [-1308.957] (-1307.085) (-1310.696) (-1301.797) * [-1311.758] (-1305.786) (-1306.502) (-1308.082) -- 0:00:51
      19500 -- (-1312.923) (-1304.990) (-1307.524) [-1309.057] * (-1304.220) (-1314.160) [-1310.464] (-1321.741) -- 0:00:50
      20000 -- [-1307.352] (-1311.642) (-1312.593) (-1310.064) * (-1309.655) [-1312.633] (-1312.794) (-1299.768) -- 0:00:49

      Average standard deviation of split frequencies: 0.043219

      20500 -- [-1309.482] (-1308.552) (-1300.118) (-1306.183) * (-1307.012) (-1313.679) [-1310.123] (-1299.910) -- 0:00:47
      21000 -- (-1316.803) (-1309.464) (-1299.742) [-1305.340] * (-1313.030) (-1311.241) [-1306.973] (-1300.861) -- 0:00:46
      21500 -- (-1309.811) [-1306.670] (-1300.667) (-1313.446) * (-1310.042) (-1311.287) (-1317.221) [-1298.116] -- 0:00:45
      22000 -- (-1311.262) [-1305.024] (-1298.984) (-1309.551) * [-1306.211] (-1310.960) (-1312.734) (-1298.390) -- 0:00:44
      22500 -- (-1311.658) [-1307.980] (-1303.252) (-1307.432) * (-1314.405) [-1306.157] (-1314.523) (-1301.231) -- 0:00:43
      23000 -- [-1309.072] (-1310.539) (-1302.867) (-1311.232) * (-1318.102) [-1306.700] (-1315.239) (-1298.060) -- 0:00:42
      23500 -- (-1316.982) (-1305.080) (-1305.104) [-1303.943] * (-1309.449) (-1314.776) (-1310.848) [-1299.518] -- 0:01:23
      24000 -- (-1309.921) (-1312.207) [-1297.889] (-1308.107) * (-1307.046) [-1305.653] (-1311.688) (-1298.475) -- 0:01:21
      24500 -- (-1312.505) [-1309.047] (-1301.672) (-1308.077) * (-1310.519) (-1311.800) [-1309.277] (-1297.804) -- 0:01:19
      25000 -- [-1303.095] (-1306.511) (-1299.613) (-1310.457) * (-1312.660) [-1307.765] (-1309.576) (-1298.221) -- 0:01:18

      Average standard deviation of split frequencies: 0.038075

      25500 -- (-1305.759) (-1308.786) (-1301.343) [-1302.963] * (-1310.645) (-1307.354) (-1316.513) [-1304.528] -- 0:01:16
      26000 -- (-1310.159) [-1311.379] (-1300.887) (-1310.992) * (-1310.395) (-1307.354) [-1310.477] (-1299.475) -- 0:01:14
      26500 -- [-1306.885] (-1311.604) (-1304.977) (-1307.092) * (-1308.924) (-1309.036) [-1307.936] (-1299.352) -- 0:01:13
      27000 -- (-1314.432) (-1306.667) (-1298.329) [-1302.185] * [-1307.309] (-1312.899) (-1307.285) (-1299.485) -- 0:01:12
      27500 -- (-1317.010) (-1306.400) [-1298.117] (-1309.582) * (-1304.820) [-1310.309] (-1310.886) (-1298.927) -- 0:01:10
      28000 -- (-1310.505) (-1308.588) (-1301.721) [-1301.345] * (-1309.449) (-1313.278) [-1314.508] (-1299.345) -- 0:01:09
      28500 -- (-1300.651) (-1308.030) [-1305.107] (-1311.065) * (-1308.623) (-1316.321) (-1312.034) [-1298.265] -- 0:01:08
      29000 -- (-1301.609) (-1315.257) [-1302.319] (-1307.618) * (-1306.119) (-1302.924) (-1311.567) [-1298.526] -- 0:01:06
      29500 -- (-1300.753) [-1309.073] (-1304.684) (-1302.791) * [-1311.061] (-1306.388) (-1307.853) (-1298.993) -- 0:01:05
      30000 -- (-1301.353) [-1309.053] (-1302.533) (-1306.602) * (-1317.938) (-1311.600) (-1305.172) [-1301.503] -- 0:01:04

      Average standard deviation of split frequencies: 0.043920

      30500 -- (-1302.652) (-1309.591) (-1301.777) [-1308.563] * (-1304.638) (-1312.667) (-1307.240) [-1299.015] -- 0:01:03
      31000 -- (-1300.842) (-1311.209) (-1299.971) [-1307.416] * (-1310.956) (-1308.553) (-1313.671) [-1300.126] -- 0:01:02
      31500 -- (-1300.731) [-1313.549] (-1298.236) (-1309.059) * (-1316.786) (-1306.570) [-1309.846] (-1300.284) -- 0:01:01
      32000 -- [-1298.803] (-1313.218) (-1298.481) (-1305.967) * (-1310.833) (-1306.077) [-1303.754] (-1304.585) -- 0:01:00
      32500 -- (-1301.112) [-1315.150] (-1298.082) (-1303.827) * [-1310.911] (-1314.426) (-1308.698) (-1297.658) -- 0:00:59
      33000 -- (-1297.997) [-1305.938] (-1298.335) (-1312.670) * (-1313.121) [-1308.214] (-1303.982) (-1300.303) -- 0:00:58
      33500 -- (-1297.692) (-1305.927) (-1298.131) [-1306.702] * (-1310.830) (-1311.130) (-1312.066) [-1298.269] -- 0:00:57
      34000 -- (-1299.588) [-1310.173] (-1298.177) (-1316.663) * (-1312.547) [-1311.435] (-1305.513) (-1300.209) -- 0:00:56
      34500 -- (-1299.046) [-1304.898] (-1297.735) (-1315.351) * (-1305.639) (-1301.612) [-1309.315] (-1299.845) -- 0:00:55
      35000 -- (-1300.215) (-1302.526) [-1297.140] (-1311.886) * (-1304.240) (-1303.013) [-1307.021] (-1297.761) -- 0:00:55

      Average standard deviation of split frequencies: 0.043212

      35500 -- (-1298.735) [-1304.834] (-1297.490) (-1308.068) * [-1306.076] (-1300.773) (-1311.815) (-1298.521) -- 0:00:54
      36000 -- (-1302.440) [-1307.446] (-1299.640) (-1310.785) * (-1311.623) (-1302.293) (-1308.300) [-1300.362] -- 0:00:53
      36500 -- (-1299.788) (-1307.702) (-1300.110) [-1309.286] * [-1308.172] (-1303.078) (-1315.819) (-1300.422) -- 0:00:52
      37000 -- [-1299.372] (-1317.468) (-1298.916) (-1309.934) * [-1303.985] (-1303.665) (-1309.484) (-1299.594) -- 0:00:52
      37500 -- (-1298.526) (-1309.752) [-1299.393] (-1310.540) * (-1304.680) [-1297.767] (-1311.498) (-1299.888) -- 0:00:51
      38000 -- [-1298.332] (-1297.687) (-1300.331) (-1308.555) * (-1307.289) (-1298.007) [-1304.284] (-1298.726) -- 0:00:50
      38500 -- [-1297.913] (-1297.888) (-1299.828) (-1310.994) * [-1305.027] (-1298.931) (-1308.799) (-1298.369) -- 0:00:49
      39000 -- (-1297.052) (-1301.955) (-1300.409) [-1304.717] * [-1304.225] (-1298.938) (-1310.469) (-1299.807) -- 0:01:13
      39500 -- (-1297.341) [-1298.688] (-1299.261) (-1310.721) * (-1311.529) [-1298.007] (-1310.248) (-1300.474) -- 0:01:12
      40000 -- (-1297.490) (-1297.989) [-1300.347] (-1304.801) * (-1308.275) [-1298.388] (-1317.105) (-1304.434) -- 0:01:12

      Average standard deviation of split frequencies: 0.043927

      40500 -- (-1297.392) (-1299.514) (-1298.827) [-1306.565] * [-1315.948] (-1298.474) (-1317.562) (-1300.090) -- 0:01:11
      41000 -- [-1302.014] (-1301.910) (-1301.126) (-1306.684) * (-1305.421) (-1300.534) [-1302.897] (-1298.867) -- 0:01:10
      41500 -- (-1301.216) (-1298.568) [-1297.144] (-1317.744) * (-1307.708) [-1297.989] (-1307.820) (-1299.817) -- 0:01:09
      42000 -- (-1301.716) (-1297.758) [-1297.193] (-1319.052) * (-1305.499) [-1299.942] (-1311.095) (-1301.256) -- 0:01:08
      42500 -- [-1297.792] (-1298.595) (-1297.849) (-1312.155) * (-1313.828) [-1298.624] (-1313.470) (-1299.305) -- 0:01:07
      43000 -- [-1299.434] (-1297.497) (-1301.396) (-1314.268) * (-1316.956) (-1305.362) (-1316.877) [-1299.137] -- 0:01:06
      43500 -- (-1300.138) [-1298.063] (-1299.640) (-1307.493) * [-1303.392] (-1299.337) (-1319.695) (-1299.817) -- 0:01:05
      44000 -- (-1298.783) (-1299.611) (-1299.615) [-1305.208] * (-1298.603) (-1299.322) (-1312.482) [-1298.804] -- 0:01:05
      44500 -- (-1298.298) [-1297.598] (-1301.505) (-1310.331) * [-1297.936] (-1302.774) (-1309.054) (-1299.664) -- 0:01:04
      45000 -- [-1298.762] (-1304.379) (-1297.531) (-1317.586) * (-1300.851) (-1305.388) (-1305.048) [-1298.789] -- 0:01:03

      Average standard deviation of split frequencies: 0.035868

      45500 -- (-1301.070) [-1303.248] (-1298.504) (-1300.912) * (-1298.573) (-1299.818) (-1318.520) [-1298.679] -- 0:01:02
      46000 -- (-1300.212) (-1300.362) [-1298.774] (-1301.274) * (-1301.941) (-1298.380) [-1301.158] (-1297.931) -- 0:01:02
      46500 -- (-1298.346) (-1298.276) [-1297.410] (-1298.289) * (-1304.411) (-1300.981) [-1306.581] (-1298.350) -- 0:01:01
      47000 -- (-1300.961) [-1298.756] (-1297.247) (-1298.468) * [-1299.705] (-1301.713) (-1304.588) (-1299.587) -- 0:01:00
      47500 -- (-1301.168) (-1298.882) (-1297.256) [-1298.630] * (-1297.619) (-1299.910) (-1318.508) [-1298.645] -- 0:01:00
      48000 -- (-1298.196) (-1298.943) [-1299.021] (-1298.744) * [-1298.332] (-1300.695) (-1302.559) (-1300.061) -- 0:00:59
      48500 -- (-1299.229) [-1297.118] (-1298.073) (-1299.518) * (-1299.179) (-1300.675) [-1297.608] (-1301.043) -- 0:00:58
      49000 -- (-1301.635) [-1297.136] (-1302.538) (-1300.952) * [-1298.223] (-1298.102) (-1297.970) (-1299.015) -- 0:00:58
      49500 -- (-1299.522) (-1297.078) [-1300.027] (-1297.327) * (-1299.930) (-1299.446) [-1298.661] (-1298.749) -- 0:00:57
      50000 -- (-1299.882) [-1297.995] (-1299.086) (-1297.957) * (-1301.573) [-1299.604] (-1298.584) (-1297.282) -- 0:00:57

      Average standard deviation of split frequencies: 0.030238

      50500 -- (-1299.324) (-1298.418) (-1298.490) [-1297.740] * (-1301.524) [-1298.001] (-1298.817) (-1297.594) -- 0:00:56
      51000 -- (-1302.474) (-1300.392) (-1298.436) [-1299.887] * [-1298.507] (-1299.034) (-1298.636) (-1297.724) -- 0:00:55
      51500 -- (-1299.415) [-1300.192] (-1300.731) (-1300.476) * (-1300.278) (-1301.875) (-1302.889) [-1297.397] -- 0:00:55
      52000 -- (-1299.875) (-1302.046) (-1301.349) [-1298.698] * (-1297.652) (-1298.624) (-1299.146) [-1297.934] -- 0:00:54
      52500 -- (-1300.410) (-1302.143) (-1299.916) [-1298.309] * [-1298.053] (-1298.824) (-1298.750) (-1297.916) -- 0:00:54
      53000 -- [-1301.301] (-1300.026) (-1299.182) (-1299.290) * (-1297.915) [-1300.440] (-1299.108) (-1297.934) -- 0:00:53
      53500 -- (-1298.543) (-1302.100) (-1300.510) [-1299.110] * (-1300.656) (-1299.682) (-1301.106) [-1297.453] -- 0:00:53
      54000 -- (-1298.838) (-1300.881) (-1298.504) [-1298.758] * (-1299.595) [-1299.407] (-1298.567) (-1303.108) -- 0:01:10
      54500 -- (-1298.963) [-1300.253] (-1300.060) (-1300.079) * [-1300.551] (-1300.153) (-1298.431) (-1298.645) -- 0:01:09
      55000 -- [-1299.884] (-1300.585) (-1298.797) (-1298.019) * (-1302.231) (-1298.744) [-1298.258] (-1299.665) -- 0:01:08

      Average standard deviation of split frequencies: 0.024786

      55500 -- (-1299.336) (-1298.902) (-1301.850) [-1301.098] * (-1300.824) (-1302.929) [-1298.258] (-1300.396) -- 0:01:08
      56000 -- (-1299.411) [-1299.209] (-1298.187) (-1301.112) * (-1303.517) (-1300.469) (-1298.798) [-1300.230] -- 0:01:07
      56500 -- (-1297.856) [-1298.130] (-1298.804) (-1298.113) * [-1302.003] (-1300.614) (-1301.116) (-1299.080) -- 0:01:06
      57000 -- (-1296.957) (-1297.502) (-1297.809) [-1298.757] * (-1302.184) (-1300.036) [-1300.603] (-1299.384) -- 0:01:06
      57500 -- (-1299.932) (-1298.167) (-1299.439) [-1298.772] * (-1301.082) (-1300.734) (-1298.772) [-1300.014] -- 0:01:05
      58000 -- (-1300.986) [-1298.806] (-1300.248) (-1298.688) * (-1305.789) (-1298.449) [-1300.540] (-1298.863) -- 0:01:04
      58500 -- (-1299.932) (-1301.275) (-1300.251) [-1300.268] * (-1301.444) (-1298.771) (-1300.414) [-1299.156] -- 0:01:04
      59000 -- (-1299.260) [-1299.341] (-1298.655) (-1300.793) * (-1301.645) (-1300.370) [-1298.215] (-1306.776) -- 0:01:03
      59500 -- [-1301.006] (-1297.831) (-1297.305) (-1300.737) * [-1298.627] (-1299.269) (-1298.649) (-1300.081) -- 0:01:03
      60000 -- (-1300.510) [-1298.476] (-1297.628) (-1297.924) * (-1299.005) (-1299.255) [-1297.448] (-1299.963) -- 0:01:02

      Average standard deviation of split frequencies: 0.026174

      60500 -- (-1298.885) [-1299.282] (-1300.604) (-1298.863) * (-1298.713) (-1297.167) [-1298.169] (-1301.463) -- 0:01:02
      61000 -- (-1298.267) (-1299.397) (-1306.169) [-1299.013] * [-1298.083] (-1297.386) (-1297.811) (-1301.209) -- 0:01:01
      61500 -- (-1298.487) [-1298.404] (-1301.974) (-1299.231) * (-1298.023) (-1298.902) (-1304.458) [-1304.514] -- 0:01:01
      62000 -- [-1299.045] (-1298.607) (-1306.220) (-1302.128) * (-1299.431) [-1301.180] (-1302.087) (-1304.261) -- 0:01:00
      62500 -- [-1298.130] (-1300.496) (-1302.067) (-1299.663) * (-1298.559) (-1300.391) (-1303.582) [-1299.134] -- 0:01:00
      63000 -- (-1298.422) (-1301.168) (-1298.462) [-1300.627] * (-1298.438) (-1301.096) (-1304.385) [-1298.570] -- 0:00:59
      63500 -- (-1301.151) [-1297.731] (-1300.139) (-1299.822) * (-1305.231) [-1298.466] (-1303.152) (-1298.320) -- 0:00:58
      64000 -- (-1298.368) (-1297.896) (-1300.190) [-1297.456] * (-1308.528) (-1303.831) [-1303.097] (-1298.599) -- 0:00:58
      64500 -- (-1300.414) (-1298.816) (-1301.551) [-1300.661] * (-1299.556) [-1301.805] (-1299.307) (-1301.686) -- 0:00:58
      65000 -- [-1298.616] (-1300.826) (-1299.620) (-1302.055) * [-1301.194] (-1298.477) (-1302.894) (-1302.800) -- 0:00:57

      Average standard deviation of split frequencies: 0.026070

      65500 -- (-1299.081) (-1299.297) [-1299.382] (-1297.243) * [-1298.932] (-1298.546) (-1297.933) (-1307.190) -- 0:00:57
      66000 -- (-1300.641) (-1300.137) (-1298.416) [-1301.444] * [-1298.572] (-1298.307) (-1298.263) (-1298.421) -- 0:00:56
      66500 -- (-1299.537) (-1301.665) [-1299.013] (-1301.658) * (-1300.133) (-1297.594) (-1298.155) [-1299.219] -- 0:00:56
      67000 -- [-1298.718] (-1299.329) (-1302.318) (-1298.115) * (-1299.849) [-1298.377] (-1299.284) (-1299.714) -- 0:00:55
      67500 -- (-1297.044) (-1299.345) (-1300.930) [-1298.113] * (-1298.227) (-1297.251) (-1298.581) [-1303.302] -- 0:00:55
      68000 -- [-1297.331] (-1300.151) (-1302.522) (-1300.868) * [-1297.660] (-1298.222) (-1298.706) (-1302.408) -- 0:00:54
      68500 -- [-1297.079] (-1299.204) (-1305.863) (-1302.345) * [-1297.742] (-1297.841) (-1300.249) (-1301.342) -- 0:00:54
      69000 -- (-1297.272) (-1301.088) [-1305.785] (-1301.338) * [-1297.749] (-1297.535) (-1304.974) (-1300.391) -- 0:00:53
      69500 -- (-1297.994) (-1298.844) [-1298.370] (-1302.561) * (-1299.943) (-1298.860) (-1297.906) [-1299.482] -- 0:00:53
      70000 -- [-1297.466] (-1301.255) (-1297.877) (-1299.917) * (-1299.925) (-1300.154) (-1298.866) [-1301.481] -- 0:00:53

      Average standard deviation of split frequencies: 0.026366

      70500 -- (-1297.241) (-1300.740) (-1297.733) [-1300.512] * (-1298.518) (-1299.006) [-1297.868] (-1299.041) -- 0:01:05
      71000 -- [-1297.290] (-1300.516) (-1297.779) (-1305.086) * [-1300.770] (-1299.406) (-1301.092) (-1299.265) -- 0:01:05
      71500 -- (-1297.845) (-1300.084) [-1299.093] (-1300.257) * (-1300.489) (-1298.142) (-1298.239) [-1298.782] -- 0:01:04
      72000 -- (-1297.877) (-1301.252) (-1297.915) [-1298.514] * (-1299.602) (-1300.608) (-1302.700) [-1298.407] -- 0:01:04
      72500 -- (-1299.737) (-1297.529) [-1302.609] (-1298.725) * [-1297.935] (-1298.893) (-1299.308) (-1297.987) -- 0:01:03
      73000 -- (-1297.401) [-1299.497] (-1298.849) (-1298.724) * (-1299.477) [-1302.842] (-1298.914) (-1302.284) -- 0:01:03
      73500 -- (-1297.383) (-1303.692) [-1298.712] (-1298.786) * [-1299.246] (-1301.531) (-1298.078) (-1299.698) -- 0:01:03
      74000 -- (-1297.375) (-1299.611) (-1298.827) [-1298.800] * [-1299.482] (-1299.651) (-1299.121) (-1300.287) -- 0:01:02
      74500 -- [-1298.294] (-1300.278) (-1298.979) (-1298.111) * [-1298.721] (-1304.444) (-1298.730) (-1299.725) -- 0:01:02
      75000 -- (-1298.527) (-1298.866) [-1300.705] (-1299.701) * (-1298.580) (-1298.570) (-1300.055) [-1297.400] -- 0:01:01

      Average standard deviation of split frequencies: 0.028532

      75500 -- (-1298.762) (-1300.306) (-1302.832) [-1297.539] * (-1301.737) (-1298.246) (-1299.122) [-1297.415] -- 0:01:01
      76000 -- (-1302.180) (-1298.024) [-1300.079] (-1297.638) * (-1299.279) (-1303.123) [-1299.286] (-1299.612) -- 0:01:00
      76500 -- (-1299.021) (-1299.088) [-1298.731] (-1298.503) * (-1298.412) (-1300.347) [-1298.754] (-1299.924) -- 0:01:00
      77000 -- (-1299.037) (-1299.688) [-1299.018] (-1297.741) * (-1300.546) [-1299.602] (-1302.724) (-1300.085) -- 0:00:59
      77500 -- (-1297.606) [-1300.598] (-1299.135) (-1299.978) * (-1298.808) (-1298.201) (-1303.310) [-1299.433] -- 0:00:59
      78000 -- (-1299.756) (-1299.702) (-1298.512) [-1298.488] * [-1298.973] (-1299.497) (-1299.935) (-1298.429) -- 0:00:59
      78500 -- (-1301.676) [-1298.953] (-1302.420) (-1299.238) * [-1299.264] (-1297.943) (-1299.060) (-1300.077) -- 0:00:58
      79000 -- [-1298.400] (-1299.208) (-1297.880) (-1299.339) * (-1299.708) (-1297.701) (-1297.765) [-1298.781] -- 0:00:58
      79500 -- (-1303.945) (-1298.739) (-1298.659) [-1299.077] * (-1299.304) [-1298.768] (-1297.587) (-1298.156) -- 0:00:57
      80000 -- (-1305.290) (-1298.854) (-1298.688) [-1297.780] * (-1299.853) (-1298.603) [-1297.542] (-1298.135) -- 0:00:57

