--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:59:32 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/hisA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1004.72 -1008.53
2 -1004.71 -1007.81
--------------------------------------
TOTAL -1004.71 -1008.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884583 0.091965 0.334032 1.473970 0.853656 1379.61 1440.31 1.000
r(A<->C){all} 0.164576 0.018780 0.000035 0.436443 0.132302 128.49 238.04 1.003
r(A<->G){all} 0.170134 0.020374 0.000004 0.459560 0.130876 130.89 153.69 1.003
r(A<->T){all} 0.165760 0.019866 0.000043 0.436207 0.128803 144.90 157.52 1.003
r(C<->G){all} 0.164753 0.019763 0.000181 0.448077 0.127535 161.00 248.23 1.001
r(C<->T){all} 0.159082 0.019943 0.000022 0.440576 0.120394 136.38 146.18 1.000
r(G<->T){all} 0.175695 0.020132 0.000023 0.446567 0.144119 137.66 203.38 1.001
pi(A){all} 0.188814 0.000208 0.161951 0.218373 0.188694 1253.38 1256.43 1.000
pi(C){all} 0.258835 0.000242 0.231598 0.291737 0.258570 1184.58 1243.31 1.001
pi(G){all} 0.330335 0.000302 0.294879 0.363023 0.330357 1219.63 1271.14 1.001
pi(T){all} 0.222016 0.000238 0.191233 0.251546 0.221888 1031.67 1190.30 1.000
alpha{1,2} 0.428858 0.235607 0.000109 1.412441 0.256906 976.07 1141.85 1.000
alpha{3} 0.471440 0.267140 0.000174 1.494645 0.301787 1293.12 1316.50 1.000
pinvar{all} 0.997895 0.000007 0.993423 0.999999 0.998658 1374.42 1437.71 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -969.091957
Model 2: PositiveSelection -969.091957
Model 0: one-ratio -969.09239
Model 7: beta -969.091957
Model 8: beta&w>1 -969.091986
Model 0 vs 1 8.660000000872969E-4
Model 2 vs 1 0.0
Model 8 vs 7 5.800000008093775E-5
>C1
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
>C2
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
>C3
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
>C4
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
>C5
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
>C6
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=245
C1 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
C2 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
C3 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
C4 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
C5 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
C6 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
**************************************************
C1 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
C2 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
C3 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
C4 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
C5 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
C6 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
**************************************************
C1 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
C2 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
C3 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
C4 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
C5 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
C6 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
**************************************************
C1 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
C2 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
C3 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
C4 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
C5 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
C6 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
**************************************************
C1 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
C2 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
C3 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
C4 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
C5 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
C6 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
*********************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 245 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 245 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7350]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7350]--->[7350]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.492 Mb, Max= 30.797 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
C2 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
C3 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
C4 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
C5 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
C6 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
**************************************************
C1 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
C2 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
C3 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
C4 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
C5 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
C6 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
**************************************************
C1 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
C2 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
C3 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
C4 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
C5 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
C6 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
**************************************************
C1 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
C2 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
C3 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
C4 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