      Average standard deviation of split frequencies: 0.026451

      80500 -- (-1302.509) [-1298.215] (-1297.782) (-1303.018) * (-1301.848) (-1298.013) (-1299.141) [-1297.767] -- 0:00:57
      81000 -- (-1297.475) (-1299.921) [-1299.874] (-1299.597) * (-1299.120) (-1298.113) (-1298.235) [-1297.357] -- 0:00:56
      81500 -- [-1298.272] (-1299.554) (-1306.243) (-1300.631) * (-1298.919) [-1299.546] (-1301.505) (-1299.448) -- 0:00:56
      82000 -- [-1298.618] (-1298.215) (-1304.811) (-1300.005) * [-1299.541] (-1300.575) (-1301.194) (-1300.142) -- 0:00:55
      82500 -- (-1298.814) (-1299.029) (-1300.726) [-1299.297] * (-1298.991) (-1300.409) [-1299.457] (-1299.778) -- 0:00:55
      83000 -- [-1297.690] (-1299.326) (-1300.597) (-1303.117) * [-1297.336] (-1300.144) (-1299.762) (-1301.677) -- 0:00:55
      83500 -- [-1297.088] (-1300.825) (-1301.796) (-1298.725) * (-1298.440) (-1299.592) (-1299.799) [-1302.956] -- 0:00:54
      84000 -- (-1297.088) (-1300.196) [-1299.314] (-1298.932) * [-1298.022] (-1298.378) (-1298.470) (-1298.346) -- 0:00:54
      84500 -- (-1297.822) [-1299.329] (-1301.731) (-1299.721) * (-1297.939) (-1299.968) (-1298.470) [-1298.070] -- 0:00:54
      85000 -- [-1297.928] (-1300.070) (-1301.996) (-1302.303) * (-1301.248) (-1299.940) (-1300.448) [-1298.210] -- 0:00:53

      Average standard deviation of split frequencies: 0.026859

      85500 -- [-1297.320] (-1298.591) (-1304.672) (-1298.144) * (-1301.185) [-1299.208] (-1300.038) (-1298.392) -- 0:00:53
      86000 -- (-1298.081) [-1301.507] (-1298.332) (-1300.090) * (-1300.233) (-1305.048) (-1300.141) [-1299.840] -- 0:00:53
      86500 -- [-1299.351] (-1297.753) (-1298.348) (-1300.136) * (-1298.997) (-1301.474) [-1298.293] (-1299.901) -- 0:01:03
      87000 -- (-1299.043) [-1300.110] (-1299.241) (-1300.295) * (-1300.653) (-1299.053) [-1299.841] (-1299.453) -- 0:01:02
      87500 -- (-1299.561) (-1297.990) (-1298.005) [-1299.577] * (-1299.593) (-1297.812) (-1301.902) [-1298.100] -- 0:01:02
      88000 -- (-1298.899) (-1297.932) [-1300.502] (-1298.036) * [-1298.305] (-1300.473) (-1302.780) (-1301.125) -- 0:01:02
      88500 -- (-1298.238) (-1297.669) [-1301.070] (-1297.548) * (-1299.666) (-1299.808) [-1297.871] (-1298.574) -- 0:01:01
      89000 -- [-1300.825] (-1300.557) (-1297.368) (-1299.276) * (-1297.932) (-1299.089) [-1297.871] (-1299.629) -- 0:01:01
      89500 -- [-1297.082] (-1297.507) (-1297.323) (-1299.987) * (-1299.160) (-1300.758) (-1297.862) [-1300.983] -- 0:01:01
      90000 -- [-1297.711] (-1298.176) (-1297.460) (-1298.876) * [-1297.035] (-1298.408) (-1299.922) (-1298.768) -- 0:01:00

      Average standard deviation of split frequencies: 0.028733

      90500 -- [-1297.946] (-1299.172) (-1299.008) (-1299.089) * (-1297.052) [-1298.407] (-1304.314) (-1301.187) -- 0:01:00
      91000 -- (-1298.079) [-1299.484] (-1297.733) (-1300.458) * (-1298.523) (-1297.838) [-1303.044] (-1302.629) -- 0:00:59
      91500 -- (-1298.222) (-1298.132) [-1297.397] (-1298.530) * [-1297.259] (-1298.121) (-1299.925) (-1300.634) -- 0:00:59
      92000 -- [-1297.376] (-1298.464) (-1297.646) (-1299.084) * (-1299.976) [-1301.917] (-1299.945) (-1300.911) -- 0:00:59
      92500 -- (-1299.499) (-1300.183) [-1297.356] (-1299.745) * (-1298.686) (-1298.244) [-1299.246] (-1299.993) -- 0:00:58
      93000 -- (-1300.653) (-1303.023) (-1300.935) [-1299.977] * [-1299.539] (-1298.874) (-1302.635) (-1300.410) -- 0:00:58
      93500 -- (-1298.752) (-1297.603) (-1301.737) [-1298.102] * (-1299.534) (-1299.696) [-1300.844] (-1300.106) -- 0:00:58
      94000 -- (-1298.822) [-1298.722] (-1299.259) (-1301.566) * (-1300.769) (-1299.026) [-1298.673] (-1299.844) -- 0:00:57
      94500 -- [-1298.292] (-1301.050) (-1299.977) (-1297.887) * [-1302.222] (-1298.723) (-1303.363) (-1299.198) -- 0:00:57
      95000 -- (-1298.120) (-1297.783) (-1301.364) [-1297.760] * (-1301.804) (-1299.336) (-1299.974) [-1299.984] -- 0:00:57

      Average standard deviation of split frequencies: 0.026025

      95500 -- [-1297.987] (-1299.447) (-1300.747) (-1297.819) * [-1301.970] (-1298.080) (-1299.445) (-1300.228) -- 0:00:56
      96000 -- (-1303.098) [-1299.149] (-1297.838) (-1297.907) * (-1300.745) (-1297.509) [-1298.178] (-1299.285) -- 0:00:56
      96500 -- [-1306.823] (-1302.702) (-1298.584) (-1297.275) * (-1301.326) (-1297.330) [-1297.643] (-1298.075) -- 0:00:56
      97000 -- (-1298.739) (-1297.736) [-1298.925] (-1298.307) * (-1300.171) (-1298.416) [-1299.796] (-1298.089) -- 0:00:55
      97500 -- (-1299.974) [-1298.594] (-1303.571) (-1298.675) * (-1298.087) (-1299.947) (-1297.640) [-1296.948] -- 0:00:55
      98000 -- (-1301.151) [-1298.775] (-1299.107) (-1301.434) * (-1301.359) (-1298.658) (-1299.493) [-1297.789] -- 0:00:55
      98500 -- (-1300.373) [-1298.734] (-1300.021) (-1299.822) * (-1301.054) [-1297.063] (-1298.865) (-1297.730) -- 0:00:54
      99000 -- (-1299.994) [-1299.098] (-1301.681) (-1297.918) * (-1303.142) (-1297.249) [-1297.896] (-1297.378) -- 0:00:54
      99500 -- (-1302.265) [-1297.987] (-1303.059) (-1300.006) * [-1298.150] (-1302.884) (-1299.080) (-1300.216) -- 0:00:54
      100000 -- (-1302.310) [-1298.695] (-1302.978) (-1301.168) * [-1298.059] (-1299.482) (-1298.906) (-1301.921) -- 0:00:54

      Average standard deviation of split frequencies: 0.024819

      100500 -- (-1299.500) [-1300.003] (-1299.582) (-1298.525) * (-1298.937) (-1299.630) (-1298.021) [-1301.636] -- 0:00:53
      101000 -- (-1298.374) (-1298.905) [-1298.495] (-1300.195) * [-1299.908] (-1299.330) (-1297.955) (-1302.913) -- 0:00:53
      101500 -- (-1300.749) (-1299.779) [-1302.848] (-1306.338) * [-1297.369] (-1301.074) (-1300.084) (-1304.219) -- 0:00:53
      102000 -- (-1300.881) (-1298.803) [-1301.872] (-1298.886) * (-1297.360) (-1302.374) [-1301.708] (-1307.452) -- 0:00:52
      102500 -- (-1299.681) (-1299.501) [-1302.002] (-1298.091) * (-1297.078) [-1300.159] (-1297.682) (-1307.888) -- 0:01:01
      103000 -- (-1302.332) [-1300.925] (-1299.410) (-1299.006) * (-1297.677) (-1298.716) (-1297.342) [-1300.951] -- 0:01:00
      103500 -- (-1306.348) (-1302.772) (-1298.168) [-1300.462] * (-1299.652) (-1297.180) (-1298.290) [-1297.817] -- 0:01:00
      104000 -- (-1304.296) (-1300.329) [-1298.169] (-1297.120) * (-1298.428) (-1301.405) (-1301.869) [-1299.707] -- 0:01:00
      104500 -- (-1302.293) (-1301.835) (-1299.355) [-1298.561] * [-1298.000] (-1301.126) (-1299.848) (-1301.488) -- 0:00:59
      105000 -- (-1303.604) (-1302.476) (-1299.917) [-1297.882] * [-1298.235] (-1301.257) (-1298.312) (-1299.895) -- 0:00:59

      Average standard deviation of split frequencies: 0.024460

      105500 -- [-1299.071] (-1300.102) (-1298.817) (-1297.388) * (-1303.148) (-1301.936) [-1297.800] (-1300.298) -- 0:00:59
      106000 -- [-1298.364] (-1301.188) (-1299.272) (-1297.531) * (-1300.355) [-1299.909] (-1299.479) (-1300.453) -- 0:00:59
      106500 -- (-1297.728) (-1302.841) (-1302.861) [-1299.472] * (-1299.544) [-1301.260] (-1299.510) (-1298.942) -- 0:00:58
      107000 -- (-1299.523) (-1300.982) [-1299.507] (-1300.771) * (-1299.266) (-1301.344) [-1298.181] (-1298.573) -- 0:00:58
      107500 -- [-1302.162] (-1299.280) (-1298.543) (-1297.927) * (-1299.419) (-1299.978) [-1298.944] (-1300.918) -- 0:00:58
      108000 -- (-1301.358) [-1297.808] (-1301.479) (-1297.615) * (-1300.642) (-1305.861) (-1298.427) [-1300.351] -- 0:00:57
      108500 -- (-1301.166) (-1297.522) [-1296.931] (-1300.647) * (-1298.465) [-1301.495] (-1300.435) (-1299.179) -- 0:00:57
      109000 -- (-1299.125) (-1297.093) [-1297.529] (-1300.176) * (-1297.498) (-1301.261) [-1299.977] (-1299.185) -- 0:00:57
      109500 -- [-1299.405] (-1297.121) (-1297.825) (-1300.941) * (-1297.498) [-1302.217] (-1298.313) (-1298.506) -- 0:00:56
      110000 -- (-1298.659) [-1304.817] (-1299.783) (-1299.248) * [-1297.206] (-1303.410) (-1300.970) (-1298.249) -- 0:00:56

      Average standard deviation of split frequencies: 0.022576

      110500 -- (-1302.722) (-1297.242) (-1299.979) [-1304.231] * (-1298.334) (-1302.220) (-1302.956) [-1298.897] -- 0:00:56
      111000 -- (-1306.215) (-1297.231) [-1299.543] (-1300.477) * [-1299.389] (-1301.694) (-1301.803) (-1299.086) -- 0:00:56
      111500 -- [-1301.275] (-1298.314) (-1300.217) (-1300.659) * (-1299.189) (-1300.239) (-1302.780) [-1298.398] -- 0:00:55
      112000 -- (-1304.134) [-1298.999] (-1300.203) (-1302.060) * (-1298.442) [-1303.156] (-1301.666) (-1299.620) -- 0:00:55
      112500 -- (-1301.036) (-1298.745) (-1302.266) [-1299.701] * (-1311.921) [-1300.205] (-1298.494) (-1299.954) -- 0:00:55
      113000 -- (-1298.684) [-1298.981] (-1299.181) (-1304.057) * (-1306.874) (-1301.373) (-1297.905) [-1301.616] -- 0:00:54
      113500 -- (-1298.746) (-1302.358) (-1300.032) [-1298.545] * (-1304.038) (-1301.349) (-1300.406) [-1300.194] -- 0:00:54
      114000 -- (-1298.634) (-1299.875) (-1299.400) [-1297.537] * (-1297.980) [-1301.412] (-1299.468) (-1299.374) -- 0:00:54
      114500 -- [-1298.578] (-1299.885) (-1298.863) (-1301.082) * (-1297.648) (-1305.515) (-1299.005) [-1302.061] -- 0:00:54
      115000 -- (-1298.930) (-1298.941) (-1297.799) [-1298.054] * (-1297.654) (-1302.713) (-1300.426) [-1304.547] -- 0:00:53

      Average standard deviation of split frequencies: 0.023164

      115500 -- [-1301.180] (-1297.926) (-1298.149) (-1300.252) * [-1298.493] (-1302.231) (-1300.364) (-1308.088) -- 0:00:53
      116000 -- [-1297.703] (-1298.310) (-1298.284) (-1300.263) * [-1297.401] (-1298.568) (-1298.406) (-1303.276) -- 0:00:53
      116500 -- (-1299.306) (-1297.483) (-1300.637) [-1299.891] * (-1302.176) (-1298.681) (-1297.518) [-1300.056] -- 0:00:53
      117000 -- (-1301.628) [-1299.179] (-1300.237) (-1302.095) * (-1304.921) (-1298.665) [-1299.286] (-1305.605) -- 0:00:52
      117500 -- (-1299.205) (-1297.906) (-1300.116) [-1307.954] * (-1306.044) [-1301.700] (-1299.521) (-1302.639) -- 0:00:52
      118000 -- (-1301.292) (-1299.232) (-1299.151) [-1301.958] * (-1298.617) (-1299.154) (-1298.355) [-1300.682] -- 0:00:52
      118500 -- (-1298.131) (-1301.227) (-1298.513) [-1298.007] * (-1299.876) (-1301.001) [-1299.502] (-1298.830) -- 0:00:59
      119000 -- [-1298.107] (-1303.257) (-1300.614) (-1298.882) * (-1297.912) [-1303.006] (-1299.053) (-1303.576) -- 0:00:59
      119500 -- (-1301.355) (-1298.965) [-1304.482] (-1299.750) * [-1298.253] (-1300.500) (-1297.248) (-1300.151) -- 0:00:58
      120000 -- (-1302.204) [-1297.921] (-1299.954) (-1299.021) * (-1297.745) [-1299.623] (-1298.065) (-1302.427) -- 0:00:58

      Average standard deviation of split frequencies: 0.020150

      120500 -- (-1301.940) [-1297.558] (-1299.659) (-1298.381) * [-1299.710] (-1304.315) (-1298.295) (-1300.493) -- 0:00:58
      121000 -- (-1298.054) (-1300.044) [-1297.307] (-1297.688) * (-1297.744) [-1302.433] (-1298.963) (-1300.103) -- 0:00:58
      121500 -- [-1297.569] (-1298.473) (-1298.117) (-1298.211) * (-1300.094) [-1297.872] (-1300.359) (-1300.716) -- 0:00:57
      122000 -- (-1298.603) (-1298.879) [-1298.928] (-1298.452) * (-1300.094) (-1298.580) [-1301.351] (-1297.364) -- 0:00:57
      122500 -- (-1297.789) [-1298.051] (-1297.838) (-1300.597) * (-1299.856) [-1298.648] (-1297.613) (-1298.280) -- 0:00:57
      123000 -- (-1297.725) [-1299.508] (-1299.160) (-1298.002) * [-1300.474] (-1298.694) (-1297.565) (-1298.796) -- 0:00:57
      123500 -- [-1298.313] (-1298.844) (-1302.129) (-1300.090) * [-1301.874] (-1297.508) (-1297.557) (-1300.463) -- 0:00:56
      124000 -- (-1298.126) (-1299.970) [-1299.101] (-1298.560) * (-1298.502) (-1299.353) [-1299.591] (-1299.653) -- 0:00:56
      124500 -- (-1298.331) (-1303.390) [-1298.408] (-1297.789) * (-1298.215) (-1299.396) [-1298.139] (-1300.484) -- 0:00:56
      125000 -- (-1298.541) (-1299.981) [-1298.794] (-1297.789) * [-1297.644] (-1300.903) (-1299.571) (-1304.620) -- 0:00:56

      Average standard deviation of split frequencies: 0.020577

      125500 -- [-1298.332] (-1298.727) (-1302.730) (-1300.888) * (-1298.153) [-1298.403] (-1302.797) (-1300.740) -- 0:00:55
      126000 -- (-1299.622) [-1298.625] (-1299.336) (-1303.973) * [-1299.390] (-1298.928) (-1297.336) (-1299.908) -- 0:00:55
      126500 -- (-1299.622) (-1297.685) [-1300.512] (-1305.711) * (-1300.083) [-1300.458] (-1300.440) (-1298.552) -- 0:00:55
      127000 -- (-1298.608) [-1298.830] (-1300.498) (-1301.378) * [-1299.377] (-1298.687) (-1300.397) (-1300.465) -- 0:00:54
      127500 -- (-1297.656) [-1298.444] (-1298.929) (-1298.608) * [-1298.329] (-1297.490) (-1300.763) (-1298.445) -- 0:00:54
      128000 -- (-1298.372) (-1298.271) [-1297.595] (-1297.439) * [-1299.793] (-1298.088) (-1301.594) (-1300.008) -- 0:00:54
      128500 -- (-1297.831) [-1299.046] (-1300.033) (-1297.810) * (-1300.851) (-1300.107) (-1301.139) [-1302.009] -- 0:00:54
      129000 -- (-1301.367) [-1299.235] (-1300.672) (-1297.198) * (-1299.675) [-1302.262] (-1297.439) (-1300.939) -- 0:00:54
      129500 -- (-1299.088) (-1301.834) [-1298.633] (-1297.336) * (-1303.416) (-1301.919) [-1299.908] (-1300.962) -- 0:00:53
      130000 -- [-1298.435] (-1302.427) (-1298.610) (-1298.244) * [-1298.520] (-1303.872) (-1300.815) (-1300.151) -- 0:00:53

      Average standard deviation of split frequencies: 0.019482

      130500 -- (-1298.698) (-1300.041) [-1298.725] (-1299.616) * [-1299.160] (-1298.768) (-1299.351) (-1300.782) -- 0:00:53
      131000 -- (-1300.359) [-1298.283] (-1304.146) (-1300.095) * (-1299.850) (-1297.625) (-1301.726) [-1297.698] -- 0:00:53
      131500 -- (-1299.346) (-1298.532) (-1300.117) [-1297.781] * (-1303.074) (-1299.341) (-1301.657) [-1297.826] -- 0:00:52
      132000 -- (-1299.409) (-1298.666) (-1298.450) [-1298.575] * (-1305.612) [-1297.953] (-1298.333) (-1298.951) -- 0:00:52
      132500 -- (-1299.304) (-1299.805) [-1298.179] (-1298.606) * (-1300.074) (-1298.252) [-1298.299] (-1298.925) -- 0:00:52
      133000 -- [-1300.502] (-1302.540) (-1298.901) (-1298.228) * (-1297.861) [-1299.244] (-1299.100) (-1303.292) -- 0:00:52
      133500 -- (-1298.199) (-1298.712) (-1299.694) [-1297.409] * (-1297.531) (-1300.169) (-1299.777) [-1298.711] -- 0:00:51
      134000 -- (-1297.511) [-1300.257] (-1298.672) (-1297.847) * [-1297.786] (-1298.965) (-1302.039) (-1298.863) -- 0:00:51
      134500 -- (-1297.544) [-1297.515] (-1298.049) (-1297.472) * (-1296.948) (-1301.017) [-1300.045] (-1299.228) -- 0:00:51
      135000 -- (-1299.505) [-1297.515] (-1301.223) (-1297.977) * (-1297.442) (-1301.107) [-1298.626] (-1297.766) -- 0:00:57

      Average standard deviation of split frequencies: 0.019064

      135500 -- [-1299.795] (-1297.650) (-1301.034) (-1300.533) * (-1298.014) (-1300.065) [-1299.381] (-1298.345) -- 0:00:57
      136000 -- (-1297.966) [-1298.175] (-1301.697) (-1299.748) * [-1297.194] (-1300.728) (-1299.424) (-1297.113) -- 0:00:57
      136500 -- [-1297.960] (-1298.870) (-1301.630) (-1299.739) * (-1297.292) (-1298.572) [-1300.601] (-1298.536) -- 0:00:56
      137000 -- (-1297.850) (-1300.958) (-1298.148) [-1300.059] * (-1299.674) (-1297.668) [-1299.062] (-1301.183) -- 0:00:56
      137500 -- (-1297.779) [-1300.378] (-1302.900) (-1303.058) * (-1299.963) (-1298.282) (-1298.356) [-1299.824] -- 0:00:56
      138000 -- [-1297.057] (-1301.576) (-1298.516) (-1304.189) * [-1300.175] (-1299.311) (-1297.640) (-1298.053) -- 0:00:56
      138500 -- (-1299.189) (-1299.465) [-1300.339] (-1298.860) * (-1297.551) [-1299.929] (-1301.298) (-1301.098) -- 0:00:55
      139000 -- (-1299.196) [-1298.053] (-1297.980) (-1300.205) * (-1300.798) (-1298.595) [-1302.125] (-1298.661) -- 0:00:55
      139500 -- (-1300.684) [-1298.110] (-1297.690) (-1300.054) * (-1297.624) (-1297.641) [-1299.046] (-1300.126) -- 0:00:55
      140000 -- (-1300.459) (-1298.764) [-1297.513] (-1300.254) * (-1299.858) (-1297.474) [-1300.263] (-1302.193) -- 0:00:55