C5 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
C6 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
**************************************************
C1 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
C2 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
C3 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
C4 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
C5 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
C6 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
*********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
C2 TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
C3 TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
C4 TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
C5 TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
C6 TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
**************************************************
C1 CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
C2 CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
C3 CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
C4 CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
C5 CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
C6 CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
**************************************************
C1 CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
C2 CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
C3 CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
C4 CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
C5 CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
C6 CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
**************************************************
C1 CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
C2 CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
C3 CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
C4 CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
C5 CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
C6 CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
**************************************************
C1 TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
C2 TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
C3 TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
C4 TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
C5 TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
C6 TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
**************************************************
C1 TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
C2 TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
C3 TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
C4 TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
C5 TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
C6 TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
**************************************************
C1 GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
C2 GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
C3 GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
C4 GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
C5 GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
C6 GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
**************************************************
C1 GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
C2 GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
C3 GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
C4 GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
C5 GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
C6 GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
**************************************************
C1 TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
C2 TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
C3 TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
C4 TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
C5 TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
C6 TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
**************************************************
C1 GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
C2 GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
C3 GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
C4 GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
C5 GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
C6 GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
**************************************************
C1 CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
C2 CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
C3 CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
C4 CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
C5 CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
C6 CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
**************************************************
C1 ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
C2 ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
C3 ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
C4 ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
C5 ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
C6 ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
**************************************************
C1 GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
C2 GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
C3 GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
C4 GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
C5 GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
C6 GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
**************************************************
C1 GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
C2 GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
C3 GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
C4 GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
C5 GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
C6 GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
**************************************************
C1 TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
C2 TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
C3 TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
C4 TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
C5 TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
C6 TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
***********************************
>C1
TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
>C2
TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
>C3
TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
>C4
TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
>C5
TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
>C6
TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC
CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG
CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC
CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT
TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA
TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG
GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT
GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG
TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA
GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT
CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG
ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC
GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA
GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT
TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
>C1
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
>C2
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
>C3
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
>C4
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
>C5
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
>C6
LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 735 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579791468
Setting output file names to "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1904475631
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0412043612
Seed = 1604759738
Swapseed = 1579791468
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1644.965232 -- -24.965149
Chain 2 -- -1644.965232 -- -24.965149
Chain 3 -- -1644.964982 -- -24.965149
Chain 4 -- -1644.965232 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1644.965232 -- -24.965149
Chain 2 -- -1644.965232 -- -24.965149
Chain 3 -- -1644.965137 -- -24.965149
Chain 4 -- -1644.965232 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1644.965] (-1644.965) (-1644.965) (-1644.965) * [-1644.965] (-1644.965) (-1644.965) (-1644.965)
500 -- (-1015.094) (-1025.796) [-1010.683] (-1027.191) * (-1017.228) [-1012.410] (-1029.659) (-1017.814) -- 0:00:00
1000 -- (-1027.067) (-1028.435) (-1013.932) [-1020.615] * (-1014.038) [-1011.095] (-1014.899) (-1013.993) -- 0:00:00
1500 -- (-1015.328) (-1017.951) [-1008.668] (-1011.633) * (-1009.856) (-1015.616) (-1013.880) [-1024.095] -- 0:00:00
2000 -- (-1012.027) (-1018.763) [-1013.506] (-1015.885) * (-1013.729) [-1010.264] (-1016.162) (-1021.152) -- 0:00:00
2500 -- (-1013.475) [-1016.229] (-1015.245) (-1013.773) * (-1014.367) (-1011.149) (-1011.802) [-1017.471] -- 0:00:00
3000 -- (-1020.733) (-1015.314) [-1010.993] (-1010.533) * [-1011.645] (-1015.899) (-1025.419) (-1015.162) -- 0:00:00
3500 -- (-1011.295) [-1009.280] (-1013.402) (-1016.159) * (-1031.550) (-1019.348) [-1014.387] (-1009.342) -- 0:04:44
4000 -- (-1023.080) (-1012.728) (-1010.566) [-1010.580] * [-1009.946] (-1014.292) (-1019.706) (-1020.994) -- 0:04:09
4500 -- (-1012.811) (-1018.340) [-1011.255] (-1016.860) * (-1013.064) (-1020.810) [-1017.230] (-1013.807) -- 0:03:41
5000 -- (-1017.515) (-1017.419) (-1013.485) [-1009.766] * (-1020.999) (-1021.927) [-1014.315] (-1012.724) -- 0:03:19
Average standard deviation of split frequencies: 0.071425
5500 -- (-1012.560) (-1010.828) [-1013.695] (-1013.378) * [-1021.726] (-1015.735) (-1014.392) (-1021.981) -- 0:03:00
6000 -- (-1011.330) (-1020.322) [-1014.101] (-1017.605) * (-1017.363) (-1010.231) (-1016.457) [-1015.507] -- 0:02:45
6500 -- (-1011.335) (-1017.579) [-1013.366] (-1014.410) * [-1011.985] (-1015.411) (-1013.742) (-1014.737) -- 0:02:32
7000 -- [-1010.442] (-1018.112) (-1011.022) (-1013.350) * (-1021.475) (-1018.065) (-1015.830) [-1015.413] -- 0:02:21
7500 -- (-1018.249) (-1016.436) [-1012.065] (-1010.801) * (-1018.104) (-1017.024) [-1009.998] (-1014.501) -- 0:02:12
8000 -- [-1010.518] (-1009.311) (-1011.273) (-1013.416) * [-1014.207] (-1018.905) (-1019.678) (-1012.627) -- 0:02:04
8500 -- (-1018.133) (-1013.648) [-1007.795] (-1009.280) * [-1017.497] (-1015.871) (-1020.428) (-1016.487) -- 0:01:56
9000 -- [-1014.168] (-1014.476) (-1015.177) (-1016.686) * (-1011.917) (-1016.708) [-1015.306] (-1016.699) -- 0:01:50
9500 -- [-1013.169] (-1020.140) (-1016.387) (-1012.063) * [-1011.793] (-1019.104) (-1011.415) (-1014.132) -- 0:01:44
10000 -- (-1021.641) [-1013.424] (-1010.164) (-1011.375) * [-1011.121] (-1016.613) (-1013.591) (-1024.793) -- 0:01:39
Average standard deviation of split frequencies: 0.078344
10500 -- (-1012.965) (-1017.686) (-1015.395) [-1012.961] * (-1021.184) (-1019.753) (-1015.601) [-1015.750] -- 0:01:34
11000 -- [-1010.532] (-1026.902) (-1017.902) (-1014.583) * (-1013.230) [-1015.308] (-1015.578) (-1020.571) -- 0:01:29