      Average standard deviation of split frequencies: 0.016756

      140500 -- (-1298.025) [-1300.288] (-1298.787) (-1298.156) * (-1300.475) (-1298.493) [-1302.169] (-1299.004) -- 0:00:55
      141000 -- (-1299.581) [-1299.820] (-1297.245) (-1299.136) * [-1299.488] (-1298.574) (-1300.421) (-1300.496) -- 0:00:54
      141500 -- (-1302.029) (-1302.002) (-1297.885) [-1298.057] * (-1298.987) [-1298.570] (-1298.780) (-1300.762) -- 0:00:54
      142000 -- (-1303.101) [-1299.462] (-1297.836) (-1298.126) * [-1297.834] (-1299.999) (-1302.202) (-1303.006) -- 0:00:54
      142500 -- (-1298.065) (-1301.066) [-1297.849] (-1298.605) * (-1300.233) (-1297.321) [-1297.207] (-1300.343) -- 0:00:54
      143000 -- [-1298.044] (-1301.145) (-1301.397) (-1298.448) * [-1298.957] (-1298.202) (-1305.811) (-1302.049) -- 0:00:53
      143500 -- [-1298.190] (-1298.686) (-1297.200) (-1303.023) * (-1298.828) [-1298.693] (-1299.655) (-1301.317) -- 0:00:53
      144000 -- (-1298.101) (-1300.224) (-1299.664) [-1298.833] * [-1298.791] (-1299.219) (-1299.856) (-1301.213) -- 0:00:53
      144500 -- (-1298.540) (-1301.658) (-1300.983) [-1299.623] * (-1299.956) [-1299.007] (-1300.460) (-1298.122) -- 0:00:53
      145000 -- (-1299.625) [-1299.360] (-1301.462) (-1300.655) * (-1297.794) (-1298.279) [-1299.495] (-1298.303) -- 0:00:53

      Average standard deviation of split frequencies: 0.017597

      145500 -- [-1299.262] (-1297.823) (-1300.116) (-1302.278) * (-1299.044) (-1297.820) (-1302.572) [-1298.719] -- 0:00:52
      146000 -- (-1302.911) (-1297.856) [-1298.779] (-1302.891) * (-1298.195) (-1297.817) (-1299.992) [-1298.576] -- 0:00:52
      146500 -- (-1300.334) [-1300.434] (-1300.419) (-1299.799) * [-1297.916] (-1297.820) (-1300.839) (-1301.424) -- 0:00:52
      147000 -- [-1299.405] (-1298.663) (-1302.283) (-1298.609) * (-1297.916) (-1302.034) [-1299.741] (-1299.948) -- 0:00:52
      147500 -- (-1301.791) [-1299.149] (-1301.113) (-1299.292) * (-1299.279) (-1297.825) [-1297.428] (-1300.203) -- 0:00:52
      148000 -- (-1299.986) (-1297.878) (-1302.524) [-1299.221] * (-1300.922) (-1298.478) (-1299.282) [-1298.503] -- 0:00:51
      148500 -- [-1300.590] (-1299.314) (-1300.520) (-1297.620) * (-1301.692) (-1297.508) (-1298.412) [-1298.104] -- 0:00:51
      149000 -- (-1297.418) [-1303.087] (-1299.809) (-1297.877) * (-1310.163) (-1298.451) [-1299.200] (-1299.938) -- 0:00:51
      149500 -- (-1298.163) [-1302.728] (-1299.377) (-1298.137) * (-1303.038) (-1297.886) [-1299.238] (-1305.384) -- 0:00:51
      150000 -- (-1298.550) (-1302.238) [-1298.853] (-1297.331) * [-1297.537] (-1300.155) (-1296.943) (-1305.700) -- 0:00:51

      Average standard deviation of split frequencies: 0.018303

      150500 -- [-1297.814] (-1299.555) (-1300.090) (-1297.644) * [-1303.009] (-1298.287) (-1297.189) (-1302.394) -- 0:00:50
      151000 -- [-1298.105] (-1297.946) (-1300.162) (-1298.790) * [-1299.132] (-1299.166) (-1297.787) (-1300.914) -- 0:00:56
      151500 -- [-1297.104] (-1297.302) (-1301.680) (-1297.175) * (-1299.752) (-1300.035) [-1297.993] (-1301.493) -- 0:00:56
      152000 -- (-1297.036) (-1300.693) [-1301.689] (-1302.430) * (-1298.154) (-1298.050) (-1299.214) [-1299.881] -- 0:00:55
      152500 -- (-1299.491) (-1300.133) (-1302.659) [-1302.630] * (-1299.069) (-1298.168) (-1298.680) [-1298.683] -- 0:00:55
      153000 -- [-1303.001] (-1299.042) (-1301.158) (-1301.206) * (-1299.722) (-1301.758) (-1298.877) [-1300.723] -- 0:00:55
      153500 -- [-1301.876] (-1299.044) (-1301.753) (-1298.016) * [-1298.908] (-1299.627) (-1299.469) (-1302.087) -- 0:00:55
      154000 -- [-1298.300] (-1298.400) (-1297.866) (-1298.033) * (-1300.468) (-1299.571) [-1297.673] (-1302.253) -- 0:00:54
      154500 -- (-1300.493) [-1298.772] (-1298.508) (-1298.038) * [-1301.473] (-1298.261) (-1298.316) (-1299.755) -- 0:00:54
      155000 -- (-1299.436) (-1301.231) [-1297.381] (-1298.029) * [-1299.829] (-1298.843) (-1299.204) (-1298.722) -- 0:00:54

      Average standard deviation of split frequencies: 0.018735

      155500 -- (-1298.827) [-1300.682] (-1297.174) (-1299.926) * (-1299.525) (-1302.060) (-1298.581) [-1302.371] -- 0:00:54
      156000 -- (-1298.827) [-1303.391] (-1297.063) (-1298.830) * (-1299.132) (-1300.269) [-1299.443] (-1300.031) -- 0:00:54
      156500 -- (-1299.431) (-1298.693) [-1301.554] (-1299.093) * (-1301.489) (-1297.927) (-1299.935) [-1299.575] -- 0:00:53
      157000 -- (-1298.274) [-1298.811] (-1301.154) (-1301.547) * (-1299.964) (-1298.801) (-1300.340) [-1298.962] -- 0:00:53
      157500 -- (-1298.790) (-1299.131) (-1298.770) [-1297.638] * (-1305.639) (-1299.025) [-1302.241] (-1298.405) -- 0:00:53
      158000 -- [-1297.283] (-1299.118) (-1297.626) (-1300.482) * [-1299.606] (-1297.861) (-1300.483) (-1298.519) -- 0:00:53
      158500 -- (-1297.558) [-1299.330] (-1298.265) (-1301.198) * [-1298.048] (-1297.495) (-1300.733) (-1300.077) -- 0:00:53
      159000 -- (-1298.682) [-1303.582] (-1299.000) (-1300.733) * (-1300.407) [-1298.379] (-1298.484) (-1300.088) -- 0:00:52
      159500 -- (-1298.945) (-1298.816) [-1297.807] (-1304.500) * (-1300.735) (-1299.960) (-1299.644) [-1301.897] -- 0:00:52
      160000 -- [-1298.816] (-1300.816) (-1299.101) (-1299.478) * (-1298.289) (-1300.880) [-1298.091] (-1301.695) -- 0:00:52

      Average standard deviation of split frequencies: 0.018531

      160500 -- [-1300.518] (-1297.492) (-1301.505) (-1298.066) * [-1298.904] (-1298.626) (-1298.104) (-1298.634) -- 0:00:52
      161000 -- (-1300.274) [-1300.444] (-1300.674) (-1298.136) * (-1300.023) (-1299.051) [-1300.678] (-1298.579) -- 0:00:52
      161500 -- [-1298.564] (-1297.622) (-1300.229) (-1299.498) * (-1299.517) [-1299.349] (-1298.966) (-1298.603) -- 0:00:51
      162000 -- (-1298.522) (-1299.411) (-1300.816) [-1298.972] * (-1301.819) (-1300.196) (-1299.842) [-1297.732] -- 0:00:51
      162500 -- (-1298.418) (-1297.934) [-1300.706] (-1298.417) * (-1299.422) [-1300.636] (-1299.715) (-1297.994) -- 0:00:51
      163000 -- (-1297.124) [-1298.196] (-1300.072) (-1298.607) * (-1300.057) (-1297.393) (-1304.105) [-1299.979] -- 0:00:51
      163500 -- (-1297.482) (-1297.390) (-1299.245) [-1299.524] * [-1299.081] (-1304.322) (-1304.137) (-1298.478) -- 0:00:51
      164000 -- (-1297.480) (-1296.944) [-1300.322] (-1301.287) * (-1298.980) (-1303.630) [-1297.892] (-1297.519) -- 0:00:50
      164500 -- (-1297.123) (-1298.561) (-1299.546) [-1298.694] * (-1297.815) [-1301.006] (-1298.754) (-1297.833) -- 0:00:50
      165000 -- [-1297.923] (-1297.413) (-1300.660) (-1297.989) * [-1297.332] (-1300.533) (-1298.867) (-1299.710) -- 0:00:50

      Average standard deviation of split frequencies: 0.017607

      165500 -- (-1297.833) (-1297.759) [-1298.202] (-1297.613) * [-1297.467] (-1303.869) (-1298.039) (-1299.133) -- 0:00:50
      166000 -- (-1299.715) (-1297.024) [-1299.221] (-1299.670) * [-1299.134] (-1298.920) (-1298.087) (-1299.524) -- 0:00:50
      166500 -- (-1298.483) (-1297.243) [-1299.221] (-1298.777) * [-1297.831] (-1300.819) (-1297.749) (-1299.764) -- 0:00:50
      167000 -- (-1299.700) (-1300.182) (-1303.737) [-1299.176] * [-1298.752] (-1298.096) (-1299.017) (-1299.856) -- 0:00:49
      167500 -- (-1301.059) (-1298.057) [-1299.435] (-1299.091) * (-1299.232) (-1298.252) [-1298.636] (-1300.117) -- 0:00:54
      168000 -- (-1302.401) (-1297.663) (-1300.764) [-1297.669] * (-1298.260) (-1298.966) [-1299.769] (-1298.834) -- 0:00:54
      168500 -- [-1301.876] (-1298.861) (-1303.887) (-1297.687) * (-1297.330) (-1299.019) (-1299.903) [-1298.531] -- 0:00:54
      169000 -- (-1297.446) [-1299.454] (-1298.408) (-1297.464) * [-1297.696] (-1299.014) (-1300.593) (-1299.203) -- 0:00:54
      169500 -- (-1304.366) (-1298.626) (-1298.726) [-1298.148] * (-1298.357) [-1298.934] (-1298.010) (-1298.339) -- 0:00:53
      170000 -- (-1299.784) (-1303.467) (-1298.365) [-1297.916] * (-1298.726) (-1297.537) [-1298.590] (-1298.527) -- 0:00:53

      Average standard deviation of split frequencies: 0.016137

      170500 -- (-1301.638) (-1301.235) [-1298.595] (-1298.984) * (-1300.168) [-1299.740] (-1299.129) (-1299.975) -- 0:00:53
      171000 -- (-1303.009) [-1298.171] (-1297.801) (-1299.644) * [-1298.815] (-1300.541) (-1300.268) (-1301.351) -- 0:00:53
      171500 -- (-1300.645) (-1302.589) (-1303.414) [-1300.750] * [-1298.272] (-1301.478) (-1300.104) (-1300.646) -- 0:00:53
      172000 -- (-1299.041) (-1301.853) (-1298.634) [-1298.716] * [-1300.493] (-1302.682) (-1299.951) (-1298.531) -- 0:00:52
      172500 -- (-1299.305) (-1300.666) [-1298.661] (-1298.385) * [-1298.681] (-1304.069) (-1298.506) (-1298.604) -- 0:00:52
      173000 -- (-1299.510) (-1298.052) (-1299.802) [-1300.109] * [-1299.156] (-1305.147) (-1299.238) (-1299.271) -- 0:00:52
      173500 -- (-1298.283) (-1298.734) [-1299.395] (-1299.361) * [-1297.890] (-1304.734) (-1299.872) (-1299.423) -- 0:00:52
      174000 -- (-1301.759) (-1302.256) [-1301.369] (-1299.778) * [-1297.487] (-1298.607) (-1298.383) (-1300.412) -- 0:00:52
      174500 -- (-1301.134) (-1300.599) (-1298.668) [-1302.285] * (-1297.946) (-1297.825) (-1298.418) [-1300.160] -- 0:00:52
      175000 -- [-1298.865] (-1298.958) (-1299.452) (-1299.422) * (-1297.948) (-1311.436) [-1302.840] (-1300.508) -- 0:00:51

      Average standard deviation of split frequencies: 0.016353

      175500 -- [-1298.612] (-1298.924) (-1302.242) (-1298.992) * (-1297.572) (-1303.695) (-1299.147) [-1301.890] -- 0:00:51
      176000 -- (-1298.479) [-1299.376] (-1305.690) (-1297.976) * [-1299.806] (-1298.465) (-1299.335) (-1302.407) -- 0:00:51
      176500 -- (-1297.200) (-1299.365) (-1300.708) [-1297.836] * (-1301.712) [-1299.720] (-1302.114) (-1298.588) -- 0:00:51
      177000 -- (-1299.063) [-1299.402] (-1306.802) (-1297.904) * [-1298.733] (-1299.885) (-1298.244) (-1298.235) -- 0:00:51
      177500 -- [-1300.046] (-1299.295) (-1302.806) (-1303.575) * (-1298.832) [-1303.511] (-1302.103) (-1298.479) -- 0:00:50
      178000 -- [-1299.511] (-1299.929) (-1303.135) (-1303.790) * (-1299.734) (-1300.394) [-1299.502] (-1300.753) -- 0:00:50
      178500 -- (-1299.609) [-1302.255] (-1302.385) (-1301.224) * (-1299.169) [-1298.265] (-1297.912) (-1300.574) -- 0:00:50
      179000 -- (-1307.257) [-1308.243] (-1300.467) (-1297.968) * (-1304.080) (-1297.147) [-1298.801] (-1303.083) -- 0:00:50
      179500 -- (-1302.909) (-1299.250) [-1298.876] (-1298.337) * (-1298.378) (-1297.326) (-1303.196) [-1299.779] -- 0:00:50
      180000 -- [-1301.910] (-1300.339) (-1298.783) (-1299.863) * [-1302.051] (-1301.976) (-1299.184) (-1297.534) -- 0:00:50

      Average standard deviation of split frequencies: 0.015076

      180500 -- (-1302.158) [-1300.222] (-1299.270) (-1298.229) * (-1299.181) (-1298.072) [-1303.010] (-1297.130) -- 0:00:49
      181000 -- [-1296.916] (-1302.505) (-1301.900) (-1298.752) * [-1299.226] (-1297.618) (-1301.123) (-1297.883) -- 0:00:49
      181500 -- (-1302.183) (-1305.534) (-1297.744) [-1298.577] * (-1300.012) (-1303.839) (-1299.593) [-1299.700] -- 0:00:49
      182000 -- (-1299.710) (-1299.270) [-1300.648] (-1298.915) * (-1300.220) [-1301.477] (-1298.436) (-1298.069) -- 0:00:53
      182500 -- [-1298.021] (-1300.001) (-1301.740) (-1299.979) * (-1300.583) [-1301.864] (-1298.533) (-1298.306) -- 0:00:53
      183000 -- (-1298.314) (-1300.208) (-1301.090) [-1297.301] * [-1297.738] (-1301.767) (-1299.367) (-1303.852) -- 0:00:53
      183500 -- (-1299.301) (-1300.410) [-1302.454] (-1298.621) * (-1298.841) [-1300.964] (-1302.946) (-1307.426) -- 0:00:53
      184000 -- [-1299.084] (-1300.345) (-1302.296) (-1302.369) * (-1297.313) [-1299.075] (-1297.719) (-1303.706) -- 0:00:53
      184500 -- [-1301.466] (-1297.744) (-1301.925) (-1302.467) * [-1297.240] (-1298.837) (-1303.409) (-1303.153) -- 0:00:53
      185000 -- (-1302.291) (-1297.740) (-1301.437) [-1299.684] * (-1298.358) [-1299.678] (-1300.000) (-1297.578) -- 0:00:52

      Average standard deviation of split frequencies: 0.015740

      185500 -- (-1299.854) [-1299.575] (-1300.694) (-1303.716) * (-1297.530) (-1300.938) [-1298.840] (-1298.579) -- 0:00:52
      186000 -- [-1297.730] (-1300.879) (-1301.299) (-1297.712) * (-1299.933) [-1299.088] (-1300.924) (-1298.008) -- 0:00:52
      186500 -- (-1297.789) (-1299.149) [-1300.505] (-1300.915) * (-1298.986) [-1298.937] (-1301.033) (-1302.400) -- 0:00:52
      187000 -- (-1297.924) [-1298.663] (-1299.794) (-1300.352) * [-1301.746] (-1299.446) (-1300.124) (-1298.741) -- 0:00:52
      187500 -- (-1301.741) (-1298.571) [-1298.737] (-1299.458) * (-1299.911) [-1298.443] (-1297.401) (-1300.828) -- 0:00:52
      188000 -- [-1298.649] (-1299.794) (-1299.726) (-1299.665) * [-1298.922] (-1300.670) (-1297.401) (-1302.079) -- 0:00:51
      188500 -- (-1298.963) (-1299.581) [-1298.936] (-1299.011) * (-1298.211) (-1300.978) [-1297.400] (-1299.920) -- 0:00:51
      189000 -- (-1301.252) (-1298.314) (-1297.900) [-1298.359] * (-1300.786) (-1300.197) (-1300.916) [-1301.254] -- 0:00:51
      189500 -- [-1301.911] (-1297.624) (-1298.516) (-1299.304) * (-1305.003) (-1300.597) (-1299.977) [-1298.846] -- 0:00:51
      190000 -- (-1298.055) (-1297.327) (-1299.624) [-1301.553] * (-1305.304) (-1300.782) [-1299.368] (-1298.069) -- 0:00:51

      Average standard deviation of split frequencies: 0.016836

      190500 -- [-1301.312] (-1298.706) (-1298.027) (-1299.222) * [-1299.399] (-1299.524) (-1301.401) (-1298.233) -- 0:00:50
      191000 -- [-1299.175] (-1300.128) (-1297.279) (-1299.407) * [-1297.757] (-1300.771) (-1300.381) (-1298.167) -- 0:00:50
      191500 -- (-1299.633) (-1299.462) [-1298.998] (-1298.252) * (-1297.407) (-1298.342) (-1298.343) [-1298.130] -- 0:00:50
      192000 -- (-1300.209) (-1300.867) (-1297.072) [-1298.093] * (-1298.924) [-1298.014] (-1297.877) (-1300.281) -- 0:00:50
      192500 -- (-1299.834) (-1298.425) [-1297.949] (-1301.223) * (-1300.145) (-1298.075) [-1299.704] (-1298.692) -- 0:00:50
      193000 -- (-1300.202) [-1298.047] (-1299.149) (-1299.087) * (-1300.145) (-1298.212) [-1301.318] (-1297.624) -- 0:00:50
      193500 -- (-1299.926) (-1299.261) (-1298.996) [-1300.566] * (-1302.123) (-1299.377) [-1297.210] (-1297.624) -- 0:00:50
      194000 -- [-1300.810] (-1299.391) (-1300.479) (-1297.470) * (-1301.268) (-1297.869) [-1298.561] (-1300.607) -- 0:00:49
      194500 -- (-1298.607) (-1300.025) [-1299.306] (-1297.671) * (-1301.647) (-1297.869) (-1299.489) [-1299.952] -- 0:00:49
      195000 -- (-1299.330) (-1300.728) (-1299.860) [-1298.599] * (-1300.592) [-1297.967] (-1297.976) (-1299.233) -- 0:00:49

      Average standard deviation of split frequencies: 0.016378

      195500 -- [-1299.264] (-1298.110) (-1297.861) (-1297.584) * (-1300.891) (-1297.635) [-1297.453] (-1300.511) -- 0:00:49
      196000 -- [-1299.656] (-1298.110) (-1299.698) (-1298.734) * (-1305.541) [-1297.635] (-1299.073) (-1298.403) -- 0:00:49
      196500 -- [-1298.002] (-1297.990) (-1300.393) (-1300.443) * (-1300.686) [-1297.640] (-1297.386) (-1298.480) -- 0:00:49
      197000 -- [-1298.112] (-1302.628) (-1299.083) (-1300.834) * (-1299.282) (-1301.463) [-1298.043] (-1303.091) -- 0:00:52
      197500 -- (-1300.573) (-1299.025) (-1301.541) [-1299.827] * (-1300.020) [-1299.607] (-1299.178) (-1298.348) -- 0:00:52
      198000 -- (-1298.144) (-1298.868) [-1298.550] (-1298.456) * (-1301.098) (-1299.098) [-1300.345] (-1298.779) -- 0:00:52
      198500 -- (-1298.438) (-1298.824) (-1300.772) [-1297.995] * (-1301.127) [-1301.506] (-1300.825) (-1298.482) -- 0:00:52
      199000 -- (-1300.306) (-1298.506) [-1302.605] (-1298.037) * (-1300.219) (-1300.076) (-1300.237) [-1299.433] -- 0:00:52
      199500 -- (-1299.259) (-1298.937) (-1304.058) [-1299.654] * (-1299.795) (-1298.324) (-1299.890) [-1300.561] -- 0:00:52
      200000 -- (-1299.249) (-1300.330) [-1303.181] (-1298.952) * (-1302.615) (-1298.820) [-1299.014] (-1298.522) -- 0:00:51

      Average standard deviation of split frequencies: 0.016444

      200500 -- (-1298.427) (-1300.322) (-1305.297) [-1298.498] * (-1301.886) [-1300.008] (-1298.450) (-1302.732) -- 0:00:51
      201000 -- (-1300.359) (-1300.635) (-1299.145) [-1297.258] * (-1300.585) [-1301.178] (-1300.068) (-1299.804) -- 0:00:51
      201500 -- (-1301.960) [-1300.155] (-1298.318) (-1303.006) * (-1300.303) (-1301.044) [-1300.005] (-1298.608) -- 0:00:51
      202000 -- (-1299.394) (-1298.392) (-1299.025) [-1299.629] * (-1300.196) (-1297.617) (-1298.352) [-1297.671] -- 0:00:51
      202500 -- (-1299.162) (-1300.449) [-1299.075] (-1297.904) * [-1300.193] (-1299.828) (-1303.825) (-1296.962) -- 0:00:51
      203000 -- (-1298.834) [-1300.507] (-1300.878) (-1298.517) * (-1301.063) (-1298.628) (-1299.686) [-1299.162] -- 0:00:51
      203500 -- (-1299.162) (-1298.084) [-1300.067] (-1298.276) * (-1301.983) (-1298.444) [-1300.358] (-1298.340) -- 0:00:50
      204000 -- (-1301.071) (-1301.346) (-1297.497) [-1301.529] * (-1299.426) [-1298.607] (-1299.151) (-1297.721) -- 0:00:50
      204500 -- (-1297.795) (-1300.383) (-1298.721) [-1297.555] * (-1299.781) (-1299.779) [-1300.131] (-1298.415) -- 0:00:50
      205000 -- (-1298.079) (-1301.437) [-1297.385] (-1302.548) * (-1299.976) [-1299.931] (-1299.525) (-1301.616) -- 0:00:50

      Average standard deviation of split frequencies: 0.015692

      205500 -- [-1299.421] (-1299.492) (-1298.544) (-1297.572) * (-1299.280) [-1299.170] (-1299.395) (-1298.097) -- 0:00:50
      206000 -- (-1298.624) [-1299.263] (-1297.358) (-1300.723) * (-1299.264) (-1297.311) (-1302.596) [-1298.105] -- 0:00:50
      206500 -- (-1298.679) [-1299.333] (-1299.186) (-1298.774) * (-1299.239) (-1300.168) (-1297.697) [-1300.390] -- 0:00:49
      207000 -- (-1298.546) [-1300.380] (-1298.097) (-1301.366) * (-1303.099) (-1300.500) [-1297.337] (-1298.720) -- 0:00:49
      207500 -- (-1297.454) [-1299.164] (-1298.064) (-1302.431) * (-1298.563) (-1300.542) (-1297.646) [-1301.977] -- 0:00:49
      208000 -- (-1298.015) [-1299.164] (-1297.938) (-1302.171) * (-1299.167) (-1299.454) (-1298.564) [-1301.768] -- 0:00:49
      208500 -- (-1297.454) (-1298.842) (-1297.935) [-1301.596] * (-1299.338) [-1297.952] (-1299.883) (-1301.809) -- 0:00:49
      209000 -- (-1297.453) (-1300.545) [-1298.538] (-1299.295) * (-1300.110) (-1298.356) [-1297.682] (-1299.962) -- 0:00:49
      209500 -- (-1297.086) (-1299.723) [-1298.667] (-1298.688) * [-1299.290] (-1297.257) (-1297.928) (-1300.105) -- 0:00:49
      210000 -- (-1297.959) (-1299.477) [-1299.567] (-1303.878) * (-1299.549) (-1298.175) [-1298.454] (-1300.227) -- 0:00:48

      Average standard deviation of split frequencies: 0.016135

      210500 -- (-1298.170) (-1299.685) [-1298.183] (-1302.442) * (-1297.406) (-1298.937) [-1299.042] (-1300.104) -- 0:00:48
      211000 -- [-1298.082] (-1297.869) (-1299.811) (-1302.720) * (-1299.706) [-1299.743] (-1299.040) (-1297.220) -- 0:00:48
      211500 -- (-1301.071) (-1302.486) [-1299.095] (-1302.716) * [-1297.056] (-1298.964) (-1298.687) (-1301.487) -- 0:00:48
      212000 -- [-1300.131] (-1301.358) (-1300.756) (-1300.881) * [-1299.009] (-1299.187) (-1299.445) (-1301.197) -- 0:00:48
      212500 -- (-1299.741) (-1307.697) [-1299.133] (-1301.083) * (-1299.201) (-1299.505) (-1302.548) [-1300.275] -- 0:00:51
      213000 -- (-1299.710) (-1299.188) [-1300.348] (-1304.312) * (-1300.060) (-1299.460) (-1301.093) [-1299.254] -- 0:00:51
      213500 -- [-1298.755] (-1301.033) (-1304.382) (-1300.650) * (-1297.314) [-1301.700] (-1299.968) (-1299.314) -- 0:00:51
      214000 -- (-1300.015) (-1300.490) [-1299.792] (-1298.567) * (-1297.111) (-1299.893) (-1302.538) [-1303.564] -- 0:00:51
      214500 -- (-1300.249) [-1301.482] (-1300.072) (-1298.860) * (-1297.111) [-1299.681] (-1301.224) (-1300.160) -- 0:00:51
      215000 -- [-1298.309] (-1303.360) (-1298.778) (-1298.363) * (-1297.954) [-1297.856] (-1299.486) (-1298.358) -- 0:00:51

      Average standard deviation of split frequencies: 0.014186

      215500 -- (-1298.094) [-1298.451] (-1299.137) (-1301.022) * (-1298.239) (-1299.011) (-1305.251) [-1299.833] -- 0:00:50
      216000 -- (-1299.712) (-1300.064) [-1301.116] (-1301.293) * [-1297.668] (-1298.225) (-1298.723) (-1299.377) -- 0:00:50
      216500 -- (-1299.399) [-1305.283] (-1299.614) (-1297.770) * [-1299.934] (-1303.982) (-1298.507) (-1298.586) -- 0:00:50
      217000 -- [-1299.046] (-1306.065) (-1299.757) (-1300.188) * (-1298.351) [-1298.806] (-1299.372) (-1299.187) -- 0:00:50
      217500 -- (-1307.190) (-1306.631) [-1299.791] (-1302.082) * (-1299.936) (-1301.754) (-1299.267) [-1299.530] -- 0:00:50
      218000 -- (-1298.930) (-1298.750) [-1298.992] (-1300.817) * [-1298.531] (-1300.534) (-1306.271) (-1300.963) -- 0:00:50
      218500 -- (-1299.126) (-1299.900) (-1297.934) [-1299.900] * (-1298.595) (-1300.748) [-1301.743] (-1300.396) -- 0:00:50
      219000 -- (-1299.408) (-1301.847) (-1301.151) [-1297.409] * [-1299.170] (-1299.528) (-1300.211) (-1298.904) -- 0:00:49
      219500 -- [-1298.563] (-1299.294) (-1301.225) (-1298.185) * (-1299.262) (-1299.644) [-1300.324] (-1298.664) -- 0:00:49
      220000 -- (-1300.643) (-1298.537) (-1299.843) [-1298.143] * (-1300.187) (-1299.055) [-1299.687] (-1298.914) -- 0:00:49

      Average standard deviation of split frequencies: 0.015629

      220500 -- (-1302.314) (-1297.870) (-1301.887) [-1298.260] * (-1300.909) [-1299.546] (-1300.195) (-1297.289) -- 0:00:49
      221000 -- (-1297.301) (-1298.914) (-1301.150) [-1297.995] * (-1302.084) (-1299.235) [-1299.908] (-1298.964) -- 0:00:49
      221500 -- (-1298.761) (-1297.588) [-1298.115] (-1297.250) * (-1303.468) [-1300.452] (-1300.060) (-1298.892) -- 0:00:49
      222000 -- [-1301.329] (-1301.392) (-1300.285) (-1297.146) * (-1302.545) (-1298.661) (-1298.388) [-1301.137] -- 0:00:49
      222500 -- (-1300.804) (-1300.925) [-1299.300] (-1298.327) * (-1299.367) [-1297.744] (-1299.853) (-1300.317) -- 0:00:48
      223000 -- (-1299.949) [-1299.380] (-1302.152) (-1303.845) * (-1301.351) (-1301.700) [-1299.516] (-1299.606) -- 0:00:48
      223500 -- (-1298.689) (-1300.582) (-1301.678) [-1299.246] * (-1303.119) (-1300.845) [-1298.892] (-1299.718) -- 0:00:48
      224000 -- (-1302.150) (-1304.825) (-1300.331) [-1298.608] * [-1297.637] (-1305.034) (-1298.503) (-1301.022) -- 0:00:48
      224500 -- [-1302.221] (-1298.767) (-1301.093) (-1298.335) * (-1297.652) [-1299.769] (-1298.572) (-1302.944) -- 0:00:48
      225000 -- [-1298.041] (-1297.147) (-1297.836) (-1298.673) * (-1298.923) (-1297.902) (-1302.445) [-1299.615] -- 0:00:48

      Average standard deviation of split frequencies: 0.015331

      225500 -- [-1297.930] (-1298.299) (-1297.201) (-1297.932) * [-1298.313] (-1299.039) (-1301.050) (-1299.609) -- 0:00:51
      226000 -- (-1301.697) (-1299.169) (-1297.045) [-1299.018] * [-1298.615] (-1301.336) (-1300.889) (-1302.591) -- 0:00:51
      226500 -- (-1299.023) [-1297.292] (-1298.803) (-1302.341) * (-1298.874) (-1301.167) (-1299.707) [-1300.340] -- 0:00:51
      227000 -- [-1298.482] (-1301.136) (-1301.494) (-1300.218) * (-1299.286) [-1298.933] (-1299.876) (-1300.083) -- 0:00:51
      227500 -- (-1302.590) [-1297.721] (-1299.879) (-1298.270) * (-1300.384) [-1300.414] (-1298.117) (-1301.975) -- 0:00:50
      228000 -- (-1299.154) (-1297.881) (-1298.600) [-1299.036] * (-1304.876) [-1301.258] (-1299.588) (-1298.786) -- 0:00:50
      228500 -- [-1297.952] (-1298.163) (-1299.889) (-1298.712) * (-1299.621) (-1300.055) (-1299.475) [-1299.919] -- 0:00:50
      229000 -- (-1297.399) (-1297.872) [-1300.770] (-1298.871) * (-1298.684) [-1301.765] (-1299.682) (-1299.250) -- 0:00:50
      229500 -- (-1297.367) (-1299.123) (-1301.159) [-1298.869] * [-1299.086] (-1302.214) (-1301.312) (-1299.423) -- 0:00:50
      230000 -- [-1302.631] (-1298.226) (-1302.153) (-1302.438) * (-1299.086) (-1298.223) (-1300.867) [-1302.893] -- 0:00:50

      Average standard deviation of split frequencies: 0.015634

      230500 -- (-1303.251) (-1298.766) (-1302.309) [-1302.475] * (-1302.564) (-1298.030) (-1302.548) [-1299.420] -- 0:00:50
      231000 -- (-1301.527) (-1297.668) [-1301.195] (-1303.265) * (-1301.243) (-1299.188) (-1304.647) [-1299.238] -- 0:00:49
      231500 -- (-1300.453) (-1298.595) (-1299.409) [-1299.912] * [-1298.487] (-1298.078) (-1300.856) (-1300.426) -- 0:00:49
      232000 -- (-1305.208) [-1298.742] (-1298.569) (-1302.815) * [-1300.871] (-1303.356) (-1297.656) (-1298.204) -- 0:00:49
      232500 -- (-1298.247) (-1299.345) [-1297.839] (-1299.810) * (-1300.361) [-1297.619] (-1297.381) (-1298.194) -- 0:00:49
      233000 -- (-1298.127) (-1301.416) [-1297.810] (-1299.030) * (-1301.213) (-1298.714) [-1297.571] (-1298.307) -- 0:00:49
      233500 -- [-1298.603] (-1300.338) (-1300.563) (-1299.376) * (-1298.075) (-1300.267) [-1298.797] (-1298.546) -- 0:00:49
      234000 -- [-1298.702] (-1300.527) (-1299.888) (-1298.754) * [-1300.285] (-1300.115) (-1298.462) (-1298.335) -- 0:00:49
      234500 -- (-1301.368) (-1299.335) (-1301.847) [-1298.659] * [-1302.927] (-1301.096) (-1299.091) (-1298.295) -- 0:00:48
      235000 -- (-1300.174) [-1298.547] (-1298.042) (-1299.547) * (-1300.850) (-1302.648) (-1301.022) [-1297.492] -- 0:00:48

      Average standard deviation of split frequencies: 0.016821

      235500 -- (-1298.981) (-1299.032) [-1297.509] (-1301.125) * (-1299.091) (-1300.520) [-1300.600] (-1298.360) -- 0:00:48
      236000 -- (-1299.406) [-1302.769] (-1297.956) (-1300.199) * (-1297.401) (-1300.396) [-1298.835] (-1298.380) -- 0:00:48
      236500 -- (-1300.287) (-1298.181) [-1299.063] (-1299.210) * (-1298.038) (-1298.930) [-1298.828] (-1300.204) -- 0:00:48
      237000 -- (-1298.889) [-1300.744] (-1300.335) (-1305.797) * (-1297.672) (-1297.755) (-1298.311) [-1300.077] -- 0:00:48
      237500 -- (-1298.891) [-1297.457] (-1300.266) (-1300.827) * (-1298.045) (-1297.356) (-1298.338) [-1299.430] -- 0:00:48
      238000 -- (-1298.818) (-1303.083) (-1298.993) [-1299.195] * (-1299.579) (-1299.122) (-1304.649) [-1299.777] -- 0:00:48
      238500 -- (-1298.883) [-1301.459] (-1299.508) (-1300.549) * (-1299.205) [-1298.739] (-1298.644) (-1300.261) -- 0:00:47
      239000 -- (-1301.301) (-1300.555) (-1299.073) [-1301.921] * [-1297.780] (-1299.560) (-1299.398) (-1300.339) -- 0:00:47
      239500 -- (-1299.806) (-1300.691) (-1302.597) [-1298.236] * (-1299.376) (-1297.950) [-1304.133] (-1300.145) -- 0:00:47
      240000 -- (-1298.877) (-1301.377) (-1300.622) [-1297.794] * (-1298.059) (-1297.985) (-1302.617) [-1300.421] -- 0:00:47

      Average standard deviation of split frequencies: 0.016214

      240500 -- [-1299.635] (-1299.801) (-1301.008) (-1302.180) * [-1297.908] (-1298.274) (-1299.052) (-1300.127) -- 0:00:47
      241000 -- (-1300.645) (-1300.715) (-1300.380) [-1298.249] * [-1298.971] (-1298.647) (-1300.634) (-1300.485) -- 0:00:47
      241500 -- (-1301.882) (-1305.712) [-1301.704] (-1298.231) * (-1300.759) (-1299.651) [-1297.473] (-1297.669) -- 0:00:50
      242000 -- (-1300.721) [-1300.699] (-1305.348) (-1297.232) * (-1300.346) (-1299.576) (-1299.907) [-1299.454] -- 0:00:50
      242500 -- (-1301.273) (-1300.058) [-1299.552] (-1297.755) * (-1299.348) [-1300.054] (-1298.681) (-1301.229) -- 0:00:49
      243000 -- (-1303.784) [-1299.874] (-1300.989) (-1298.900) * (-1297.482) (-1301.301) [-1297.923] (-1301.248) -- 0:00:49
      243500 -- [-1302.476] (-1300.205) (-1303.486) (-1297.854) * (-1297.628) (-1300.308) [-1298.437] (-1302.418) -- 0:00:49
      244000 -- (-1299.969) (-1299.689) (-1300.770) [-1301.803] * (-1297.540) (-1298.673) [-1297.555] (-1299.250) -- 0:00:49
      244500 -- [-1299.255] (-1300.050) (-1298.850) (-1300.143) * (-1297.710) (-1299.629) [-1297.717] (-1299.062) -- 0:00:49
      245000 -- (-1297.416) (-1301.531) (-1299.187) [-1298.087] * (-1297.320) (-1300.261) (-1299.480) [-1300.089] -- 0:00:49

      Average standard deviation of split frequencies: 0.016036

      245500 -- (-1300.288) (-1298.522) (-1298.848) [-1299.396] * (-1299.790) (-1298.573) [-1298.882] (-1301.421) -- 0:00:49
      246000 -- [-1301.054] (-1302.806) (-1299.155) (-1299.903) * [-1298.055] (-1298.328) (-1301.910) (-1298.581) -- 0:00:49
      246500 -- [-1300.678] (-1302.280) (-1299.351) (-1298.474) * (-1298.495) (-1298.103) (-1302.893) [-1297.718] -- 0:00:48
      247000 -- (-1297.405) (-1304.909) [-1298.487] (-1301.250) * [-1299.310] (-1300.133) (-1299.531) (-1298.377) -- 0:00:48
      247500 -- (-1299.183) [-1297.485] (-1300.848) (-1298.442) * [-1297.807] (-1302.466) (-1298.664) (-1297.766) -- 0:00:48
      248000 -- (-1298.415) (-1297.009) (-1301.599) [-1298.718] * (-1298.419) (-1299.602) (-1299.083) [-1301.320] -- 0:00:48
      248500 -- (-1299.063) (-1297.004) (-1300.792) [-1299.287] * (-1303.211) (-1297.582) [-1297.833] (-1297.787) -- 0:00:48
      249000 -- (-1300.865) (-1297.283) (-1299.279) [-1298.963] * (-1303.784) (-1297.582) [-1297.782] (-1298.305) -- 0:00:48
      249500 -- (-1302.017) (-1297.576) [-1303.501] (-1307.072) * (-1298.302) [-1297.574] (-1298.252) (-1299.603) -- 0:00:48
      250000 -- (-1300.512) (-1299.006) (-1305.628) [-1301.678] * (-1299.004) (-1298.532) (-1298.222) [-1298.073] -- 0:00:48

      Average standard deviation of split frequencies: 0.015985

      250500 -- (-1300.285) (-1298.424) [-1301.184] (-1299.352) * (-1299.695) (-1301.291) (-1300.180) [-1298.073] -- 0:00:47
      251000 -- (-1300.255) [-1297.407] (-1301.737) (-1303.242) * [-1298.548] (-1301.977) (-1300.154) (-1299.829) -- 0:00:47
      251500 -- (-1300.597) [-1297.267] (-1301.559) (-1307.656) * [-1299.320] (-1298.072) (-1298.260) (-1298.168) -- 0:00:47
      252000 -- [-1298.466] (-1298.155) (-1301.491) (-1305.685) * [-1298.404] (-1299.319) (-1299.653) (-1302.629) -- 0:00:47
      252500 -- (-1300.365) [-1298.760] (-1300.943) (-1300.150) * (-1298.394) (-1300.573) (-1298.466) [-1301.105] -- 0:00:47
      253000 -- (-1301.294) (-1297.424) [-1300.080] (-1300.039) * (-1297.970) [-1302.421] (-1297.874) (-1304.872) -- 0:00:47
      253500 -- (-1300.192) (-1298.514) (-1299.541) [-1299.891] * [-1300.888] (-1303.093) (-1299.345) (-1300.998) -- 0:00:47
      254000 -- (-1297.549) (-1297.488) (-1300.143) [-1299.121] * (-1311.240) [-1300.738] (-1299.786) (-1304.083) -- 0:00:46
      254500 -- [-1297.446] (-1298.812) (-1298.405) (-1298.092) * [-1298.491] (-1300.108) (-1298.339) (-1299.812) -- 0:00:46
      255000 -- [-1297.990] (-1297.576) (-1298.553) (-1299.615) * (-1297.892) (-1298.007) (-1297.601) [-1299.807] -- 0:00:46

      Average standard deviation of split frequencies: 0.016164

      255500 -- (-1299.161) (-1298.311) (-1299.966) [-1297.742] * (-1298.135) [-1298.455] (-1298.199) (-1300.533) -- 0:00:46
      256000 -- [-1298.584] (-1299.035) (-1297.636) (-1297.784) * (-1298.165) [-1298.045] (-1298.866) (-1299.982) -- 0:00:46
      256500 -- (-1300.082) (-1300.346) [-1297.599] (-1297.623) * (-1298.817) (-1299.782) [-1299.496] (-1301.066) -- 0:00:46
      257000 -- (-1300.866) (-1297.893) (-1297.970) [-1300.223] * [-1300.221] (-1298.034) (-1299.521) (-1299.836) -- 0:00:46
      257500 -- [-1300.079] (-1298.531) (-1299.116) (-1298.842) * (-1300.381) [-1298.034] (-1298.859) (-1300.682) -- 0:00:49
      258000 -- (-1299.863) [-1299.080] (-1297.744) (-1303.161) * (-1298.624) [-1300.436] (-1299.741) (-1302.182) -- 0:00:48
      258500 -- (-1298.559) [-1299.392] (-1301.847) (-1297.665) * (-1298.983) (-1298.709) [-1302.433] (-1300.407) -- 0:00:48
      259000 -- (-1301.695) [-1302.561] (-1299.540) (-1300.645) * [-1298.790] (-1297.893) (-1300.345) (-1299.789) -- 0:00:48
      259500 -- (-1298.248) (-1300.412) [-1297.726] (-1298.783) * [-1297.529] (-1299.117) (-1298.780) (-1298.014) -- 0:00:48
      260000 -- (-1301.669) (-1300.252) [-1299.874] (-1298.789) * (-1297.700) [-1302.506] (-1297.746) (-1300.084) -- 0:00:48

      Average standard deviation of split frequencies: 0.014367

      260500 -- (-1296.925) (-1298.837) [-1299.414] (-1297.921) * [-1299.946] (-1300.188) (-1297.987) (-1299.603) -- 0:00:48
      261000 -- (-1297.316) [-1300.180] (-1300.817) (-1298.926) * [-1301.658] (-1300.271) (-1297.460) (-1301.374) -- 0:00:48
      261500 -- (-1304.525) [-1302.533] (-1299.210) (-1300.866) * (-1298.094) (-1299.097) (-1297.688) [-1300.920] -- 0:00:48
      262000 -- (-1300.752) (-1302.759) [-1299.272] (-1298.366) * (-1298.852) [-1299.179] (-1298.896) (-1301.972) -- 0:00:47
      262500 -- (-1298.086) [-1298.594] (-1302.489) (-1299.038) * (-1298.433) (-1304.520) (-1298.128) [-1300.787] -- 0:00:47
      263000 -- (-1298.036) (-1298.492) [-1300.804] (-1300.031) * (-1298.580) (-1302.194) [-1298.163] (-1300.910) -- 0:00:47
      263500 -- (-1300.981) [-1298.666] (-1302.481) (-1299.199) * (-1300.398) (-1302.998) [-1298.122] (-1303.945) -- 0:00:47
      264000 -- [-1298.138] (-1303.594) (-1299.734) (-1297.239) * (-1302.327) (-1303.967) [-1298.229] (-1307.036) -- 0:00:47
      264500 -- (-1297.678) (-1297.918) [-1297.911] (-1298.444) * (-1299.747) (-1299.318) [-1298.863] (-1298.145) -- 0:00:47
      265000 -- [-1299.142] (-1298.262) (-1300.521) (-1299.711) * (-1298.424) (-1299.394) (-1301.804) [-1297.959] -- 0:00:47