11500 -- [-1013.163] (-1026.620) (-1016.633) (-1008.857) * (-1022.020) (-1013.653) [-1010.500] (-1015.466) -- 0:01:25
12000 -- [-1015.795] (-1007.571) (-1015.643) (-1011.421) * (-1012.262) (-1015.253) (-1016.835) [-1013.256] -- 0:01:22
12500 -- (-1023.306) (-1007.125) [-1013.829] (-1017.586) * (-1009.126) (-1005.679) [-1017.844] (-1011.178) -- 0:01:19
13000 -- (-1014.170) (-1006.066) (-1008.181) [-1020.211] * (-1021.978) (-1008.049) (-1016.514) [-1013.183] -- 0:01:15
13500 -- [-1010.956] (-1004.633) (-1014.611) (-1017.154) * (-1014.921) [-1003.980] (-1015.058) (-1012.695) -- 0:01:13
14000 -- [-1012.770] (-1004.517) (-1016.243) (-1017.738) * (-1010.788) (-1006.761) [-1011.088] (-1012.320) -- 0:01:10
14500 -- [-1013.930] (-1003.907) (-1018.979) (-1017.278) * [-1009.538] (-1010.342) (-1010.646) (-1008.164) -- 0:01:07
15000 -- (-1015.557) (-1004.823) (-1017.833) [-1012.081] * (-1014.913) (-1006.778) (-1015.109) [-1013.133] -- 0:01:05
Average standard deviation of split frequencies: 0.071552
15500 -- (-1015.720) (-1003.514) [-1011.834] (-1021.449) * [-1009.548] (-1004.755) (-1026.166) (-1013.908) -- 0:01:03
16000 -- [-1014.896] (-1003.499) (-1013.193) (-1028.814) * (-1014.269) (-1003.206) [-1012.466] (-1011.171) -- 0:01:01
16500 -- [-1020.681] (-1003.459) (-1020.153) (-1017.619) * (-1022.318) (-1003.209) [-1011.659] (-1017.385) -- 0:00:59
17000 -- (-1014.406) (-1004.765) (-1015.897) [-1006.498] * (-1013.807) (-1005.035) (-1005.749) [-1011.721] -- 0:00:57
17500 -- [-1008.568] (-1004.161) (-1014.236) (-1006.757) * [-1013.866] (-1005.617) (-1005.558) (-1015.890) -- 0:00:56
18000 -- (-1015.817) (-1007.234) (-1013.949) [-1003.702] * (-1010.752) (-1004.363) (-1006.227) [-1014.171] -- 0:00:54
18500 -- [-1010.558] (-1004.733) (-1012.401) (-1003.497) * (-1018.552) (-1003.282) (-1005.533) [-1010.694] -- 0:01:46
19000 -- [-1011.100] (-1006.076) (-1017.407) (-1003.938) * (-1015.879) [-1004.287] (-1005.003) (-1013.953) -- 0:01:43
19500 -- (-1016.643) (-1004.370) [-1010.817] (-1006.057) * [-1015.068] (-1003.904) (-1004.666) (-1017.171) -- 0:01:40
20000 -- (-1012.575) [-1004.889] (-1017.798) (-1006.999) * (-1010.293) [-1004.763] (-1004.840) (-1020.746) -- 0:01:38
Average standard deviation of split frequencies: 0.049421
20500 -- [-1012.315] (-1004.740) (-1015.590) (-1003.737) * (-1019.037) (-1006.397) (-1005.839) [-1024.105] -- 0:01:35
21000 -- (-1013.572) (-1012.866) (-1017.206) [-1003.803] * (-1013.766) (-1005.674) (-1003.159) [-1012.478] -- 0:01:33
21500 -- [-1012.694] (-1010.081) (-1011.253) (-1004.884) * (-1012.348) (-1006.565) [-1003.178] (-1014.218) -- 0:01:31
22000 -- (-1015.371) [-1007.687] (-1011.770) (-1004.935) * (-1012.269) (-1003.754) (-1003.168) [-1011.077] -- 0:01:28
22500 -- (-1015.881) (-1006.761) [-1012.256] (-1005.248) * (-1015.587) [-1005.987] (-1004.169) (-1014.745) -- 0:01:26
23000 -- [-1016.651] (-1007.131) (-1013.581) (-1003.615) * (-1013.607) (-1010.295) (-1005.060) [-1009.333] -- 0:01:24
23500 -- [-1019.873] (-1006.087) (-1015.714) (-1004.903) * [-1009.167] (-1015.789) (-1004.984) (-1016.004) -- 0:01:23
24000 -- [-1015.140] (-1003.971) (-1015.012) (-1009.701) * (-1017.068) (-1005.956) (-1011.897) [-1013.007] -- 0:01:21
24500 -- (-1012.316) (-1004.908) [-1012.970] (-1005.081) * [-1011.236] (-1006.737) (-1004.945) (-1015.942) -- 0:01:19
25000 -- [-1018.045] (-1003.740) (-1013.405) (-1005.784) * (-1019.453) (-1005.156) [-1005.125] (-1024.850) -- 0:01:18
Average standard deviation of split frequencies: 0.042855
25500 -- (-1015.864) (-1005.534) [-1020.944] (-1006.820) * (-1014.136) (-1004.943) [-1003.959] (-1015.464) -- 0:01:16
26000 -- (-1018.220) (-1006.797) [-1014.727] (-1006.202) * (-1018.122) [-1006.011] (-1006.153) (-1014.321) -- 0:01:14
26500 -- [-1022.482] (-1004.760) (-1017.566) (-1007.732) * (-1017.336) (-1005.058) [-1004.893] (-1019.249) -- 0:01:13
27000 -- [-1016.595] (-1004.032) (-1010.812) (-1005.551) * (-1012.726) (-1007.129) (-1004.702) [-1009.359] -- 0:01:12
27500 -- (-1018.576) (-1004.101) [-1010.924] (-1004.059) * (-1016.358) (-1011.352) (-1007.736) [-1011.107] -- 0:01:10
28000 -- [-1011.023] (-1003.771) (-1016.230) (-1004.605) * (-1015.276) [-1006.296] (-1005.856) (-1015.750) -- 0:01:09
28500 -- (-1007.031) (-1005.837) [-1010.254] (-1005.223) * (-1016.192) (-1009.090) [-1004.930] (-1014.429) -- 0:01:08
29000 -- (-1005.056) (-1005.540) (-1016.572) [-1004.037] * [-1012.726] (-1004.614) (-1004.908) (-1015.328) -- 0:01:06
29500 -- (-1005.063) (-1006.876) [-1011.027] (-1004.410) * (-1016.310) [-1004.959] (-1004.754) (-1014.593) -- 0:01:05
30000 -- [-1003.795] (-1009.728) (-1014.358) (-1005.749) * (-1017.100) (-1006.127) (-1004.411) [-1013.256] -- 0:01:04
Average standard deviation of split frequencies: 0.052404
30500 -- (-1004.618) [-1004.898] (-1023.856) (-1004.850) * [-1013.246] (-1008.738) (-1004.493) (-1018.887) -- 0:01:03
31000 -- (-1004.802) (-1005.209) (-1012.302) [-1003.621] * (-1010.852) [-1006.428] (-1004.323) (-1011.781) -- 0:01:02
31500 -- (-1004.994) [-1004.460] (-1013.017) (-1008.222) * (-1021.701) [-1005.006] (-1005.346) (-1011.835) -- 0:01:01
32000 -- (-1005.848) (-1004.165) (-1017.667) [-1004.731] * (-1013.561) (-1003.665) [-1009.002] (-1016.738) -- 0:01:00
32500 -- (-1005.546) (-1004.798) [-1009.651] (-1004.606) * (-1024.239) (-1004.093) [-1004.443] (-1014.699) -- 0:00:59
33000 -- (-1011.206) (-1003.968) (-1004.640) [-1004.656] * (-1015.114) (-1003.795) (-1004.995) [-1015.536] -- 0:00:58
33500 -- (-1004.770) (-1007.625) (-1004.616) [-1005.932] * [-1019.383] (-1004.686) (-1005.908) (-1019.239) -- 0:00:57
34000 -- (-1005.410) (-1005.049) [-1003.785] (-1006.387) * [-1014.529] (-1004.969) (-1003.304) (-1012.287) -- 0:01:25