      Average standard deviation of split frequencies: 0.014457

      265500 -- [-1298.520] (-1301.894) (-1300.300) (-1301.594) * (-1302.192) [-1300.076] (-1299.409) (-1297.761) -- 0:00:47
      266000 -- (-1297.948) [-1297.602] (-1300.388) (-1306.629) * [-1301.792] (-1302.809) (-1297.760) (-1303.939) -- 0:00:46
      266500 -- [-1297.631] (-1300.167) (-1298.065) (-1302.813) * (-1303.527) [-1298.691] (-1301.476) (-1300.346) -- 0:00:46
      267000 -- (-1299.101) (-1297.998) [-1297.019] (-1304.225) * (-1303.346) (-1299.126) (-1298.751) [-1298.778] -- 0:00:46
      267500 -- (-1299.121) [-1298.217] (-1297.777) (-1303.511) * (-1297.991) [-1298.723] (-1298.139) (-1297.519) -- 0:00:46
      268000 -- (-1299.977) [-1300.130] (-1297.968) (-1299.680) * (-1301.683) (-1298.829) [-1298.548] (-1298.774) -- 0:00:46
      268500 -- [-1298.257] (-1302.458) (-1298.849) (-1299.550) * (-1298.291) (-1298.638) [-1298.845] (-1299.371) -- 0:00:46
      269000 -- (-1300.009) (-1298.909) [-1298.354] (-1301.548) * (-1300.621) (-1299.413) [-1297.393] (-1299.821) -- 0:00:46
      269500 -- [-1298.009] (-1299.093) (-1298.562) (-1301.334) * (-1300.667) (-1301.866) [-1300.050] (-1300.262) -- 0:00:46
      270000 -- [-1300.816] (-1300.370) (-1299.410) (-1298.524) * [-1301.606] (-1301.368) (-1300.346) (-1305.228) -- 0:00:45

      Average standard deviation of split frequencies: 0.014666

      270500 -- [-1300.356] (-1298.604) (-1300.371) (-1298.516) * [-1300.876] (-1298.263) (-1297.980) (-1298.540) -- 0:00:45
      271000 -- (-1298.735) (-1297.900) [-1299.401] (-1299.898) * (-1297.813) (-1297.931) [-1298.481] (-1299.131) -- 0:00:45
      271500 -- (-1298.614) (-1298.433) [-1298.445] (-1300.796) * [-1299.132] (-1297.974) (-1297.147) (-1298.279) -- 0:00:45
      272000 -- (-1301.060) [-1300.002] (-1299.640) (-1302.848) * [-1298.729] (-1297.864) (-1297.281) (-1299.641) -- 0:00:45
      272500 -- (-1299.110) [-1297.873] (-1300.593) (-1297.571) * (-1301.638) [-1297.545] (-1298.037) (-1297.766) -- 0:00:45
      273000 -- (-1301.928) (-1298.502) (-1299.069) [-1299.366] * (-1299.730) [-1297.422] (-1298.669) (-1297.139) -- 0:00:45
      273500 -- (-1304.631) (-1297.498) (-1298.789) [-1300.048] * (-1298.861) (-1298.568) (-1301.051) [-1297.198] -- 0:00:45
      274000 -- [-1300.321] (-1298.970) (-1298.411) (-1297.613) * (-1298.785) (-1298.972) (-1299.585) [-1297.578] -- 0:00:47
      274500 -- [-1303.788] (-1297.326) (-1300.063) (-1300.098) * (-1299.648) (-1300.694) [-1297.887] (-1300.399) -- 0:00:47
      275000 -- (-1300.938) [-1297.305] (-1301.322) (-1297.764) * (-1303.758) (-1301.928) [-1298.649] (-1299.516) -- 0:00:47

      Average standard deviation of split frequencies: 0.014897

      275500 -- [-1302.781] (-1301.078) (-1299.981) (-1297.856) * (-1300.061) [-1297.584] (-1301.044) (-1301.554) -- 0:00:47
      276000 -- [-1301.060] (-1300.357) (-1308.142) (-1300.137) * [-1302.001] (-1299.421) (-1298.909) (-1300.017) -- 0:00:47
      276500 -- (-1299.053) [-1298.669] (-1297.473) (-1301.421) * (-1299.714) [-1298.600] (-1301.795) (-1301.204) -- 0:00:47
      277000 -- (-1297.597) (-1298.495) [-1297.468] (-1299.830) * (-1298.690) [-1298.169] (-1300.179) (-1300.702) -- 0:00:46
      277500 -- (-1298.901) (-1298.584) [-1297.856] (-1299.358) * [-1300.127] (-1300.561) (-1299.644) (-1302.600) -- 0:00:46
      278000 -- (-1297.276) (-1299.449) (-1299.485) [-1298.448] * [-1298.964] (-1298.699) (-1301.143) (-1306.405) -- 0:00:46
      278500 -- (-1297.655) [-1300.723] (-1297.690) (-1302.042) * (-1299.599) [-1298.646] (-1301.900) (-1302.604) -- 0:00:46
      279000 -- (-1299.361) (-1300.067) [-1297.959] (-1298.836) * (-1302.761) [-1297.667] (-1303.802) (-1301.056) -- 0:00:46
      279500 -- (-1298.884) (-1304.445) [-1299.210] (-1298.258) * (-1298.299) [-1297.088] (-1300.695) (-1297.135) -- 0:00:46
      280000 -- (-1298.878) (-1298.564) (-1303.175) [-1298.129] * (-1299.148) (-1298.017) [-1299.658] (-1300.704) -- 0:00:46

      Average standard deviation of split frequencies: 0.013832

      280500 -- (-1298.437) (-1298.611) (-1297.497) [-1301.763] * [-1298.628] (-1297.962) (-1299.186) (-1297.760) -- 0:00:46
      281000 -- (-1297.189) (-1298.929) [-1303.373] (-1300.322) * (-1298.821) (-1297.630) [-1297.968] (-1297.625) -- 0:00:46
      281500 -- (-1298.217) (-1299.711) [-1298.371] (-1298.341) * (-1301.072) [-1297.638] (-1297.909) (-1298.740) -- 0:00:45
      282000 -- (-1299.059) (-1299.588) [-1299.442] (-1299.061) * [-1301.102] (-1300.217) (-1299.708) (-1298.500) -- 0:00:45
      282500 -- [-1300.730] (-1299.018) (-1297.421) (-1300.331) * (-1299.551) [-1298.411] (-1297.132) (-1300.240) -- 0:00:45
      283000 -- (-1299.165) [-1297.918] (-1297.413) (-1297.658) * (-1300.055) (-1300.558) [-1299.518] (-1299.530) -- 0:00:45
      283500 -- [-1297.772] (-1298.448) (-1297.702) (-1297.655) * (-1300.361) [-1298.964] (-1297.448) (-1297.893) -- 0:00:45
      284000 -- (-1300.330) [-1299.970] (-1300.233) (-1297.418) * [-1300.278] (-1297.844) (-1297.843) (-1297.909) -- 0:00:45
      284500 -- (-1299.530) [-1299.002] (-1300.965) (-1297.320) * (-1298.369) (-1300.718) [-1298.140] (-1298.952) -- 0:00:45
      285000 -- (-1298.714) (-1298.237) (-1299.107) [-1299.672] * [-1299.464] (-1298.578) (-1298.600) (-1300.403) -- 0:00:45

      Average standard deviation of split frequencies: 0.014544

      285500 -- [-1298.455] (-1297.250) (-1298.496) (-1298.183) * (-1298.455) (-1300.719) [-1297.638] (-1299.315) -- 0:00:45
      286000 -- (-1299.161) (-1297.281) [-1297.280] (-1298.236) * [-1298.340] (-1298.367) (-1297.688) (-1299.368) -- 0:00:44
      286500 -- [-1301.250] (-1297.322) (-1298.133) (-1303.422) * (-1297.489) (-1300.488) [-1297.815] (-1298.850) -- 0:00:44
      287000 -- (-1297.978) (-1303.946) [-1299.836] (-1302.714) * (-1301.173) [-1303.672] (-1297.974) (-1301.226) -- 0:00:44
      287500 -- (-1301.767) (-1299.310) (-1298.416) [-1300.477] * (-1302.275) (-1297.650) (-1297.325) [-1299.289] -- 0:00:44
      288000 -- (-1302.116) [-1299.291] (-1299.491) (-1300.960) * (-1308.224) (-1298.453) (-1297.403) [-1299.303] -- 0:00:44
      288500 -- (-1300.816) (-1297.891) (-1298.914) [-1299.526] * (-1301.264) (-1298.779) [-1298.388] (-1301.987) -- 0:00:46
      289000 -- (-1299.085) (-1300.703) [-1297.866] (-1299.340) * (-1305.326) (-1298.491) [-1297.716] (-1298.473) -- 0:00:46
      289500 -- (-1297.791) (-1302.793) [-1298.664] (-1306.811) * (-1299.739) (-1298.267) [-1297.550] (-1297.912) -- 0:00:46
      290000 -- (-1299.412) (-1301.992) [-1298.610] (-1302.715) * (-1299.744) (-1297.245) (-1298.886) [-1299.075] -- 0:00:46

      Average standard deviation of split frequencies: 0.014692

      290500 -- (-1296.826) [-1299.136] (-1298.326) (-1298.774) * (-1298.702) (-1300.657) [-1299.064] (-1297.339) -- 0:00:46
      291000 -- (-1299.592) (-1298.447) [-1300.698] (-1299.148) * [-1298.698] (-1297.422) (-1298.293) (-1301.259) -- 0:00:46
      291500 -- (-1307.081) (-1299.363) (-1298.398) [-1299.760] * [-1297.856] (-1299.520) (-1298.452) (-1300.891) -- 0:00:46
      292000 -- (-1301.994) (-1298.656) [-1298.370] (-1300.994) * (-1298.586) (-1300.939) (-1298.108) [-1301.166] -- 0:00:46
      292500 -- (-1301.571) (-1298.247) [-1298.596] (-1300.353) * (-1298.384) (-1299.276) (-1299.829) [-1299.191] -- 0:00:45
      293000 -- (-1300.462) (-1298.320) [-1297.578] (-1298.308) * (-1298.379) [-1300.096] (-1298.204) (-1299.133) -- 0:00:45
      293500 -- (-1302.702) (-1299.715) [-1297.770] (-1298.025) * (-1297.628) (-1299.017) [-1298.699] (-1304.461) -- 0:00:45
      294000 -- [-1297.495] (-1298.761) (-1298.162) (-1297.107) * (-1298.693) (-1297.773) [-1298.054] (-1301.287) -- 0:00:45
      294500 -- (-1298.506) (-1297.485) [-1300.426] (-1301.187) * [-1299.703] (-1297.762) (-1297.736) (-1301.313) -- 0:00:45
      295000 -- (-1298.782) (-1300.270) [-1298.157] (-1302.458) * (-1298.619) [-1298.684] (-1297.724) (-1300.291) -- 0:00:45

      Average standard deviation of split frequencies: 0.015270

      295500 -- [-1297.988] (-1300.215) (-1298.156) (-1301.626) * (-1299.562) [-1298.213] (-1299.589) (-1301.790) -- 0:00:45
      296000 -- (-1298.100) (-1299.109) [-1301.232] (-1301.657) * (-1298.466) (-1299.841) (-1299.827) [-1298.009] -- 0:00:45
      296500 -- (-1299.607) (-1300.118) (-1300.081) [-1299.198] * (-1297.941) (-1298.146) (-1299.415) [-1298.496] -- 0:00:45
      297000 -- (-1298.136) (-1300.358) [-1298.690] (-1302.278) * [-1297.965] (-1299.542) (-1298.790) (-1298.331) -- 0:00:44
      297500 -- [-1297.421] (-1299.771) (-1306.859) (-1298.085) * (-1298.238) (-1299.411) [-1304.127] (-1299.661) -- 0:00:44
      298000 -- [-1297.637] (-1297.355) (-1305.358) (-1298.980) * [-1298.008] (-1302.802) (-1301.001) (-1298.473) -- 0:00:44
      298500 -- (-1297.637) (-1298.494) [-1299.156] (-1298.053) * (-1298.131) (-1302.231) (-1298.370) [-1300.089] -- 0:00:44
      299000 -- (-1299.487) [-1300.354] (-1303.643) (-1298.091) * [-1298.163] (-1302.239) (-1297.859) (-1299.426) -- 0:00:44
      299500 -- (-1298.924) (-1298.727) [-1301.847] (-1298.249) * (-1298.359) (-1301.250) [-1297.696] (-1304.598) -- 0:00:44
      300000 -- (-1299.383) [-1300.454] (-1300.442) (-1299.310) * (-1298.480) (-1299.627) [-1299.903] (-1302.063) -- 0:00:44

      Average standard deviation of split frequencies: 0.015033

      300500 -- [-1298.760] (-1300.749) (-1299.857) (-1298.701) * [-1300.654] (-1297.711) (-1299.377) (-1300.698) -- 0:00:44
      301000 -- [-1300.983] (-1297.671) (-1300.819) (-1300.787) * (-1297.848) (-1302.756) (-1298.720) [-1300.913] -- 0:00:44
      301500 -- [-1301.053] (-1298.795) (-1302.702) (-1302.761) * (-1297.540) (-1299.837) (-1299.290) [-1299.552] -- 0:00:44
      302000 -- (-1301.747) (-1298.451) (-1297.751) [-1297.599] * [-1299.346] (-1299.534) (-1299.520) (-1298.115) -- 0:00:43
      302500 -- (-1299.936) [-1299.006] (-1299.544) (-1297.529) * [-1299.543] (-1299.633) (-1303.116) (-1298.731) -- 0:00:43
      303000 -- (-1300.634) [-1299.465] (-1302.027) (-1299.085) * (-1298.312) [-1297.856] (-1302.493) (-1297.856) -- 0:00:43
      303500 -- (-1301.194) [-1298.635] (-1299.216) (-1298.642) * [-1297.763] (-1297.420) (-1306.299) (-1297.920) -- 0:00:43
      304000 -- (-1299.974) (-1299.829) [-1300.280] (-1300.012) * [-1299.791] (-1306.839) (-1302.793) (-1299.204) -- 0:00:45
      304500 -- (-1299.974) (-1299.990) (-1299.476) [-1297.605] * (-1303.432) (-1300.632) [-1300.083] (-1301.267) -- 0:00:45
      305000 -- (-1298.819) (-1300.125) (-1298.504) [-1297.622] * [-1297.616] (-1299.027) (-1299.125) (-1300.646) -- 0:00:45

      Average standard deviation of split frequencies: 0.015496

      305500 -- (-1299.197) (-1298.317) (-1299.570) [-1297.212] * (-1296.956) (-1299.680) (-1298.880) [-1299.171] -- 0:00:45
      306000 -- (-1297.396) (-1298.632) [-1300.228] (-1297.858) * [-1300.262] (-1299.496) (-1300.510) (-1300.332) -- 0:00:45
      306500 -- [-1298.685] (-1298.676) (-1301.547) (-1299.786) * (-1300.954) [-1298.796] (-1301.212) (-1298.768) -- 0:00:45
      307000 -- (-1301.967) (-1299.343) [-1301.216] (-1299.025) * (-1301.725) (-1298.545) [-1298.890] (-1298.446) -- 0:00:45
      307500 -- (-1298.641) (-1300.093) [-1301.441] (-1299.105) * (-1303.956) [-1301.348] (-1298.571) (-1302.172) -- 0:00:45
      308000 -- (-1298.941) (-1298.289) [-1299.273] (-1300.921) * (-1301.708) [-1302.544] (-1299.716) (-1298.606) -- 0:00:44
      308500 -- (-1299.573) (-1300.345) (-1300.665) [-1298.565] * (-1300.617) (-1299.211) [-1299.484] (-1300.607) -- 0:00:44
      309000 -- (-1298.242) [-1298.747] (-1298.665) (-1298.530) * (-1299.529) (-1300.112) [-1300.945] (-1303.274) -- 0:00:44
      309500 -- [-1298.348] (-1298.925) (-1297.917) (-1299.571) * (-1298.471) [-1298.326] (-1302.844) (-1304.265) -- 0:00:44
      310000 -- (-1298.279) [-1301.140] (-1298.489) (-1299.208) * (-1302.099) [-1297.918] (-1299.820) (-1301.038) -- 0:00:44

      Average standard deviation of split frequencies: 0.016156

      310500 -- [-1299.882] (-1299.494) (-1298.134) (-1300.108) * (-1299.785) [-1298.208] (-1299.061) (-1297.567) -- 0:00:44
      311000 -- (-1300.415) (-1301.354) (-1305.450) [-1300.384] * (-1299.700) (-1297.265) (-1299.254) [-1298.881] -- 0:00:44
      311500 -- (-1299.642) [-1302.970] (-1299.786) (-1299.546) * (-1300.557) [-1299.566] (-1298.302) (-1298.043) -- 0:00:44
      312000 -- (-1302.406) (-1301.764) [-1297.414] (-1299.433) * [-1300.363] (-1301.112) (-1303.655) (-1299.851) -- 0:00:44
      312500 -- (-1306.313) (-1303.420) [-1299.117] (-1300.017) * (-1300.601) (-1301.155) (-1299.835) [-1299.715] -- 0:00:44
      313000 -- (-1302.897) [-1298.717] (-1297.591) (-1302.363) * (-1300.263) (-1300.760) (-1299.488) [-1299.743] -- 0:00:43
      313500 -- (-1299.410) (-1302.298) [-1298.329] (-1302.399) * (-1298.355) (-1303.359) (-1300.610) [-1298.901] -- 0:00:43
      314000 -- (-1300.371) (-1301.825) (-1302.232) [-1299.065] * (-1298.562) (-1307.534) (-1301.274) [-1300.036] -- 0:00:43
      314500 -- (-1299.448) (-1299.143) [-1303.577] (-1299.486) * (-1297.917) [-1300.132] (-1303.359) (-1298.516) -- 0:00:43
      315000 -- [-1298.844] (-1298.492) (-1299.554) (-1302.097) * (-1298.148) [-1297.675] (-1301.294) (-1298.856) -- 0:00:43

      Average standard deviation of split frequencies: 0.016936

      315500 -- (-1301.593) (-1298.552) (-1303.382) [-1298.583] * (-1298.279) [-1297.624] (-1301.278) (-1297.870) -- 0:00:43
      316000 -- (-1298.419) [-1303.181] (-1304.794) (-1297.538) * (-1302.091) (-1299.568) [-1299.782] (-1298.692) -- 0:00:43
      316500 -- (-1299.950) [-1301.664] (-1297.795) (-1298.297) * [-1299.619] (-1300.832) (-1301.653) (-1299.501) -- 0:00:43
      317000 -- (-1302.546) (-1301.161) [-1298.709] (-1297.777) * [-1299.015] (-1299.093) (-1301.003) (-1299.714) -- 0:00:43
      317500 -- [-1299.436] (-1299.690) (-1299.968) (-1297.755) * [-1298.981] (-1298.772) (-1302.813) (-1299.933) -- 0:00:42
      318000 -- (-1298.823) (-1300.753) (-1300.278) [-1300.215] * (-1299.324) [-1299.439] (-1300.077) (-1299.021) -- 0:00:42
      318500 -- (-1300.935) [-1299.391] (-1302.543) (-1302.630) * (-1300.711) (-1300.262) [-1298.159] (-1298.193) -- 0:00:42
      319000 -- (-1298.734) (-1301.566) (-1302.052) [-1300.493] * (-1301.458) [-1301.677] (-1301.401) (-1297.570) -- 0:00:42
      319500 -- (-1297.069) [-1304.368] (-1300.467) (-1301.750) * [-1299.254] (-1297.956) (-1300.398) (-1297.994) -- 0:00:42
      320000 -- (-1299.594) [-1300.561] (-1300.858) (-1300.196) * (-1300.190) (-1297.902) [-1302.394] (-1299.383) -- 0:00:44

      Average standard deviation of split frequencies: 0.017554

      320500 -- (-1299.766) (-1300.979) [-1298.934] (-1301.461) * (-1298.700) [-1298.305] (-1301.631) (-1298.512) -- 0:00:44
      321000 -- (-1299.297) (-1302.167) [-1297.785] (-1300.830) * [-1299.270] (-1297.705) (-1300.422) (-1300.192) -- 0:00:44
      321500 -- (-1299.323) (-1298.618) (-1299.884) [-1300.072] * [-1299.829] (-1299.108) (-1299.171) (-1298.625) -- 0:00:44
      322000 -- (-1299.352) (-1299.087) [-1298.359] (-1300.471) * (-1299.737) (-1300.193) [-1299.305] (-1299.700) -- 0:00:44
      322500 -- (-1303.381) [-1299.109] (-1299.185) (-1299.210) * [-1299.273] (-1299.522) (-1297.816) (-1297.209) -- 0:00:44
      323000 -- (-1301.434) (-1298.734) (-1298.811) [-1298.187] * (-1299.180) (-1298.450) [-1303.542] (-1297.640) -- 0:00:44
      323500 -- (-1300.229) [-1299.554] (-1297.668) (-1302.156) * (-1299.168) (-1298.011) (-1301.732) [-1298.634] -- 0:00:43
      324000 -- (-1300.171) [-1299.038] (-1301.174) (-1302.998) * (-1300.226) [-1298.144] (-1298.390) (-1297.774) -- 0:00:43
      324500 -- [-1297.373] (-1299.710) (-1299.067) (-1303.936) * (-1300.264) (-1298.012) (-1299.933) [-1297.751] -- 0:00:43
      325000 -- (-1298.192) (-1299.320) (-1299.245) [-1298.266] * (-1300.084) (-1299.275) (-1300.590) [-1298.532] -- 0:00:43