34500 -- (-1004.654) [-1006.157] (-1004.542) (-1007.459) * (-1012.278) (-1003.577) (-1006.546) [-1014.110] -- 0:01:23
35000 -- [-1007.541] (-1009.151) (-1004.397) (-1005.404) * (-1012.560) (-1008.727) (-1005.755) [-1014.484] -- 0:01:22
Average standard deviation of split frequencies: 0.046143
35500 -- (-1007.398) (-1005.019) [-1003.658] (-1012.482) * (-1009.665) (-1007.143) (-1008.391) [-1011.405] -- 0:01:21
36000 -- [-1005.037] (-1004.785) (-1005.545) (-1008.671) * (-1011.839) (-1004.667) [-1004.779] (-1006.003) -- 0:01:20
36500 -- (-1008.164) (-1009.905) (-1006.974) [-1004.875] * (-1021.461) (-1008.027) [-1008.960] (-1005.296) -- 0:01:19
37000 -- (-1007.378) [-1004.425] (-1006.135) (-1006.946) * (-1026.671) [-1004.962] (-1004.986) (-1003.832) -- 0:01:18
37500 -- (-1007.986) (-1004.833) (-1005.097) [-1007.036] * (-1028.211) [-1004.961] (-1006.213) (-1005.472) -- 0:01:17
38000 -- (-1003.919) (-1005.490) (-1005.327) [-1005.151] * [-1012.011] (-1003.886) (-1007.819) (-1003.173) -- 0:01:15
38500 -- (-1004.502) (-1005.212) [-1004.663] (-1003.890) * (-1015.281) (-1004.839) (-1004.894) [-1005.294] -- 0:01:14
39000 -- (-1006.331) (-1005.664) (-1007.601) [-1004.233] * [-1016.831] (-1003.718) (-1004.783) (-1007.268) -- 0:01:13
39500 -- (-1006.364) (-1003.480) [-1004.117] (-1006.863) * [-1016.719] (-1004.079) (-1004.654) (-1005.620) -- 0:01:12
40000 -- (-1010.636) (-1007.338) [-1005.313] (-1003.699) * [-1013.005] (-1003.976) (-1005.265) (-1008.419) -- 0:01:12
Average standard deviation of split frequencies: 0.048541
40500 -- (-1004.665) (-1006.871) (-1004.480) [-1003.771] * (-1016.569) (-1006.386) [-1005.673] (-1004.637) -- 0:01:11
41000 -- [-1005.837] (-1008.795) (-1004.449) (-1007.011) * (-1009.428) (-1004.435) [-1006.018] (-1005.730) -- 0:01:10
41500 -- (-1005.262) (-1008.074) [-1005.048] (-1007.147) * (-1012.387) (-1005.532) [-1004.658] (-1006.266) -- 0:01:09
42000 -- (-1004.027) (-1008.745) [-1004.146] (-1006.858) * [-1009.817] (-1005.053) (-1005.513) (-1005.505) -- 0:01:08
42500 -- (-1007.143) (-1009.094) (-1005.511) [-1004.499] * (-1015.316) (-1004.107) (-1005.610) [-1005.731] -- 0:01:07
43000 -- (-1006.718) (-1004.034) [-1003.791] (-1006.054) * (-1014.040) (-1003.469) (-1008.462) [-1008.125] -- 0:01:06
43500 -- (-1006.935) (-1006.222) [-1007.384] (-1006.313) * (-1018.520) (-1008.268) [-1004.405] (-1005.592) -- 0:01:05
44000 -- (-1006.710) (-1006.222) (-1005.736) [-1006.203] * [-1019.319] (-1005.433) (-1004.601) (-1012.545) -- 0:01:05
44500 -- [-1008.087] (-1005.738) (-1006.059) (-1004.911) * (-1013.626) (-1005.699) [-1003.932] (-1013.991) -- 0:01:04
45000 -- (-1006.973) [-1004.831] (-1004.951) (-1006.665) * (-1019.109) [-1005.221] (-1005.231) (-1009.905) -- 0:01:03
Average standard deviation of split frequencies: 0.040422
45500 -- (-1004.449) (-1004.709) [-1006.246] (-1009.970) * (-1011.667) (-1004.684) (-1004.740) [-1007.214] -- 0:01:02
46000 -- (-1005.245) (-1004.020) (-1005.601) [-1006.905] * [-1007.717] (-1004.812) (-1005.836) (-1008.457) -- 0:01:02
46500 -- [-1004.497] (-1009.626) (-1004.869) (-1006.852) * (-1011.197) (-1008.418) [-1004.229] (-1006.496) -- 0:01:01
47000 -- (-1005.405) (-1006.878) (-1005.223) [-1004.987] * (-1005.982) (-1006.323) (-1004.317) [-1005.571] -- 0:01:00
47500 -- (-1005.236) (-1006.326) (-1006.661) [-1005.420] * [-1006.710] (-1005.829) (-1006.459) (-1003.908) -- 0:01:00
48000 -- (-1004.399) (-1005.850) (-1004.441) [-1004.920] * (-1003.379) (-1005.385) (-1004.497) [-1003.657] -- 0:00:59
48500 -- [-1005.556] (-1007.979) (-1005.551) (-1004.791) * (-1003.836) [-1004.127] (-1007.309) (-1006.142) -- 0:00:58
49000 -- (-1005.473) (-1004.513) [-1012.457] (-1005.722) * (-1004.203) [-1004.323] (-1005.157) (-1005.963) -- 0:00:58
49500 -- (-1005.474) [-1006.550] (-1004.758) (-1007.188) * [-1004.824] (-1005.628) (-1006.858) (-1005.675) -- 0:00:57
50000 -- (-1003.396) (-1004.782) [-1005.765] (-1005.767) * [-1004.105] (-1008.210) (-1009.057) (-1008.063) -- 0:01:16
Average standard deviation of split frequencies: 0.039953
50500 -- (-1003.347) [-1005.063] (-1006.097) (-1005.054) * (-1004.452) [-1003.905] (-1004.189) (-1006.360) -- 0:01:15
51000 -- (-1004.961) [-1005.301] (-1009.836) (-1003.892) * (-1004.047) [-1007.217] (-1015.557) (-1005.201) -- 0:01:14
51500 -- [-1004.763] (-1005.494) (-1005.710) (-1003.245) * (-1004.933) (-1004.565) [-1009.999] (-1009.807) -- 0:01:13
52000 -- (-1005.938) (-1008.649) [-1006.612] (-1009.287) * (-1004.516) (-1007.433) [-1003.495] (-1006.759) -- 0:01:12
52500 -- (-1005.056) (-1006.757) (-1004.834) [-1005.719] * (-1004.909) (-1006.305) [-1005.167] (-1007.402) -- 0:01:12
53000 -- [-1005.030] (-1006.865) (-1004.723) (-1005.244) * (-1006.461) [-1004.308] (-1004.477) (-1007.104) -- 0:01:11
53500 -- [-1006.273] (-1009.023) (-1005.883) (-1005.363) * [-1004.293] (-1006.769) (-1004.029) (-1003.933) -- 0:01:10
54000 -- (-1006.589) (-1006.934) (-1008.504) [-1003.472] * (-1003.584) (-1007.498) (-1003.417) [-1004.192] -- 0:01:10
54500 -- (-1006.206) [-1003.611] (-1005.511) (-1011.192) * [-1004.306] (-1005.941) (-1003.417) (-1003.975) -- 0:01:09
55000 -- (-1006.528) (-1003.606) (-1004.430) [-1008.454] * (-1006.036) (-1006.326) (-1003.502) [-1003.761] -- 0:01:08
Average standard deviation of split frequencies: 0.038407
55500 -- (-1004.212) [-1003.338] (-1007.062) (-1008.784) * (-1006.126) [-1004.828] (-1004.709) (-1005.574) -- 0:01:08
56000 -- (-1004.362) [-1004.216] (-1005.644) (-1008.721) * (-1008.514) (-1006.892) (-1009.833) [-1005.255] -- 0:01:07
56500 -- (-1003.754) [-1005.102] (-1005.221) (-1012.849) * [-1006.836] (-1003.546) (-1004.543) (-1004.345) -- 0:01:06
57000 -- (-1006.178) [-1007.430] (-1005.857) (-1009.994) * (-1007.084) [-1004.289] (-1004.305) (-1004.142) -- 0:01:06
57500 -- (-1003.818) (-1005.701) (-1004.698) [-1004.269] * [-1007.213] (-1003.779) (-1004.230) (-1008.718) -- 0:01:05
58000 -- (-1003.170) (-1005.140) (-1005.999) [-1005.222] * (-1007.346) [-1003.787] (-1005.335) (-1005.634) -- 0:01:04
58500 -- (-1005.216) (-1004.092) (-1004.396) [-1004.185] * (-1004.907) (-1005.596) (-1004.699) [-1006.711] -- 0:01:04
59000 -- (-1005.231) (-1004.278) [-1005.458] (-1006.381) * [-1005.418] (-1008.909) (-1006.556) (-1008.127) -- 0:01:03
59500 -- (-1003.713) (-1003.149) [-1004.101] (-1007.203) * (-1004.514) (-1009.253) [-1006.224] (-1011.596) -- 0:01:03
60000 -- (-1005.436) (-1004.239) [-1005.551] (-1004.914) * [-1005.234] (-1009.121) (-1005.315) (-1014.426) -- 0:01:02
Average standard deviation of split frequencies: 0.033996
60500 -- (-1006.842) (-1007.295) [-1005.266] (-1007.703) * (-1005.585) (-1006.338) [-1005.003] (-1014.091) -- 0:01:02
61000 -- (-1004.505) (-1007.339) (-1005.517) [-1009.173] * (-1006.140) (-1006.342) (-1005.652) [-1006.947] -- 0:01:01
61500 -- (-1005.858) (-1004.438) [-1003.488] (-1004.456) * [-1004.956] (-1009.362) (-1005.802) (-1005.999) -- 0:01:01
62000 -- (-1007.578) [-1005.670] (-1005.111) (-1004.932) * (-1005.935) (-1005.788) (-1006.890) [-1003.638] -- 0:01:00
62500 -- (-1006.102) (-1006.884) (-1004.776) [-1004.262] * [-1003.714] (-1004.867) (-1006.621) (-1003.797) -- 0:01:00
63000 -- (-1005.637) (-1007.001) [-1008.106] (-1004.759) * (-1003.714) (-1006.055) (-1007.169) [-1004.370] -- 0:00:59
63500 -- [-1005.344] (-1006.775) (-1006.919) (-1005.216) * (-1003.831) (-1005.185) (-1012.773) [-1005.160] -- 0:00:58
64000 -- (-1005.539) (-1005.483) (-1006.339) [-1006.258] * (-1006.395) [-1003.923] (-1004.826) (-1010.089) -- 0:00:58
64500 -- (-1003.746) (-1006.779) [-1003.393] (-1005.379) * (-1004.984) [-1005.410] (-1005.411) (-1011.631) -- 0:00:58
65000 -- (-1003.501) (-1005.347) [-1004.414] (-1005.204) * (-1004.952) (-1004.870) (-1005.862) [-1005.101] -- 0:00:57
Average standard deviation of split frequencies: 0.030157
65500 -- (-1003.322) (-1004.622) [-1003.931] (-1005.507) * (-1005.737) (-1004.896) (-1005.097) [-1008.343] -- 0:00:57
66000 -- (-1003.352) [-1004.389] (-1005.018) (-1005.210) * (-1004.531) (-1003.537) [-1008.758] (-1005.537) -- 0:01:10
66500 -- (-1004.488) [-1005.787] (-1006.725) (-1005.617) * [-1006.107] (-1003.904) (-1006.909) (-1008.624) -- 0:01:10
67000 -- (-1005.004) [-1004.665] (-1005.720) (-1004.262) * [-1004.761] (-1004.367) (-1005.720) (-1007.100) -- 0:01:09
67500 -- (-1004.265) (-1008.403) (-1005.432) [-1005.727] * [-1005.392] (-1003.742) (-1005.809) (-1009.023) -- 0:01:09
68000 -- (-1008.279) (-1011.272) (-1003.878) [-1005.969] * [-1008.580] (-1003.281) (-1006.198) (-1010.012) -- 0:01:08
68500 -- (-1005.521) (-1006.225) (-1003.914) [-1005.742] * (-1008.748) (-1003.330) (-1004.224) [-1004.644] -- 0:01:07
69000 -- (-1007.252) (-1005.442) [-1005.127] (-1007.653) * [-1006.983] (-1003.921) (-1003.980) (-1004.628) -- 0:01:07
69500 -- (-1004.392) [-1003.966] (-1005.638) (-1006.384) * (-1005.780) (-1006.928) (-1005.636) [-1003.945] -- 0:01:06
70000 -- (-1006.937) [-1005.708] (-1004.082) (-1003.417) * [-1005.997] (-1004.816) (-1007.367) (-1004.870) -- 0:01:06
Average standard deviation of split frequencies: 0.031599
70500 -- [-1006.012] (-1005.900) (-1003.742) (-1009.146) * (-1005.556) (-1005.904) [-1008.069] (-1004.836) -- 0:01:05
71000 -- [-1006.758] (-1006.084) (-1004.712) (-1007.696) * (-1004.459) [-1005.604] (-1004.073) (-1005.795) -- 0:01:05
71500 -- (-1004.734) (-1005.273) (-1004.512) [-1007.445] * (-1004.655) (-1007.150) [-1003.901] (-1005.663) -- 0:01:04
72000 -- (-1005.421) (-1005.656) (-1007.713) [-1011.824] * (-1005.473) (-1009.086) (-1009.264) [-1004.686] -- 0:01:04
72500 -- [-1004.762] (-1003.814) (-1005.243) (-1009.087) * [-1005.208] (-1008.788) (-1007.250) (-1003.411) -- 0:01:03
73000 -- [-1004.429] (-1005.036) (-1005.484) (-1005.550) * (-1004.300) (-1005.114) (-1009.705) [-1003.995] -- 0:01:03
73500 -- (-1004.501) (-1003.632) [-1003.312] (-1005.016) * (-1006.561) (-1006.553) (-1006.303) [-1004.147] -- 0:01:03
74000 -- (-1004.897) (-1004.221) (-1005.173) [-1005.607] * (-1005.601) (-1004.729) [-1004.058] (-1009.537) -- 0:01:02
74500 -- (-1005.520) (-1004.144) [-1003.682] (-1005.436) * (-1005.816) [-1005.208] (-1003.514) (-1004.780) -- 0:01:02
75000 -- (-1004.596) [-1005.045] (-1005.734) (-1009.710) * (-1011.213) (-1005.536) (-1004.624) [-1003.369] -- 0:01:01
Average standard deviation of split frequencies: 0.027730
75500 -- (-1004.995) [-1004.543] (-1005.586) (-1006.879) * (-1010.785) [-1005.312] (-1004.348) (-1004.402) -- 0:01:01
76000 -- (-1005.969) [-1003.886] (-1004.828) (-1006.652) * (-1006.722) (-1004.992) (-1003.798) [-1004.459] -- 0:01:00
76500 -- [-1007.910] (-1005.520) (-1008.018) (-1007.646) * (-1005.144) (-1005.398) (-1003.889) [-1003.235] -- 0:01:00
77000 -- [-1007.345] (-1004.074) (-1004.129) (-1008.953) * (-1004.562) (-1008.964) (-1005.746) [-1003.403] -- 0:00:59
77500 -- [-1006.113] (-1006.649) (-1005.746) (-1004.951) * (-1006.450) (-1006.063) (-1004.015) [-1003.878] -- 0:00:59
78000 -- [-1005.871] (-1006.216) (-1005.118) (-1004.549) * (-1007.341) [-1006.191] (-1003.865) (-1006.721) -- 0:00:59
78500 -- [-1006.617] (-1007.706) (-1004.651) (-1004.703) * (-1003.676) (-1007.218) (-1003.842) [-1006.173] -- 0:00:58
79000 -- (-1006.267) (-1010.814) (-1003.646) [-1008.700] * (-1005.797) (-1006.678) (-1004.123) [-1005.752] -- 0:00:58
79500 -- (-1004.936) [-1009.412] (-1006.857) (-1006.245) * [-1004.122] (-1009.007) (-1007.145) (-1006.816) -- 0:00:57
80000 -- (-1003.917) (-1007.695) [-1007.653] (-1003.463) * (-1005.320) (-1008.173) (-1006.667) [-1005.237] -- 0:00:57
Average standard deviation of split frequencies: 0.027501