      Average standard deviation of split frequencies: 0.017267

      325500 -- (-1298.354) (-1301.543) (-1302.051) [-1298.626] * (-1300.328) [-1298.893] (-1299.204) (-1298.174) -- 0:00:43
      326000 -- (-1297.304) [-1298.859] (-1298.423) (-1297.595) * [-1298.627] (-1299.765) (-1298.374) (-1297.897) -- 0:00:43
      326500 -- [-1299.481] (-1298.515) (-1297.573) (-1303.674) * (-1297.709) (-1301.094) (-1299.000) [-1298.432] -- 0:00:43
      327000 -- (-1300.524) (-1298.774) (-1297.509) [-1298.139] * (-1301.266) (-1302.647) [-1298.053] (-1300.349) -- 0:00:43
      327500 -- [-1302.981] (-1299.889) (-1304.018) (-1300.392) * [-1300.488] (-1302.567) (-1297.064) (-1297.799) -- 0:00:43
      328000 -- (-1302.321) (-1300.729) [-1300.347] (-1303.274) * [-1304.086] (-1297.755) (-1298.609) (-1298.906) -- 0:00:43
      328500 -- (-1302.262) [-1301.445] (-1300.614) (-1300.792) * (-1302.090) [-1297.819] (-1300.028) (-1301.058) -- 0:00:42
      329000 -- (-1303.311) (-1297.963) (-1297.516) [-1300.174] * (-1300.185) (-1298.569) (-1299.899) [-1299.475] -- 0:00:42
      329500 -- (-1312.281) (-1297.567) [-1297.817] (-1298.096) * (-1304.210) (-1302.039) (-1299.470) [-1300.698] -- 0:00:42
      330000 -- (-1298.750) (-1299.312) (-1298.530) [-1298.827] * (-1304.225) (-1301.930) [-1300.020] (-1298.251) -- 0:00:42

      Average standard deviation of split frequencies: 0.018622

      330500 -- [-1298.431] (-1299.970) (-1300.095) (-1299.746) * (-1303.564) (-1300.370) [-1300.429] (-1298.569) -- 0:00:42
      331000 -- (-1298.125) (-1299.247) (-1303.328) [-1300.673] * [-1301.702] (-1299.518) (-1299.394) (-1299.219) -- 0:00:42
      331500 -- (-1298.810) (-1300.065) (-1299.326) [-1303.222] * [-1299.033] (-1299.987) (-1302.046) (-1299.373) -- 0:00:42
      332000 -- (-1299.604) [-1297.720] (-1298.364) (-1299.602) * (-1298.975) [-1297.989] (-1299.460) (-1300.210) -- 0:00:42
      332500 -- [-1298.093] (-1297.646) (-1297.965) (-1300.556) * [-1299.066] (-1297.877) (-1301.389) (-1299.809) -- 0:00:42
      333000 -- (-1300.068) [-1297.971] (-1297.461) (-1300.541) * [-1299.413] (-1299.283) (-1298.492) (-1306.343) -- 0:00:42
      333500 -- (-1298.493) (-1301.237) [-1297.012] (-1300.592) * (-1298.582) (-1297.162) [-1300.538] (-1304.680) -- 0:00:41
      334000 -- (-1302.966) (-1304.037) [-1297.050] (-1300.646) * (-1299.083) (-1298.451) [-1301.459] (-1297.952) -- 0:00:41
      334500 -- [-1298.042] (-1298.633) (-1299.085) (-1300.601) * [-1300.741] (-1298.386) (-1298.872) (-1298.459) -- 0:00:41
      335000 -- (-1303.003) (-1303.105) [-1299.201] (-1302.180) * (-1300.797) (-1297.632) (-1299.084) [-1300.073] -- 0:00:41

      Average standard deviation of split frequencies: 0.017976

      335500 -- (-1303.915) [-1304.563] (-1299.691) (-1301.981) * (-1297.740) (-1298.255) [-1297.332] (-1302.263) -- 0:00:41
      336000 -- (-1300.960) (-1306.059) (-1301.627) [-1300.749] * [-1298.000] (-1300.377) (-1300.663) (-1300.704) -- 0:00:43
      336500 -- [-1298.782] (-1301.347) (-1300.262) (-1298.519) * (-1297.643) (-1301.159) (-1301.352) [-1298.229] -- 0:00:43
      337000 -- (-1298.921) [-1299.625] (-1300.106) (-1298.485) * (-1299.320) [-1299.509] (-1298.764) (-1297.505) -- 0:00:43
      337500 -- (-1299.172) (-1300.114) [-1298.113] (-1299.115) * (-1298.381) (-1298.882) (-1298.874) [-1298.022] -- 0:00:43
      338000 -- (-1302.016) (-1300.896) [-1299.265] (-1298.265) * (-1297.802) (-1298.379) (-1298.075) [-1298.486] -- 0:00:43
      338500 -- (-1303.420) (-1301.590) (-1298.577) [-1298.590] * [-1298.877] (-1299.620) (-1298.187) (-1298.082) -- 0:00:42
      339000 -- (-1303.986) (-1303.570) (-1299.478) [-1299.311] * (-1298.476) (-1299.688) (-1297.922) [-1297.413] -- 0:00:42
      339500 -- (-1299.665) [-1298.320] (-1298.966) (-1298.160) * (-1298.358) [-1299.857] (-1299.743) (-1298.335) -- 0:00:42
      340000 -- [-1300.584] (-1298.683) (-1298.324) (-1298.663) * (-1301.119) [-1299.748] (-1299.598) (-1298.018) -- 0:00:42

      Average standard deviation of split frequencies: 0.017989

      340500 -- (-1298.566) (-1300.118) [-1298.175] (-1299.651) * (-1301.589) [-1299.622] (-1298.888) (-1297.466) -- 0:00:42
      341000 -- (-1298.097) [-1300.475] (-1298.236) (-1299.854) * (-1299.882) (-1300.221) [-1299.881] (-1298.796) -- 0:00:42
      341500 -- (-1297.833) (-1300.810) (-1302.634) [-1298.342] * (-1299.691) (-1299.558) [-1298.786] (-1299.667) -- 0:00:42
      342000 -- (-1298.990) [-1300.060] (-1299.915) (-1300.450) * (-1301.842) (-1299.511) [-1299.574] (-1302.133) -- 0:00:42
      342500 -- [-1298.999] (-1299.249) (-1303.822) (-1301.366) * (-1299.777) [-1299.116] (-1300.430) (-1298.104) -- 0:00:42
      343000 -- (-1300.109) [-1299.057] (-1303.526) (-1298.618) * (-1298.361) (-1298.938) [-1299.630] (-1300.039) -- 0:00:42
      343500 -- (-1299.358) (-1299.612) (-1301.631) [-1297.673] * (-1300.190) (-1298.641) (-1299.642) [-1298.409] -- 0:00:42
      344000 -- [-1301.796] (-1308.814) (-1301.754) (-1298.999) * (-1305.876) (-1297.911) (-1298.894) [-1300.889] -- 0:00:41
      344500 -- (-1298.319) (-1300.548) [-1297.933] (-1298.416) * (-1303.726) (-1297.537) [-1298.228] (-1300.169) -- 0:00:41
      345000 -- (-1300.564) (-1300.141) (-1300.461) [-1298.495] * (-1298.712) (-1297.829) [-1298.085] (-1298.550) -- 0:00:41

      Average standard deviation of split frequencies: 0.018904

      345500 -- (-1298.718) [-1298.265] (-1301.690) (-1297.786) * (-1297.694) (-1298.231) [-1298.757] (-1299.774) -- 0:00:41
      346000 -- (-1301.867) [-1298.210] (-1298.554) (-1297.957) * [-1297.740] (-1297.328) (-1302.004) (-1298.673) -- 0:00:41
      346500 -- [-1301.188] (-1302.135) (-1297.585) (-1298.433) * (-1297.981) (-1297.809) [-1300.025] (-1298.890) -- 0:00:41
      347000 -- (-1300.666) [-1300.932] (-1303.489) (-1298.484) * (-1297.621) [-1297.710] (-1298.822) (-1298.984) -- 0:00:41
      347500 -- [-1302.361] (-1299.711) (-1299.167) (-1297.699) * (-1298.877) [-1298.724] (-1301.107) (-1300.542) -- 0:00:41
      348000 -- (-1297.286) [-1298.760] (-1300.225) (-1300.573) * (-1302.500) [-1298.227] (-1299.934) (-1301.649) -- 0:00:41
      348500 -- (-1297.195) [-1298.747] (-1300.117) (-1299.531) * (-1298.627) (-1298.013) [-1301.154] (-1298.917) -- 0:00:41
      349000 -- (-1297.016) (-1298.797) [-1299.256] (-1300.341) * (-1301.795) [-1299.585] (-1297.981) (-1301.160) -- 0:00:41
      349500 -- (-1297.004) (-1298.816) [-1300.404] (-1302.500) * (-1300.689) (-1299.734) (-1298.251) [-1301.368] -- 0:00:40
      350000 -- [-1301.069] (-1300.287) (-1300.090) (-1300.435) * [-1306.786] (-1299.809) (-1297.784) (-1300.043) -- 0:00:40

      Average standard deviation of split frequencies: 0.018988

      350500 -- (-1298.679) [-1303.044] (-1299.029) (-1301.298) * (-1301.747) (-1301.191) (-1299.320) [-1299.986] -- 0:00:42
      351000 -- (-1299.442) (-1305.499) [-1298.437] (-1299.108) * (-1300.185) (-1303.249) (-1298.911) [-1300.758] -- 0:00:42
      351500 -- (-1299.405) [-1297.934] (-1298.288) (-1301.201) * (-1300.293) [-1301.793] (-1299.121) (-1302.626) -- 0:00:42
      352000 -- (-1300.584) (-1297.762) [-1298.070] (-1299.637) * (-1301.082) (-1299.680) [-1300.265] (-1302.759) -- 0:00:42
      352500 -- (-1302.054) (-1297.763) [-1297.649] (-1297.456) * (-1298.467) (-1298.861) (-1299.109) [-1301.788] -- 0:00:42
      353000 -- (-1302.457) (-1297.763) (-1298.664) [-1298.877] * (-1299.143) (-1299.669) [-1301.421] (-1299.164) -- 0:00:42
      353500 -- (-1301.036) [-1299.168] (-1299.080) (-1303.374) * (-1299.906) (-1297.768) (-1301.699) [-1298.379] -- 0:00:42
      354000 -- (-1302.971) (-1303.846) [-1301.844] (-1302.916) * (-1304.117) (-1299.102) [-1301.023] (-1297.174) -- 0:00:41
      354500 -- (-1300.763) [-1300.866] (-1299.546) (-1302.309) * (-1302.316) [-1298.977] (-1299.936) (-1300.495) -- 0:00:41
      355000 -- (-1298.477) (-1300.258) [-1298.111] (-1299.510) * (-1297.767) (-1298.774) [-1299.793] (-1298.605) -- 0:00:41

      Average standard deviation of split frequencies: 0.018456

      355500 -- [-1298.077] (-1304.955) (-1299.568) (-1300.696) * (-1299.687) (-1300.220) (-1298.301) [-1301.395] -- 0:00:41
      356000 -- (-1298.318) (-1298.809) [-1301.214] (-1300.128) * (-1301.897) (-1299.299) (-1298.004) [-1299.001] -- 0:00:41
      356500 -- [-1300.351] (-1297.804) (-1298.144) (-1297.602) * (-1299.993) (-1301.072) (-1299.867) [-1302.517] -- 0:00:41
      357000 -- (-1298.980) (-1297.185) [-1298.399] (-1298.447) * (-1298.594) [-1303.804] (-1300.373) (-1297.210) -- 0:00:41
      357500 -- (-1298.302) (-1305.022) (-1298.526) [-1298.979] * (-1299.516) (-1298.321) [-1298.455] (-1300.044) -- 0:00:41
      358000 -- [-1299.549] (-1301.448) (-1298.218) (-1299.029) * (-1298.565) (-1298.308) (-1299.186) [-1299.398] -- 0:00:41
      358500 -- (-1298.436) (-1300.380) [-1298.521] (-1300.144) * (-1299.844) (-1298.308) (-1300.838) [-1300.154] -- 0:00:41
      359000 -- (-1304.959) [-1299.398] (-1299.391) (-1299.414) * (-1298.693) (-1299.776) (-1301.502) [-1300.755] -- 0:00:41
      359500 -- (-1299.561) [-1298.811] (-1299.645) (-1306.025) * (-1298.613) (-1304.220) (-1299.019) [-1298.907] -- 0:00:40
      360000 -- (-1303.436) (-1299.630) [-1298.526] (-1298.808) * (-1298.393) (-1300.423) [-1297.524] (-1297.896) -- 0:00:40

      Average standard deviation of split frequencies: 0.018053

      360500 -- (-1299.158) [-1301.683] (-1299.047) (-1299.150) * [-1298.389] (-1300.406) (-1297.170) (-1303.106) -- 0:00:40
      361000 -- (-1298.268) (-1302.404) (-1298.201) [-1300.538] * (-1298.692) (-1298.837) [-1297.173] (-1301.616) -- 0:00:40
      361500 -- [-1298.451] (-1298.783) (-1303.381) (-1300.521) * (-1300.728) [-1298.166] (-1301.180) (-1301.349) -- 0:00:40
      362000 -- (-1297.795) [-1298.249] (-1303.194) (-1299.661) * (-1300.254) (-1300.702) (-1298.715) [-1298.255] -- 0:00:40
      362500 -- (-1298.547) (-1298.206) (-1302.431) [-1298.827] * (-1302.713) (-1300.116) (-1299.014) [-1298.611] -- 0:00:40
      363000 -- [-1298.600] (-1306.863) (-1302.114) (-1301.320) * [-1298.462] (-1304.174) (-1298.161) (-1298.355) -- 0:00:40
      363500 -- [-1298.069] (-1299.389) (-1303.276) (-1301.947) * (-1297.649) (-1303.838) [-1301.957] (-1298.781) -- 0:00:40
      364000 -- (-1301.840) [-1301.347] (-1301.367) (-1299.289) * (-1300.231) (-1302.770) (-1298.354) [-1300.608] -- 0:00:40
      364500 -- (-1299.109) [-1300.283] (-1300.203) (-1302.874) * [-1300.704] (-1299.359) (-1299.186) (-1300.467) -- 0:00:40
      365000 -- (-1301.845) (-1304.432) (-1299.535) [-1301.824] * [-1299.327] (-1303.126) (-1302.161) (-1299.191) -- 0:00:40

      Average standard deviation of split frequencies: 0.016592

      365500 -- [-1298.452] (-1299.652) (-1299.535) (-1304.950) * (-1299.081) (-1298.363) (-1302.956) [-1299.368] -- 0:00:41
      366000 -- [-1299.850] (-1302.443) (-1300.832) (-1307.011) * (-1298.783) (-1297.444) [-1298.761] (-1302.664) -- 0:00:41
      366500 -- (-1297.917) (-1299.878) [-1301.029] (-1303.094) * [-1298.900] (-1299.488) (-1297.379) (-1300.103) -- 0:00:41
      367000 -- (-1301.182) (-1299.047) [-1298.385] (-1299.918) * (-1298.301) [-1300.671] (-1297.364) (-1300.550) -- 0:00:41
      367500 -- [-1302.049] (-1299.068) (-1301.805) (-1300.816) * (-1298.426) (-1299.773) (-1301.195) [-1299.598] -- 0:00:41
      368000 -- (-1299.861) (-1302.485) [-1297.540] (-1298.500) * (-1302.756) (-1297.628) (-1299.460) [-1302.439] -- 0:00:41
      368500 -- (-1299.934) (-1299.362) (-1302.041) [-1297.840] * (-1304.208) (-1297.828) [-1298.335] (-1302.042) -- 0:00:41
      369000 -- [-1299.945] (-1297.789) (-1303.612) (-1297.220) * (-1299.061) (-1298.732) [-1297.349] (-1300.429) -- 0:00:41
      369500 -- (-1299.313) [-1297.689] (-1300.783) (-1297.522) * (-1298.699) (-1300.765) [-1297.457] (-1303.354) -- 0:00:40
      370000 -- (-1298.201) (-1298.189) (-1301.069) [-1297.517] * (-1298.451) (-1300.690) [-1297.977] (-1301.060) -- 0:00:40

      Average standard deviation of split frequencies: 0.016309

      370500 -- [-1297.528] (-1298.883) (-1298.710) (-1297.492) * (-1300.820) (-1297.908) (-1297.145) [-1301.082] -- 0:00:40
      371000 -- [-1298.846] (-1299.128) (-1300.079) (-1297.492) * (-1300.683) (-1300.167) (-1300.935) [-1301.117] -- 0:00:40
      371500 -- (-1297.905) [-1298.745] (-1299.084) (-1297.496) * (-1299.291) [-1301.272] (-1299.320) (-1302.129) -- 0:00:40
      372000 -- (-1299.697) [-1299.300] (-1301.073) (-1297.527) * (-1297.808) (-1298.436) [-1300.789] (-1301.560) -- 0:00:40
      372500 -- (-1298.230) (-1299.659) [-1298.738] (-1300.444) * (-1298.568) (-1297.974) (-1301.629) [-1301.678] -- 0:00:40
      373000 -- (-1298.863) (-1297.760) (-1298.361) [-1297.452] * [-1299.657] (-1299.153) (-1302.242) (-1300.935) -- 0:00:40
      373500 -- (-1300.002) (-1296.942) [-1298.608] (-1297.834) * [-1298.758] (-1298.647) (-1302.795) (-1303.859) -- 0:00:40
      374000 -- (-1299.593) [-1298.508] (-1302.612) (-1297.280) * (-1303.521) [-1298.637] (-1301.938) (-1299.963) -- 0:00:40
      374500 -- (-1299.012) [-1298.494] (-1300.201) (-1297.185) * (-1303.911) [-1298.212] (-1299.522) (-1300.658) -- 0:00:40
      375000 -- (-1298.614) (-1300.760) (-1299.472) [-1298.502] * [-1298.200] (-1303.864) (-1302.177) (-1298.293) -- 0:00:40

      Average standard deviation of split frequencies: 0.015561

      375500 -- (-1301.058) (-1302.725) (-1298.246) [-1299.854] * (-1298.367) (-1302.379) (-1301.763) [-1298.851] -- 0:00:39
      376000 -- (-1301.335) (-1298.212) (-1300.888) [-1297.972] * (-1305.413) [-1303.265] (-1299.748) (-1298.057) -- 0:00:39
      376500 -- (-1304.824) (-1298.172) [-1298.036] (-1297.850) * (-1299.029) [-1300.227] (-1298.505) (-1301.596) -- 0:00:39
      377000 -- (-1302.969) [-1300.335] (-1297.722) (-1297.889) * (-1298.520) (-1301.812) [-1298.356] (-1300.889) -- 0:00:39
      377500 -- [-1299.587] (-1298.518) (-1299.552) (-1298.977) * [-1297.335] (-1299.546) (-1300.200) (-1300.670) -- 0:00:39
      378000 -- (-1298.842) [-1297.706] (-1307.214) (-1300.766) * (-1299.529) (-1300.316) [-1301.769] (-1298.966) -- 0:00:39
      378500 -- (-1300.213) [-1297.706] (-1303.510) (-1300.099) * (-1300.294) (-1297.611) (-1301.411) [-1303.254] -- 0:00:39
      379000 -- [-1300.486] (-1298.842) (-1299.377) (-1299.287) * (-1298.172) (-1298.177) [-1297.952] (-1298.278) -- 0:00:39
      379500 -- [-1297.381] (-1299.990) (-1300.213) (-1301.739) * (-1299.014) [-1297.614] (-1299.739) (-1299.807) -- 0:00:39
      380000 -- [-1297.410] (-1300.547) (-1300.970) (-1302.229) * (-1298.311) (-1301.338) (-1300.210) [-1299.172] -- 0:00:39

      Average standard deviation of split frequencies: 0.016536

      380500 -- [-1297.677] (-1298.570) (-1298.115) (-1298.207) * (-1298.216) (-1298.484) [-1299.872] (-1298.130) -- 0:00:39
      381000 -- (-1297.630) [-1298.007] (-1300.503) (-1299.295) * (-1297.969) (-1299.289) [-1300.012] (-1300.779) -- 0:00:40
      381500 -- [-1297.160] (-1299.323) (-1298.651) (-1300.527) * (-1299.786) [-1297.920] (-1298.731) (-1302.443) -- 0:00:40
      382000 -- (-1297.577) (-1298.231) (-1299.082) [-1299.175] * (-1301.741) (-1299.598) [-1298.804] (-1300.843) -- 0:00:40
      382500 -- (-1297.568) [-1298.996] (-1298.279) (-1298.225) * (-1299.731) [-1299.644] (-1301.696) (-1298.552) -- 0:00:40
      383000 -- [-1297.566] (-1299.153) (-1300.770) (-1297.643) * (-1299.015) (-1298.745) (-1300.755) [-1299.491] -- 0:00:40
      383500 -- (-1297.568) (-1299.484) (-1298.972) [-1298.365] * [-1298.115] (-1298.961) (-1300.152) (-1300.075) -- 0:00:40
      384000 -- [-1299.711] (-1301.422) (-1299.411) (-1304.456) * (-1298.769) (-1299.579) (-1299.067) [-1298.878] -- 0:00:40
      384500 -- (-1298.293) [-1298.978] (-1297.509) (-1299.433) * [-1298.832] (-1298.493) (-1297.894) (-1299.535) -- 0:00:40
      385000 -- [-1298.984] (-1298.331) (-1298.658) (-1300.281) * (-1302.090) (-1298.021) [-1299.896] (-1300.746) -- 0:00:39