80500 -- (-1003.592) (-1005.893) (-1006.154) [-1005.129] * (-1010.278) (-1006.459) (-1008.931) [-1007.227] -- 0:00:57
81000 -- (-1008.551) (-1006.081) (-1006.616) [-1004.210] * (-1006.483) (-1008.663) [-1006.221] (-1006.967) -- 0:00:56
81500 -- (-1008.511) [-1005.638] (-1010.163) (-1007.792) * (-1006.490) [-1008.622] (-1006.807) (-1005.937) -- 0:00:56
82000 -- (-1005.864) (-1006.213) (-1006.316) [-1006.585] * (-1004.889) [-1005.863] (-1008.591) (-1006.872) -- 0:01:07
82500 -- [-1005.950] (-1004.774) (-1006.956) (-1005.582) * (-1013.213) (-1006.290) (-1006.783) [-1004.032] -- 0:01:06
83000 -- (-1005.760) (-1010.520) (-1006.445) [-1004.666] * (-1009.637) (-1004.155) [-1004.313] (-1005.246) -- 0:01:06
83500 -- (-1004.878) (-1004.740) [-1007.504] (-1004.795) * (-1006.882) (-1004.394) (-1006.811) [-1004.488] -- 0:01:05
84000 -- [-1004.444] (-1004.997) (-1006.721) (-1005.601) * [-1004.746] (-1004.134) (-1006.625) (-1004.009) -- 0:01:05
84500 -- (-1003.887) [-1004.878] (-1015.691) (-1005.873) * (-1004.523) [-1005.269] (-1004.347) (-1004.690) -- 0:01:05
85000 -- (-1007.335) (-1007.124) (-1006.590) [-1005.000] * (-1004.825) [-1005.411] (-1004.829) (-1005.793) -- 0:01:04
Average standard deviation of split frequencies: 0.027119
85500 -- (-1006.117) (-1005.586) [-1004.619] (-1004.826) * (-1004.659) (-1007.518) [-1004.701] (-1004.500) -- 0:01:04
86000 -- (-1007.176) [-1006.396] (-1006.120) (-1003.839) * [-1004.425] (-1004.822) (-1003.966) (-1005.101) -- 0:01:03
86500 -- (-1008.257) (-1005.349) (-1003.338) [-1003.406] * (-1004.225) (-1006.426) [-1007.169] (-1003.723) -- 0:01:03
87000 -- (-1008.758) [-1006.350] (-1004.136) (-1005.606) * (-1004.602) [-1003.677] (-1005.207) (-1003.803) -- 0:01:02
87500 -- (-1005.345) (-1005.597) [-1005.762] (-1006.773) * (-1005.028) [-1004.823] (-1004.247) (-1003.762) -- 0:01:02
88000 -- (-1004.901) (-1007.211) [-1004.894] (-1007.764) * (-1004.693) (-1005.146) (-1005.638) [-1004.244] -- 0:01:02
88500 -- (-1007.341) (-1011.306) (-1005.943) [-1004.980] * (-1004.277) (-1005.487) [-1004.691] (-1006.437) -- 0:01:01
89000 -- (-1003.969) (-1007.674) (-1004.300) [-1008.714] * [-1003.681] (-1006.289) (-1005.373) (-1005.642) -- 0:01:01
89500 -- (-1004.846) (-1007.546) (-1007.198) [-1004.804] * (-1005.923) [-1004.052] (-1013.528) (-1007.539) -- 0:01:01
90000 -- [-1005.920] (-1004.730) (-1004.337) (-1004.929) * (-1007.149) (-1006.478) [-1010.298] (-1005.704) -- 0:01:00
Average standard deviation of split frequencies: 0.025254
90500 -- (-1003.183) [-1003.710] (-1004.277) (-1005.133) * (-1006.035) [-1004.248] (-1005.950) (-1006.313) -- 0:01:00
91000 -- (-1003.244) [-1005.135] (-1005.246) (-1005.945) * (-1003.096) [-1004.174] (-1005.752) (-1004.485) -- 0:00:59
91500 -- (-1003.452) [-1005.310] (-1005.493) (-1005.904) * [-1004.223] (-1004.926) (-1008.878) (-1007.968) -- 0:00:59
92000 -- (-1006.391) [-1004.274] (-1004.442) (-1010.118) * [-1003.600] (-1006.795) (-1008.389) (-1005.089) -- 0:00:59
92500 -- [-1006.042] (-1004.787) (-1006.722) (-1008.028) * (-1006.069) (-1004.320) (-1006.560) [-1006.206] -- 0:00:58
93000 -- (-1005.135) (-1006.743) (-1007.344) [-1008.060] * [-1006.819] (-1004.138) (-1008.535) (-1005.602) -- 0:00:58
93500 -- [-1003.857] (-1005.865) (-1004.444) (-1006.394) * (-1008.110) (-1005.853) [-1006.217] (-1004.616) -- 0:00:58
94000 -- (-1013.781) (-1005.138) [-1006.822] (-1005.733) * (-1004.239) (-1004.165) [-1004.500] (-1004.042) -- 0:00:57
94500 -- (-1003.369) (-1005.004) [-1004.979] (-1004.662) * [-1004.044] (-1006.352) (-1004.949) (-1004.505) -- 0:00:57
95000 -- (-1007.499) [-1005.487] (-1007.454) (-1004.412) * (-1004.245) (-1004.916) [-1006.958] (-1004.091) -- 0:00:57
Average standard deviation of split frequencies: 0.026574
95500 -- (-1003.704) (-1005.601) [-1005.253] (-1004.696) * (-1004.243) [-1004.921] (-1007.898) (-1007.073) -- 0:00:56
96000 -- [-1004.976] (-1006.686) (-1003.969) (-1006.754) * (-1007.578) [-1005.576] (-1011.140) (-1011.392) -- 0:00:56
96500 -- (-1004.413) [-1004.536] (-1009.985) (-1005.307) * (-1004.757) [-1004.228] (-1004.168) (-1007.608) -- 0:00:56
97000 -- (-1005.520) (-1004.587) [-1006.202] (-1004.605) * (-1008.661) (-1004.033) [-1005.021] (-1006.661) -- 0:00:55
97500 -- (-1003.711) (-1005.191) (-1005.573) [-1004.753] * (-1008.197) [-1003.188] (-1005.340) (-1003.980) -- 0:00:55
98000 -- [-1004.682] (-1007.587) (-1005.626) (-1004.687) * (-1006.931) (-1003.363) [-1003.732] (-1003.814) -- 0:00:55
98500 -- (-1006.783) [-1005.072] (-1005.765) (-1004.141) * [-1004.949] (-1006.007) (-1003.504) (-1004.555) -- 0:01:04
99000 -- (-1008.259) [-1005.708] (-1005.561) (-1004.165) * (-1003.665) (-1003.360) [-1005.532] (-1004.322) -- 0:01:03
99500 -- (-1009.923) (-1004.718) (-1007.892) [-1005.611] * [-1008.391] (-1005.469) (-1006.537) (-1005.687) -- 0:01:03
100000 -- (-1007.469) (-1004.448) [-1005.683] (-1007.922) * [-1006.646] (-1009.534) (-1005.455) (-1008.661) -- 0:01:02
Average standard deviation of split frequencies: 0.027316
100500 -- [-1004.797] (-1004.544) (-1006.033) (-1004.577) * (-1006.609) [-1006.643] (-1007.242) (-1006.105) -- 0:01:02
101000 -- (-1004.251) (-1006.337) (-1008.814) [-1006.379] * (-1006.949) (-1004.138) (-1008.473) [-1006.191] -- 0:01:02
101500 -- [-1007.597] (-1008.847) (-1004.313) (-1004.980) * (-1004.237) [-1003.908] (-1007.536) (-1005.920) -- 0:01:01
102000 -- (-1007.908) (-1005.384) [-1004.001] (-1007.820) * (-1004.336) (-1005.492) [-1005.145] (-1007.618) -- 0:01:01
102500 -- [-1006.264] (-1006.654) (-1003.411) (-1008.388) * [-1004.547] (-1003.879) (-1009.904) (-1007.528) -- 0:01:01
103000 -- (-1005.783) (-1005.935) [-1003.361] (-1008.824) * (-1006.171) (-1009.231) (-1004.982) [-1006.431] -- 0:01:00
103500 -- (-1005.705) (-1004.694) [-1004.424] (-1005.913) * [-1004.046] (-1008.840) (-1008.869) (-1004.633) -- 0:01:00