      Average standard deviation of split frequencies: 0.016555

      385500 -- (-1298.496) [-1297.853] (-1297.456) (-1299.342) * (-1299.498) [-1298.080] (-1299.028) (-1300.112) -- 0:00:39
      386000 -- [-1298.781] (-1297.362) (-1299.173) (-1298.487) * (-1304.009) [-1299.897] (-1298.598) (-1298.782) -- 0:00:39
      386500 -- [-1297.906] (-1298.135) (-1301.500) (-1297.695) * (-1300.984) [-1299.298] (-1298.744) (-1303.111) -- 0:00:39
      387000 -- (-1300.599) (-1302.334) (-1298.883) [-1299.015] * (-1303.354) [-1298.536] (-1298.902) (-1299.077) -- 0:00:39
      387500 -- [-1303.196] (-1301.574) (-1299.061) (-1302.547) * (-1299.653) (-1298.128) [-1299.459] (-1298.093) -- 0:00:39
      388000 -- (-1297.141) (-1298.878) (-1299.442) [-1298.298] * (-1299.395) (-1301.154) [-1298.994] (-1298.117) -- 0:00:39
      388500 -- (-1297.227) (-1298.526) (-1298.154) [-1298.002] * [-1298.800] (-1299.645) (-1298.291) (-1299.428) -- 0:00:39
      389000 -- (-1297.851) (-1299.692) (-1300.921) [-1297.461] * (-1300.151) (-1299.210) [-1298.682] (-1297.435) -- 0:00:39
      389500 -- [-1299.062] (-1298.756) (-1297.851) (-1299.297) * (-1302.491) [-1298.897] (-1298.962) (-1297.710) -- 0:00:39
      390000 -- (-1302.722) [-1298.461] (-1298.714) (-1299.877) * [-1301.301] (-1299.810) (-1302.482) (-1301.695) -- 0:00:39

      Average standard deviation of split frequencies: 0.017027

      390500 -- [-1297.480] (-1300.569) (-1299.043) (-1296.947) * (-1299.660) (-1300.402) [-1299.865] (-1299.923) -- 0:00:39
      391000 -- (-1297.429) [-1299.012] (-1304.498) (-1298.387) * [-1299.588] (-1309.225) (-1302.365) (-1300.715) -- 0:00:38
      391500 -- [-1299.703] (-1299.046) (-1303.981) (-1298.487) * (-1303.082) [-1301.363] (-1301.743) (-1298.107) -- 0:00:38
      392000 -- (-1299.122) (-1297.791) (-1301.145) [-1302.237] * (-1299.899) (-1303.289) [-1297.069] (-1297.602) -- 0:00:38
      392500 -- [-1300.420] (-1298.892) (-1299.763) (-1299.699) * (-1299.092) [-1303.687] (-1300.840) (-1301.851) -- 0:00:38
      393000 -- (-1300.056) (-1298.576) [-1299.723] (-1298.906) * [-1301.407] (-1303.103) (-1300.001) (-1298.639) -- 0:00:38
      393500 -- (-1298.268) [-1298.662] (-1301.040) (-1300.563) * (-1301.261) [-1297.927] (-1303.057) (-1298.570) -- 0:00:38
      394000 -- (-1297.993) (-1301.691) (-1299.387) [-1300.805] * (-1299.742) (-1297.946) [-1302.760] (-1299.252) -- 0:00:38
      394500 -- (-1299.388) (-1298.543) (-1302.355) [-1298.514] * (-1299.081) [-1298.734] (-1300.464) (-1298.761) -- 0:00:38
      395000 -- [-1299.210] (-1299.881) (-1298.702) (-1303.413) * (-1305.167) [-1299.846] (-1298.424) (-1300.766) -- 0:00:38

      Average standard deviation of split frequencies: 0.016666

      395500 -- [-1299.678] (-1303.877) (-1300.408) (-1303.107) * [-1303.009] (-1299.763) (-1301.849) (-1299.673) -- 0:00:38
      396000 -- (-1302.689) (-1299.814) [-1300.484] (-1302.145) * (-1299.357) [-1301.859] (-1302.058) (-1300.123) -- 0:00:38
      396500 -- (-1299.666) (-1297.779) [-1298.008] (-1301.096) * (-1300.536) [-1299.412] (-1298.936) (-1301.913) -- 0:00:38
      397000 -- (-1300.260) [-1299.148] (-1298.347) (-1300.009) * [-1299.946] (-1299.039) (-1298.326) (-1299.083) -- 0:00:37
      397500 -- (-1298.917) (-1298.056) [-1299.409] (-1297.914) * (-1299.236) (-1299.768) [-1298.427] (-1301.795) -- 0:00:39
      398000 -- [-1297.497] (-1298.632) (-1298.204) (-1298.102) * (-1299.481) [-1302.946] (-1298.758) (-1299.316) -- 0:00:39
      398500 -- (-1302.042) (-1298.508) [-1298.730] (-1297.377) * [-1299.283] (-1306.000) (-1301.008) (-1299.111) -- 0:00:39
      399000 -- (-1299.370) (-1298.660) [-1300.431] (-1301.220) * (-1299.013) [-1297.760] (-1300.563) (-1300.487) -- 0:00:39
      399500 -- (-1300.395) (-1303.094) [-1298.122] (-1302.296) * (-1297.906) [-1300.598] (-1298.322) (-1303.166) -- 0:00:39
      400000 -- [-1298.630] (-1302.011) (-1297.674) (-1301.522) * [-1298.853] (-1302.056) (-1297.483) (-1301.735) -- 0:00:39

      Average standard deviation of split frequencies: 0.016406

      400500 -- (-1300.418) (-1301.292) [-1297.161] (-1298.674) * (-1298.928) [-1298.616] (-1297.836) (-1299.751) -- 0:00:38
      401000 -- (-1298.984) [-1297.244] (-1300.261) (-1298.863) * (-1299.610) (-1300.189) (-1298.474) [-1299.434] -- 0:00:38
      401500 -- [-1299.305] (-1299.369) (-1300.351) (-1298.435) * (-1299.899) [-1301.676] (-1299.867) (-1300.399) -- 0:00:38
      402000 -- [-1297.774] (-1298.944) (-1297.698) (-1298.601) * (-1300.699) [-1300.990] (-1298.987) (-1300.899) -- 0:00:38
      402500 -- (-1298.627) (-1300.198) (-1298.241) [-1297.891] * (-1297.864) [-1299.780] (-1299.992) (-1297.884) -- 0:00:38
      403000 -- (-1298.568) [-1299.157] (-1298.621) (-1298.929) * (-1300.502) [-1298.737] (-1298.517) (-1297.325) -- 0:00:38
      403500 -- (-1297.966) (-1301.508) [-1301.545] (-1300.198) * [-1297.798] (-1299.125) (-1302.361) (-1298.046) -- 0:00:38
      404000 -- (-1298.111) (-1301.035) [-1299.351] (-1298.143) * [-1301.004] (-1301.510) (-1297.807) (-1300.265) -- 0:00:38
      404500 -- (-1297.936) (-1301.093) (-1299.178) [-1297.302] * [-1299.166] (-1299.777) (-1297.815) (-1300.601) -- 0:00:38
      405000 -- (-1297.923) [-1298.731] (-1301.866) (-1297.176) * (-1299.201) (-1299.698) (-1297.850) [-1299.265] -- 0:00:38

      Average standard deviation of split frequencies: 0.015804

      405500 -- [-1300.870] (-1299.931) (-1300.809) (-1299.434) * (-1298.372) (-1299.609) (-1298.793) [-1298.252] -- 0:00:38
      406000 -- [-1299.963] (-1298.170) (-1301.912) (-1301.884) * (-1300.771) (-1300.155) [-1298.781] (-1300.259) -- 0:00:38
      406500 -- (-1298.432) (-1300.109) (-1300.719) [-1299.574] * (-1297.774) (-1300.683) [-1298.809] (-1297.523) -- 0:00:37
      407000 -- (-1302.466) [-1299.343] (-1300.616) (-1298.824) * (-1298.316) (-1298.571) [-1299.079] (-1298.944) -- 0:00:37
      407500 -- (-1301.180) [-1299.796] (-1299.888) (-1299.419) * [-1299.043] (-1296.982) (-1300.178) (-1300.027) -- 0:00:37
      408000 -- (-1302.749) [-1300.189] (-1299.769) (-1298.322) * (-1299.126) [-1299.260] (-1303.248) (-1300.235) -- 0:00:37
      408500 -- (-1306.570) (-1297.973) (-1298.459) [-1298.624] * (-1305.387) [-1297.075] (-1297.249) (-1299.263) -- 0:00:37
      409000 -- (-1302.050) (-1297.338) (-1298.466) [-1297.774] * (-1306.108) (-1299.001) [-1298.728] (-1297.219) -- 0:00:37
      409500 -- (-1300.376) (-1298.979) (-1298.466) [-1298.976] * (-1303.635) (-1300.000) (-1298.158) [-1298.672] -- 0:00:37
      410000 -- (-1301.318) (-1298.106) (-1299.534) [-1297.580] * (-1297.680) [-1299.508] (-1300.616) (-1302.750) -- 0:00:37

      Average standard deviation of split frequencies: 0.016262

      410500 -- (-1302.297) [-1297.744] (-1302.486) (-1297.580) * (-1305.933) [-1299.111] (-1302.599) (-1299.557) -- 0:00:37
      411000 -- (-1299.228) [-1297.814] (-1299.455) (-1297.579) * (-1301.003) [-1299.174] (-1302.445) (-1301.196) -- 0:00:37
      411500 -- (-1301.038) [-1297.695] (-1302.515) (-1297.798) * (-1299.392) [-1298.726] (-1302.248) (-1299.060) -- 0:00:37
      412000 -- (-1300.744) (-1298.564) (-1299.402) [-1301.875] * (-1298.450) [-1297.725] (-1301.588) (-1299.527) -- 0:00:37
      412500 -- (-1299.839) (-1298.403) [-1297.245] (-1301.739) * (-1299.092) (-1299.116) [-1297.502] (-1302.993) -- 0:00:37
      413000 -- (-1303.848) (-1297.254) [-1297.420] (-1303.808) * (-1297.384) (-1300.084) (-1297.760) [-1299.561] -- 0:00:36
      413500 -- (-1297.780) [-1300.140] (-1302.787) (-1305.896) * (-1300.359) (-1299.930) (-1299.194) [-1299.724] -- 0:00:38
      414000 -- [-1300.460] (-1301.982) (-1299.674) (-1300.161) * (-1299.645) (-1302.587) (-1297.108) [-1297.629] -- 0:00:38
      414500 -- (-1300.927) (-1299.069) [-1301.986] (-1298.974) * (-1302.272) (-1301.701) [-1297.119] (-1298.232) -- 0:00:38
      415000 -- [-1297.087] (-1298.213) (-1299.889) (-1298.492) * (-1299.513) [-1300.025] (-1300.405) (-1298.594) -- 0:00:38

      Average standard deviation of split frequencies: 0.015531

      415500 -- [-1297.294] (-1300.043) (-1298.637) (-1298.696) * (-1299.557) (-1302.215) [-1300.921] (-1299.594) -- 0:00:37
      416000 -- (-1297.256) (-1299.971) [-1298.585] (-1297.664) * (-1299.109) (-1304.458) [-1301.498] (-1301.689) -- 0:00:37
      416500 -- (-1301.595) (-1299.452) [-1298.131] (-1298.917) * [-1299.908] (-1299.977) (-1302.425) (-1302.863) -- 0:00:37
      417000 -- (-1300.183) (-1299.530) [-1298.749] (-1302.110) * (-1299.907) [-1299.011] (-1297.842) (-1299.867) -- 0:00:37
      417500 -- [-1298.387] (-1300.449) (-1300.137) (-1299.762) * (-1299.421) (-1302.111) (-1297.732) [-1301.112] -- 0:00:37
      418000 -- (-1299.337) (-1298.244) [-1302.509] (-1303.307) * (-1298.661) (-1302.173) (-1299.738) [-1300.047] -- 0:00:37
      418500 -- (-1299.098) [-1298.251] (-1302.159) (-1300.697) * (-1299.627) (-1299.206) (-1300.477) [-1297.479] -- 0:00:37
      419000 -- (-1302.176) (-1298.200) (-1298.901) [-1300.299] * (-1302.098) [-1300.348] (-1299.446) (-1298.413) -- 0:00:37
      419500 -- (-1302.104) (-1298.891) (-1299.571) [-1300.076] * (-1301.280) [-1298.471] (-1301.368) (-1299.002) -- 0:00:37
      420000 -- (-1298.715) (-1300.784) [-1298.075] (-1299.839) * (-1299.552) [-1299.234] (-1300.972) (-1300.057) -- 0:00:37

      Average standard deviation of split frequencies: 0.016018

      420500 -- (-1301.977) (-1299.375) [-1297.582] (-1300.878) * (-1298.078) (-1299.507) [-1302.497] (-1303.118) -- 0:00:37
      421000 -- (-1301.993) (-1300.127) [-1297.912] (-1300.167) * (-1303.677) (-1299.069) (-1300.449) [-1300.219] -- 0:00:37
      421500 -- (-1300.391) (-1298.428) [-1298.828] (-1301.868) * (-1307.824) (-1305.849) (-1302.445) [-1298.920] -- 0:00:37
      422000 -- (-1300.653) [-1297.867] (-1302.677) (-1298.017) * [-1300.209] (-1306.308) (-1299.944) (-1300.702) -- 0:00:36
      422500 -- (-1300.100) [-1300.470] (-1305.297) (-1302.030) * [-1300.521] (-1298.185) (-1299.582) (-1301.403) -- 0:00:36
      423000 -- (-1298.864) [-1298.576] (-1300.197) (-1298.841) * (-1301.479) (-1298.057) [-1298.220] (-1301.745) -- 0:00:36
      423500 -- (-1299.121) (-1303.752) (-1298.590) [-1301.126] * (-1300.513) (-1298.521) (-1300.525) [-1298.202] -- 0:00:36
      424000 -- (-1299.438) [-1299.492] (-1300.364) (-1298.071) * [-1300.287] (-1299.124) (-1302.655) (-1298.808) -- 0:00:36
      424500 -- (-1299.125) (-1299.682) [-1297.795] (-1298.150) * (-1300.889) [-1299.124] (-1301.068) (-1298.879) -- 0:00:36
      425000 -- (-1299.296) (-1298.837) [-1297.307] (-1302.550) * (-1298.414) [-1298.592] (-1300.364) (-1301.532) -- 0:00:36

      Average standard deviation of split frequencies: 0.016208

      425500 -- (-1302.327) [-1300.764] (-1300.978) (-1299.504) * (-1299.146) (-1300.797) (-1298.942) [-1299.418] -- 0:00:36
      426000 -- (-1304.161) (-1298.606) (-1302.550) [-1298.825] * (-1299.615) [-1297.837] (-1300.000) (-1298.686) -- 0:00:36
      426500 -- (-1303.446) (-1300.371) (-1300.024) [-1299.797] * [-1298.799] (-1297.369) (-1299.702) (-1298.117) -- 0:00:36
      427000 -- (-1303.279) (-1299.254) (-1299.516) [-1298.058] * (-1300.165) (-1298.369) [-1298.836] (-1301.364) -- 0:00:36
      427500 -- (-1299.815) (-1299.442) (-1300.517) [-1303.383] * [-1299.570] (-1298.200) (-1300.185) (-1298.321) -- 0:00:36
      428000 -- (-1300.955) [-1299.612] (-1303.424) (-1299.872) * (-1299.310) (-1297.702) (-1299.630) [-1302.171] -- 0:00:36
      428500 -- (-1301.628) [-1298.018] (-1300.365) (-1300.042) * (-1304.704) (-1297.707) [-1298.719] (-1299.100) -- 0:00:36
      429000 -- (-1299.880) (-1302.098) [-1299.228] (-1299.788) * (-1297.663) [-1298.036] (-1299.732) (-1297.571) -- 0:00:35
      429500 -- (-1302.503) (-1300.452) (-1299.643) [-1297.266] * (-1303.190) (-1299.693) (-1298.011) [-1301.336] -- 0:00:35
      430000 -- [-1300.959] (-1301.286) (-1302.556) (-1300.573) * [-1298.115] (-1298.646) (-1301.216) (-1298.103) -- 0:00:37

      Average standard deviation of split frequencies: 0.017320

      430500 -- (-1302.038) [-1298.499] (-1304.462) (-1301.786) * (-1298.072) [-1302.282] (-1300.527) (-1298.470) -- 0:00:37
      431000 -- (-1299.892) [-1300.957] (-1303.120) (-1301.997) * (-1300.580) [-1300.367] (-1301.997) (-1297.471) -- 0:00:36
      431500 -- (-1299.273) (-1299.530) (-1299.894) [-1298.198] * [-1300.667] (-1297.588) (-1299.237) (-1299.741) -- 0:00:36
      432000 -- (-1302.796) (-1302.478) (-1299.065) [-1297.470] * [-1298.891] (-1298.628) (-1297.957) (-1299.210) -- 0:00:36
      432500 -- (-1299.788) [-1299.418] (-1299.932) (-1300.726) * (-1298.868) (-1301.287) (-1298.398) [-1297.048] -- 0:00:36
      433000 -- (-1300.423) (-1300.298) (-1303.778) [-1301.273] * (-1298.762) (-1298.910) [-1300.792] (-1298.624) -- 0:00:36
      433500 -- (-1300.374) [-1298.276] (-1302.745) (-1304.732) * [-1297.370] (-1297.240) (-1304.106) (-1304.668) -- 0:00:36
      434000 -- [-1297.358] (-1298.182) (-1299.281) (-1302.386) * (-1299.267) (-1300.139) [-1300.765] (-1299.638) -- 0:00:36
      434500 -- (-1297.360) (-1297.700) (-1300.482) [-1299.228] * [-1298.527] (-1298.968) (-1299.623) (-1298.833) -- 0:00:36
      435000 -- (-1298.815) [-1297.662] (-1298.769) (-1296.930) * [-1298.169] (-1297.871) (-1298.816) (-1297.882) -- 0:00:36

      Average standard deviation of split frequencies: 0.018317

      435500 -- (-1301.997) (-1299.045) [-1298.164] (-1297.086) * (-1299.691) [-1299.721] (-1299.475) (-1304.469) -- 0:00:36
      436000 -- [-1298.397] (-1299.538) (-1297.767) (-1299.287) * [-1300.080] (-1300.259) (-1298.644) (-1298.923) -- 0:00:36
      436500 -- [-1300.922] (-1299.875) (-1297.739) (-1298.405) * (-1297.462) [-1300.658] (-1299.755) (-1300.122) -- 0:00:36
      437000 -- (-1301.870) (-1300.155) [-1298.087] (-1297.937) * (-1298.121) (-1301.162) [-1299.483] (-1300.722) -- 0:00:36
      437500 -- (-1297.985) (-1301.823) [-1299.109] (-1298.596) * (-1297.810) (-1298.392) (-1298.619) [-1300.631] -- 0:00:36
      438000 -- (-1301.695) (-1298.620) (-1297.660) [-1299.259] * (-1299.262) [-1298.164] (-1298.016) (-1298.958) -- 0:00:35
      438500 -- (-1299.839) (-1300.235) [-1300.850] (-1299.688) * (-1301.284) [-1307.729] (-1299.031) (-1300.659) -- 0:00:35
      439000 -- (-1299.682) [-1298.253] (-1298.114) (-1298.955) * (-1300.680) (-1299.622) [-1298.779] (-1299.193) -- 0:00:35
      439500 -- (-1298.329) [-1302.550] (-1298.854) (-1301.044) * (-1298.972) [-1299.557] (-1300.895) (-1299.402) -- 0:00:35
      440000 -- [-1297.596] (-1299.431) (-1297.625) (-1299.440) * (-1299.713) [-1301.537] (-1299.932) (-1299.076) -- 0:00:35

      Average standard deviation of split frequencies: 0.018689

      440500 -- (-1303.580) (-1301.646) (-1300.672) [-1296.981] * (-1302.155) (-1303.828) [-1297.492] (-1299.424) -- 0:00:35
      441000 -- [-1301.570] (-1300.644) (-1299.314) (-1298.688) * (-1298.041) [-1301.983] (-1299.226) (-1299.960) -- 0:00:35
      441500 -- (-1300.981) (-1298.978) [-1302.652] (-1299.182) * (-1297.345) (-1300.196) (-1301.392) [-1301.010] -- 0:00:35
      442000 -- (-1302.047) (-1298.819) (-1300.010) [-1298.171] * (-1298.014) (-1297.440) (-1301.462) [-1302.931] -- 0:00:35
      442500 -- (-1301.280) (-1297.065) [-1301.895] (-1297.907) * (-1297.378) (-1302.161) (-1300.223) [-1297.364] -- 0:00:35
      443000 -- (-1299.926) [-1298.260] (-1304.050) (-1298.601) * [-1298.368] (-1297.648) (-1300.744) (-1298.866) -- 0:00:35
      443500 -- (-1300.142) (-1297.093) [-1299.942] (-1299.296) * (-1298.382) (-1298.619) (-1298.039) [-1299.466] -- 0:00:35
      444000 -- (-1300.744) [-1299.956] (-1298.791) (-1297.723) * (-1297.929) [-1299.746] (-1298.344) (-1302.133) -- 0:00:35
      444500 -- (-1300.118) [-1299.508] (-1305.365) (-1299.641) * (-1299.258) (-1299.840) (-1300.639) [-1299.574] -- 0:00:34
      445000 -- (-1299.889) [-1296.910] (-1303.617) (-1298.956) * (-1299.377) (-1300.681) [-1299.557] (-1299.337) -- 0:00:34

      Average standard deviation of split frequencies: 0.018155

      445500 -- (-1299.643) (-1300.236) (-1299.993) [-1297.430] * (-1299.906) (-1302.360) (-1301.617) [-1299.214] -- 0:00:34
      446000 -- (-1299.015) (-1302.147) (-1298.167) [-1300.974] * (-1299.712) [-1301.128] (-1301.777) (-1297.902) -- 0:00:36
      446500 -- [-1299.089] (-1302.120) (-1300.058) (-1301.815) * [-1298.336] (-1298.395) (-1300.207) (-1299.098) -- 0:00:35
      447000 -- (-1303.075) [-1297.656] (-1299.100) (-1297.878) * (-1300.405) (-1298.048) [-1303.132] (-1301.113) -- 0:00:35
      447500 -- (-1298.477) [-1297.252] (-1298.814) (-1299.751) * (-1305.975) (-1299.613) (-1302.119) [-1297.254] -- 0:00:35
      448000 -- [-1299.046] (-1298.855) (-1301.173) (-1303.694) * (-1298.359) [-1298.871] (-1303.138) (-1303.195) -- 0:00:35
      448500 -- (-1298.497) [-1297.518] (-1298.893) (-1299.116) * [-1302.070] (-1302.079) (-1303.932) (-1302.951) -- 0:00:35
      449000 -- [-1301.460] (-1297.598) (-1303.209) (-1298.353) * (-1301.644) [-1299.978] (-1301.023) (-1299.983) -- 0:00:35
      449500 -- (-1297.465) [-1301.261] (-1300.723) (-1299.382) * [-1297.486] (-1298.209) (-1301.140) (-1300.869) -- 0:00:35
      450000 -- (-1298.831) (-1301.472) [-1300.530] (-1300.744) * [-1297.032] (-1301.044) (-1301.135) (-1300.786) -- 0:00:35

      Average standard deviation of split frequencies: 0.018275

      450500 -- (-1302.353) (-1298.792) (-1307.591) [-1299.013] * (-1303.626) (-1300.062) (-1299.628) [-1298.503] -- 0:00:35
      451000 -- (-1304.044) (-1299.934) (-1304.457) [-1298.511] * [-1298.951] (-1299.077) (-1302.413) (-1297.965) -- 0:00:35
      451500 -- (-1300.784) (-1298.813) (-1302.474) [-1300.618] * (-1299.055) [-1304.803] (-1302.534) (-1298.699) -- 0:00:35
      452000 -- (-1297.513) (-1298.813) (-1304.748) [-1299.218] * (-1299.567) (-1303.153) [-1301.868] (-1302.049) -- 0:00:35
      452500 -- (-1299.163) (-1297.945) [-1298.977] (-1299.089) * (-1299.621) (-1297.206) [-1298.646] (-1298.783) -- 0:00:35
      453000 -- (-1298.717) (-1297.836) (-1300.898) [-1300.496] * (-1299.054) (-1300.631) [-1298.520] (-1298.885) -- 0:00:35
      453500 -- (-1298.814) (-1298.593) (-1299.313) [-1300.399] * (-1301.342) (-1297.269) [-1298.326] (-1299.163) -- 0:00:34
      454000 -- [-1300.684] (-1298.800) (-1302.096) (-1300.568) * [-1300.530] (-1297.393) (-1299.000) (-1297.412) -- 0:00:34
      454500 -- (-1300.659) [-1298.726] (-1301.545) (-1299.708) * (-1298.632) (-1298.892) [-1299.752] (-1298.507) -- 0:00:34
      455000 -- [-1297.849] (-1301.990) (-1302.763) (-1299.056) * [-1298.803] (-1299.245) (-1299.383) (-1299.818) -- 0:00:34

      Average standard deviation of split frequencies: 0.017209

      455500 -- (-1297.675) (-1300.084) [-1299.186] (-1298.264) * (-1301.104) (-1299.170) [-1298.811] (-1300.232) -- 0:00:34
      456000 -- (-1305.127) (-1303.297) [-1298.016] (-1301.078) * (-1302.957) [-1301.281] (-1298.240) (-1300.474) -- 0:00:34
      456500 -- [-1299.479] (-1301.056) (-1299.936) (-1299.423) * (-1298.641) (-1300.202) [-1297.254] (-1298.088) -- 0:00:34
      457000 -- [-1297.920] (-1300.936) (-1301.471) (-1298.162) * [-1297.924] (-1303.430) (-1298.114) (-1299.817) -- 0:00:34
      457500 -- (-1298.707) (-1300.466) [-1300.563] (-1304.192) * (-1299.557) (-1297.635) [-1300.109] (-1300.782) -- 0:00:34
      458000 -- (-1300.399) [-1302.381] (-1301.210) (-1302.281) * [-1298.757] (-1298.521) (-1299.402) (-1299.681) -- 0:00:34
      458500 -- (-1300.484) [-1298.702] (-1299.091) (-1298.881) * [-1300.029] (-1302.974) (-1299.227) (-1299.281) -- 0:00:34
      459000 -- [-1297.543] (-1299.322) (-1298.070) (-1299.219) * (-1297.698) (-1305.240) [-1302.533] (-1298.559) -- 0:00:34
      459500 -- [-1297.392] (-1298.988) (-1299.380) (-1302.007) * (-1298.918) (-1301.406) (-1304.154) [-1297.336] -- 0:00:34
      460000 -- (-1297.122) [-1299.390] (-1299.548) (-1302.080) * (-1298.166) (-1300.550) [-1297.667] (-1297.398) -- 0:00:34

      Average standard deviation of split frequencies: 0.015691

      460500 -- (-1298.133) (-1301.056) (-1298.425) [-1299.131] * (-1299.576) [-1299.015] (-1300.489) (-1297.700) -- 0:00:33
      461000 -- (-1297.525) (-1303.057) [-1301.694] (-1298.501) * [-1303.866] (-1300.377) (-1297.173) (-1298.929) -- 0:00:33
      461500 -- [-1301.571] (-1301.717) (-1302.728) (-1297.001) * [-1298.966] (-1298.475) (-1297.100) (-1299.315) -- 0:00:33
      462000 -- (-1301.664) (-1298.820) [-1298.681] (-1297.791) * [-1298.446] (-1298.294) (-1298.800) (-1298.595) -- 0:00:33
      462500 -- (-1302.090) [-1298.698] (-1299.144) (-1299.350) * (-1298.929) (-1297.288) (-1298.813) [-1300.735] -- 0:00:34
      463000 -- [-1300.353] (-1298.424) (-1298.706) (-1304.842) * (-1299.577) [-1297.563] (-1298.520) (-1300.899) -- 0:00:34
      463500 -- (-1298.835) [-1301.396] (-1297.987) (-1300.020) * (-1298.002) (-1298.593) (-1299.644) [-1298.619] -- 0:00:34
      464000 -- (-1302.053) (-1303.069) [-1300.787] (-1298.761) * [-1304.854] (-1297.726) (-1299.402) (-1298.919) -- 0:00:34
      464500 -- (-1300.425) (-1301.160) [-1299.082] (-1300.357) * (-1300.052) [-1297.264] (-1297.713) (-1298.790) -- 0:00:34
      465000 -- (-1299.258) (-1301.510) (-1298.981) [-1297.399] * (-1297.052) [-1297.459] (-1300.077) (-1303.345) -- 0:00:34

      Average standard deviation of split frequencies: 0.015567

      465500 -- [-1301.313] (-1302.965) (-1298.239) (-1300.116) * (-1298.868) [-1297.907] (-1302.236) (-1298.507) -- 0:00:34
      466000 -- (-1298.828) [-1298.417] (-1297.568) (-1304.197) * [-1297.393] (-1298.606) (-1302.820) (-1299.311) -- 0:00:34
      466500 -- (-1300.920) (-1301.274) [-1297.311] (-1299.423) * (-1297.515) (-1298.316) (-1299.666) [-1298.723] -- 0:00:34
      467000 -- (-1299.528) (-1298.181) [-1297.746] (-1298.113) * [-1299.672] (-1299.591) (-1299.771) (-1300.027) -- 0:00:34
      467500 -- [-1300.036] (-1297.736) (-1297.403) (-1301.258) * (-1299.861) (-1298.243) [-1297.755] (-1302.362) -- 0:00:34
      468000 -- (-1300.879) (-1297.968) (-1297.305) [-1299.703] * [-1297.867] (-1297.871) (-1300.205) (-1298.721) -- 0:00:34
      468500 -- (-1305.522) [-1298.978] (-1300.826) (-1300.483) * (-1299.078) [-1298.519] (-1303.983) (-1300.967) -- 0:00:34
      469000 -- (-1301.521) (-1303.225) [-1301.440] (-1303.151) * (-1299.731) (-1298.240) [-1300.586] (-1297.390) -- 0:00:33
      469500 -- [-1298.471] (-1300.452) (-1299.401) (-1300.418) * (-1299.724) (-1299.497) (-1306.282) [-1298.395] -- 0:00:33
      470000 -- (-1298.574) [-1299.744] (-1299.373) (-1300.412) * (-1299.313) (-1298.924) (-1303.450) [-1298.603] -- 0:00:33

      Average standard deviation of split frequencies: 0.015672

      470500 -- [-1297.699] (-1299.702) (-1301.098) (-1298.833) * [-1300.448] (-1298.307) (-1301.928) (-1301.356) -- 0:00:33
      471000 -- (-1298.387) (-1299.266) (-1301.791) [-1299.717] * (-1299.922) (-1297.314) (-1304.435) [-1298.846] -- 0:00:33
      471500 -- (-1298.664) [-1301.217] (-1299.849) (-1298.261) * (-1300.731) (-1298.139) (-1301.924) [-1297.753] -- 0:00:33
      472000 -- (-1297.753) (-1302.234) [-1302.430] (-1308.092) * [-1300.527] (-1299.799) (-1302.956) (-1298.899) -- 0:00:33
      472500 -- [-1297.946] (-1303.104) (-1301.575) (-1304.364) * [-1302.903] (-1299.251) (-1302.811) (-1299.787) -- 0:00:33
      473000 -- [-1301.533] (-1300.547) (-1300.679) (-1297.324) * [-1298.956] (-1298.608) (-1299.272) (-1300.002) -- 0:00:33
      473500 -- (-1300.273) (-1299.317) (-1300.383) [-1298.289] * (-1297.891) [-1297.833] (-1299.271) (-1301.762) -- 0:00:33
      474000 -- (-1299.816) [-1300.272] (-1300.480) (-1297.924) * (-1297.719) [-1298.073] (-1301.936) (-1301.086) -- 0:00:33
      474500 -- [-1298.509] (-1300.288) (-1298.753) (-1297.291) * (-1300.484) (-1298.768) (-1302.219) [-1303.280] -- 0:00:33
      475000 -- (-1300.416) [-1300.405] (-1299.480) (-1298.186) * [-1299.827] (-1299.267) (-1300.158) (-1303.792) -- 0:00:33

      Average standard deviation of split frequencies: 0.014564

      475500 -- (-1299.607) [-1299.615] (-1299.120) (-1298.166) * (-1301.442) (-1305.824) [-1297.953] (-1300.114) -- 0:00:33
      476000 -- (-1299.099) (-1298.571) (-1298.203) [-1298.766] * (-1300.023) (-1300.698) (-1298.662) [-1297.315] -- 0:00:33
      476500 -- (-1299.203) (-1299.089) (-1298.435) [-1300.492] * (-1299.270) [-1298.871] (-1300.441) (-1299.118) -- 0:00:32
      477000 -- [-1299.747] (-1298.585) (-1299.230) (-1300.239) * (-1298.589) (-1298.882) [-1299.513] (-1302.607) -- 0:00:32
      477500 -- (-1298.338) [-1298.781] (-1298.902) (-1298.217) * (-1298.164) (-1301.142) [-1301.724] (-1300.004) -- 0:00:32
      478000 -- (-1301.720) [-1297.942] (-1300.431) (-1301.738) * (-1300.757) [-1298.161] (-1298.831) (-1298.239) -- 0:00:32
      478500 -- (-1300.222) (-1299.719) (-1301.843) [-1297.979] * (-1302.370) (-1298.463) [-1299.965] (-1297.492) -- 0:00:33
      479000 -- (-1299.769) (-1299.996) (-1308.059) [-1298.984] * (-1303.443) [-1300.209] (-1298.991) (-1299.814) -- 0:00:33
      479500 -- (-1298.320) [-1302.044] (-1301.353) (-1299.026) * (-1299.571) (-1298.509) (-1299.396) [-1299.004] -- 0:00:33
      480000 -- (-1299.569) (-1299.869) (-1303.152) [-1300.161] * (-1298.966) (-1298.161) [-1298.453] (-1298.815) -- 0:00:33

      Average standard deviation of split frequencies: 0.013903

      480500 -- (-1298.917) (-1299.602) [-1298.649] (-1301.563) * (-1302.458) [-1297.504] (-1300.377) (-1298.943) -- 0:00:33
      481000 -- (-1299.092) [-1298.023] (-1297.730) (-1298.697) * [-1297.330] (-1297.375) (-1300.897) (-1298.525) -- 0:00:33
      481500 -- (-1300.763) (-1300.229) [-1299.892] (-1301.347) * (-1297.963) (-1298.736) (-1301.533) [-1300.970] -- 0:00:33
      482000 -- [-1298.985] (-1297.769) (-1299.894) (-1299.605) * [-1298.416] (-1297.942) (-1298.435) (-1298.397) -- 0:00:33
      482500 -- (-1298.222) (-1297.339) (-1299.429) [-1302.642] * (-1297.942) [-1304.021] (-1299.319) (-1299.420) -- 0:00:33
      483000 -- [-1298.866] (-1297.594) (-1300.411) (-1302.474) * (-1299.290) (-1300.549) [-1298.820] (-1299.044) -- 0:00:33
      483500 -- [-1298.056] (-1298.738) (-1298.792) (-1299.231) * [-1297.561] (-1298.788) (-1298.107) (-1297.312) -- 0:00:33
      484000 -- (-1298.652) [-1297.768] (-1298.125) (-1301.196) * (-1297.263) (-1299.808) [-1302.707] (-1298.739) -- 0:00:33
      484500 -- (-1301.544) [-1298.117] (-1299.317) (-1304.770) * [-1297.386] (-1303.721) (-1299.986) (-1303.288) -- 0:00:32
      485000 -- (-1300.232) (-1298.281) (-1297.321) [-1298.635] * (-1301.173) (-1299.445) [-1297.386] (-1303.438) -- 0:00:32

      Average standard deviation of split frequencies: 0.013694

      485500 -- [-1297.701] (-1298.335) (-1300.082) (-1298.985) * (-1297.781) (-1298.931) [-1298.273] (-1300.924) -- 0:00:32
      486000 -- (-1297.726) (-1299.829) (-1301.521) [-1298.090] * (-1297.981) (-1301.186) (-1297.738) [-1297.613] -- 0:00:32
      486500 -- (-1298.044) (-1300.064) (-1298.640) [-1299.519] * [-1299.300] (-1301.642) (-1302.622) (-1297.646) -- 0:00:32
      487000 -- (-1298.515) [-1297.260] (-1298.436) (-1299.899) * (-1299.956) (-1300.405) (-1299.076) [-1298.173] -- 0:00:32
      487500 -- [-1298.917] (-1299.108) (-1300.844) (-1298.583) * (-1304.214) (-1302.386) [-1298.987] (-1297.516) -- 0:00:32
      488000 -- [-1297.402] (-1297.782) (-1299.822) (-1297.517) * [-1301.022] (-1300.769) (-1298.282) (-1300.917) -- 0:00:32
      488500 -- (-1298.949) [-1297.990] (-1298.268) (-1300.686) * (-1298.181) (-1299.804) (-1298.271) [-1300.990] -- 0:00:32
      489000 -- (-1303.269) (-1298.016) [-1297.498] (-1297.883) * (-1302.304) (-1299.559) (-1300.414) [-1299.271] -- 0:00:32
      489500 -- (-1297.719) [-1297.689] (-1302.511) (-1300.360) * (-1302.461) (-1299.710) [-1297.072] (-1300.639) -- 0:00:32
      490000 -- [-1299.163] (-1298.035) (-1300.559) (-1300.096) * (-1304.114) (-1301.718) [-1299.130] (-1300.369) -- 0:00:32

      Average standard deviation of split frequencies: 0.013846

      490500 -- [-1297.369] (-1298.958) (-1298.085) (-1297.259) * (-1306.683) (-1297.113) (-1297.558) [-1299.864] -- 0:00:32
      491000 -- [-1298.939] (-1298.934) (-1300.639) (-1300.224) * (-1300.203) (-1300.199) [-1298.143] (-1299.797) -- 0:00:32
      491500 -- (-1298.279) (-1298.564) (-1304.043) [-1299.292] * (-1299.157) (-1298.538) (-1300.268) [-1301.825] -- 0:00:32
      492000 -- (-1298.398) (-1299.542) [-1300.183] (-1297.499) * [-1297.819] (-1298.794) (-1303.059) (-1302.579) -- 0:00:32
      492500 -- (-1301.174) [-1297.402] (-1298.335) (-1298.510) * [-1298.059] (-1299.771) (-1301.976) (-1300.014) -- 0:00:31
      493000 -- [-1298.111] (-1299.435) (-1299.300) (-1297.300) * (-1300.169) [-1299.962] (-1300.504) (-1299.296) -- 0:00:31
      493500 -- (-1298.969) (-1299.752) (-1298.168) [-1297.640] * (-1298.386) [-1298.721] (-1302.820) (-1300.695) -- 0:00:31
      494000 -- [-1306.684] (-1299.796) (-1300.878) (-1301.334) * (-1299.183) [-1299.241] (-1298.586) (-1301.756) -- 0:00:31
      494500 -- (-1300.736) (-1304.505) [-1299.161] (-1299.583) * (-1299.093) [-1301.311] (-1298.269) (-1298.769) -- 0:00:31
      495000 -- [-1302.212] (-1300.082) (-1298.670) (-1299.582) * [-1300.382] (-1299.546) (-1300.115) (-1299.066) -- 0:00:32

      Average standard deviation of split frequencies: 0.013362

      495500 -- (-1300.177) (-1300.682) [-1301.015] (-1298.776) * (-1304.183) (-1298.322) (-1300.184) [-1299.314] -- 0:00:32
      496000 -- (-1300.195) [-1297.815] (-1300.297) (-1304.216) * (-1300.397) (-1298.324) [-1297.365] (-1299.373) -- 0:00:32
      496500 -- (-1298.426) (-1297.484) [-1297.737] (-1299.716) * (-1298.983) (-1297.855) [-1299.261] (-1297.950) -- 0:00:32
      497000 -- [-1299.419] (-1297.435) (-1298.043) (-1300.109) * (-1300.929) [-1300.403] (-1300.459) (-1298.284) -- 0:00:32
      497500 -- (-1300.734) (-1298.710) [-1297.258] (-1299.099) * (-1298.433) (-1298.716) [-1301.089] (-1298.909) -- 0:00:32
      498000 -- (-1298.781) [-1297.942] (-1299.375) (-1297.901) * (-1298.022) (-1297.358) (-1300.407) [-1300.277] -- 0:00:32
      498500 -- (-1299.542) [-1297.697] (-1299.264) (-1298.354) * (-1300.066) (-1298.936) (-1299.786) [-1298.564] -- 0:00:32
      499000 -- (-1300.519) (-1298.214) [-1298.109] (-1300.033) * (-1298.247) [-1298.762] (-1301.115) (-1303.602) -- 0:00:32
      499500 -- [-1298.087] (-1302.173) (-1298.033) (-1299.728) * [-1297.252] (-1299.746) (-1302.782) (-1301.603) -- 0:00:32
      500000 -- (-1297.704) (-1297.511) (-1302.210) [-1297.874] * (-1297.914) [-1297.954] (-1302.914) (-1299.059) -- 0:00:32

      Average standard deviation of split frequencies: 0.013293

      500500 -- (-1298.304) (-1299.008) [-1299.848] (-1299.243) * [-1299.985] (-1299.107) (-1302.695) (-1298.877) -- 0:00:31
      501000 -- [-1297.782] (-1304.444) (-1299.715) (-1300.946) * (-1300.729) (-1299.821) [-1298.458] (-1298.465) -- 0:00:31
      501500 -- (-1297.363) (-1299.890) (-1297.896) [-1298.990] * [-1298.732] (-1301.343) (-1300.273) (-1298.080) -- 0:00:31
      502000 -- (-1298.159) [-1298.370] (-1297.411) (-1298.317) * (-1298.614) (-1299.066) [-1301.060] (-1301.836) -- 0:00:31
      502500 -- (-1300.550) (-1300.558) [-1300.457] (-1298.205) * (-1300.907) [-1299.616] (-1300.684) (-1301.195) -- 0:00:31
      503000 -- (-1299.674) (-1299.562) (-1298.765) [-1300.554] * (-1301.300) [-1305.022] (-1298.386) (-1298.181) -- 0:00:31
      503500 -- (-1302.100) [-1299.231] (-1298.709) (-1298.836) * [-1299.399] (-1297.975) (-1297.993) (-1299.405) -- 0:00:31
      504000 -- (-1299.789) [-1298.460] (-1301.274) (-1300.284) * (-1299.446) [-1297.587] (-1298.324) (-1297.521) -- 0:00:31
      504500 -- [-1299.649] (-1299.161) (-1300.851) (-1298.843) * (-1299.588) (-1297.510) [-1298.362] (-1298.617) -- 0:00:31
      505000 -- (-1300.252) (-1302.776) (-1301.209) [-1301.453] * (-1299.648) (-1298.915) (-1299.765) [-1301.095] -- 0:00:31

      Average standard deviation of split frequencies: 0.014139

      505500 -- (-1300.125) (-1302.312) (-1301.595) [-1299.508] * (-1299.680) (-1297.593) (-1299.489) [-1297.805] -- 0:00:31
      506000 -- (-1301.181) (-1300.606) [-1300.308] (-1298.336) * (-1300.429) (-1301.751) [-1298.591] (-1302.066) -- 0:00:31
      506500 -- (-1300.277) (-1298.117) (-1298.766) [-1297.804] * (-1298.178) [-1299.436] (-1304.664) (-1300.287) -- 0:00:31
      507000 -- [-1302.391] (-1299.138) (-1298.731) (-1300.849) * (-1298.065) [-1298.662] (-1300.975) (-1297.464) -- 0:00:31
      507500 -- (-1301.992) [-1301.838] (-1303.049) (-1304.275) * [-1298.367] (-1300.241) (-1300.941) (-1298.544) -- 0:00:31
      508000 -- [-1300.571] (-1302.773) (-1299.725) (-1297.801) * (-1300.968) (-1303.294) (-1301.752) [-1298.281] -- 0:00:30
      508500 -- (-1304.210) [-1299.796] (-1301.043) (-1297.062) * (-1299.353) (-1298.357) (-1303.373) [-1297.687] -- 0:00:30
      509000 -- (-1300.398) [-1297.237] (-1300.225) (-1299.727) * (-1299.387) (-1298.032) (-1299.137) [-1298.642] -- 0:00:30
      50