104000 -- (-1005.404) [-1004.028] (-1005.425) (-1004.021) * [-1004.745] (-1005.400) (-1008.550) (-1004.535) -- 0:01:00
104500 -- [-1004.055] (-1004.231) (-1003.517) (-1006.506) * (-1010.666) (-1012.502) (-1006.118) [-1004.850] -- 0:00:59
105000 -- (-1008.149) (-1005.070) (-1004.394) [-1004.099] * (-1004.868) [-1005.884] (-1003.635) (-1005.485) -- 0:00:59
Average standard deviation of split frequencies: 0.031130
105500 -- [-1004.233] (-1003.921) (-1004.638) (-1003.936) * (-1004.481) [-1004.716] (-1006.280) (-1011.156) -- 0:00:59
106000 -- (-1006.041) (-1004.893) (-1004.839) [-1006.293] * (-1007.011) (-1004.664) [-1005.838] (-1008.765) -- 0:00:59
106500 -- (-1004.622) [-1008.700] (-1004.367) (-1004.221) * (-1011.033) (-1005.285) [-1008.859] (-1008.378) -- 0:00:58
107000 -- (-1005.108) (-1004.818) [-1004.612] (-1008.187) * (-1005.632) (-1007.448) (-1008.986) [-1005.779] -- 0:00:58
107500 -- (-1005.596) [-1006.727] (-1004.913) (-1007.324) * [-1005.289] (-1005.916) (-1008.444) (-1004.629) -- 0:00:58
108000 -- (-1007.280) (-1008.618) [-1004.893] (-1005.005) * [-1005.654] (-1006.436) (-1006.993) (-1004.791) -- 0:00:57
108500 -- (-1008.688) (-1006.868) (-1005.881) [-1003.761] * (-1005.469) (-1003.368) [-1006.237] (-1003.847) -- 0:00:57
109000 -- (-1005.962) (-1011.971) (-1006.573) [-1005.783] * (-1004.356) (-1003.677) [-1004.607] (-1005.495) -- 0:00:57
109500 -- (-1004.197) [-1008.785] (-1010.328) (-1005.315) * (-1005.704) (-1003.389) [-1004.618] (-1003.960) -- 0:00:56
110000 -- (-1004.985) [-1006.704] (-1015.221) (-1007.583) * (-1011.185) [-1004.449] (-1003.868) (-1005.286) -- 0:00:56
Average standard deviation of split frequencies: 0.033405
110500 -- (-1004.983) (-1004.345) (-1013.726) [-1007.722] * (-1006.653) (-1013.063) (-1003.872) [-1003.611] -- 0:00:56
111000 -- (-1004.247) (-1007.126) (-1012.860) [-1006.065] * (-1003.971) (-1004.672) [-1003.558] (-1005.559) -- 0:00:56
111500 -- (-1004.749) [-1006.603] (-1005.734) (-1004.121) * (-1005.810) [-1004.721] (-1006.569) (-1008.612) -- 0:00:55
112000 -- (-1006.242) [-1006.890] (-1008.182) (-1004.416) * (-1006.112) (-1005.446) (-1006.935) [-1004.656] -- 0:00:55
112500 -- (-1007.981) [-1007.347] (-1004.330) (-1006.633) * (-1011.348) (-1007.114) (-1004.319) [-1005.597] -- 0:00:55
113000 -- (-1009.194) (-1005.203) (-1007.339) [-1005.790] * (-1007.509) (-1005.383) [-1003.167] (-1004.457) -- 0:00:54
113500 -- (-1011.641) (-1009.326) [-1006.167] (-1004.765) * (-1007.287) (-1005.187) (-1004.164) [-1006.427] -- 0:01:02
114000 -- [-1008.291] (-1011.042) (-1005.388) (-1004.772) * (-1007.992) (-1003.982) [-1005.822] (-1006.819) -- 0:01:02
114500 -- [-1005.214] (-1004.949) (-1005.832) (-1004.843) * (-1008.062) (-1004.680) [-1005.730] (-1003.623) -- 0:01:01
115000 -- (-1005.500) (-1004.154) (-1003.431) [-1007.691] * (-1006.845) (-1007.611) [-1005.353] (-1005.268) -- 0:01:01
Average standard deviation of split frequencies: 0.034091
115500 -- [-1007.277] (-1004.981) (-1004.120) (-1009.010) * (-1006.010) (-1006.159) (-1004.043) [-1004.528] -- 0:01:01
116000 -- (-1007.277) (-1005.010) [-1011.202] (-1007.666) * (-1006.518) (-1009.130) [-1006.705] (-1005.582) -- 0:01:00
116500 -- (-1006.616) [-1004.223] (-1007.766) (-1005.764) * (-1004.908) (-1005.554) [-1006.071] (-1005.563) -- 0:01:00
117000 -- (-1007.307) (-1004.850) (-1010.100) [-1004.591] * (-1005.217) [-1003.780] (-1007.816) (-1003.685) -- 0:01:00
117500 -- (-1007.328) [-1004.710] (-1005.691) (-1006.392) * (-1007.579) (-1004.792) [-1010.651] (-1005.957) -- 0:01:00
118000 -- (-1004.720) [-1005.080] (-1003.463) (-1005.537) * (-1006.137) [-1004.149] (-1005.828) (-1004.187) -- 0:00:59
118500 -- (-1003.940) (-1007.490) (-1009.518) [-1005.185] * (-1006.624) [-1004.353] (-1005.793) (-1004.403) -- 0:00:59
119000 -- [-1004.400] (-1006.387) (-1005.979) (-1004.083) * [-1006.491] (-1008.525) (-1007.894) (-1005.282) -- 0:00:59
119500 -- (-1005.097) [-1004.378] (-1003.918) (-1005.585) * (-1004.736) (-1006.075) (-1007.381) [-1006.329] -- 0:00:58
120000 -- (-1004.778) (-1006.939) [-1005.344] (-1004.471) * (-1004.816) (-1004.191) (-1004.653) [-1005.048] -- 0:00:58
Average standard deviation of split frequencies: 0.035620
120500 -- [-1008.222] (-1004.895) (-1005.194) (-1004.318) * [-1004.372] (-1004.041) (-1004.760) (-1005.813) -- 0:00:58
121000 -- (-1005.938) (-1004.724) [-1006.144] (-1005.655) * (-1003.605) (-1004.025) (-1006.083) [-1004.947] -- 0:00:58
121500 -- (-1008.838) (-1008.364) [-1005.640] (-1005.795) * (-1005.571) [-1004.530] (-1005.961) (-1003.833) -- 0:00:57
122000 -- [-1006.628] (-1006.184) (-1007.563) (-1004.159) * (-1005.299) (-1007.984) (-1005.374) [-1007.465] -- 0:00:57
122500 -- [-1004.544] (-1008.224) (-1005.572) (-1004.130) * (-1006.056) [-1004.101] (-1004.010) (-1005.533) -- 0:00:57
123000 -- (-1009.168) (-1005.971) (-1003.723) [-1003.785] * (-1005.588) (-1004.101) [-1003.980] (-1011.659) -- 0:00:57
123500 -- [-1008.217] (-1004.002) (-1009.200) (-1005.326) * (-1004.852) [-1005.309] (-1006.424) (-1004.449) -- 0:00:56
124000 -- [-1008.300] (-1004.378) (-1005.829) (-1005.797) * (-1004.466) (-1003.625) (-1004.601) [-1005.945] -- 0:00:56
124500 -- [-1005.732] (-1006.197) (-1005.830) (-1007.352) * (-1006.755) (-1005.078) [-1006.825] (-1006.402) -- 0:00:56
125000 -- (-1007.629) (-1005.755) (-1007.948) [-1004.992] * (-1005.043) (-1004.574) (-1004.090) [-1006.950] -- 0:00:56
Average standard deviation of split frequencies: 0.034262
125500 -- (-1005.717) (-1005.873) [-1007.761] (-1004.058) * (-1004.511) (-1004.318) [-1009.212] (-1004.695) -- 0:00:55
126000 -- (-1007.122) [-1004.291] (-1005.977) (-1003.912) * (-1004.152) [-1004.398] (-1006.200) (-1005.197) -- 0:00:55
126500 -- (-1005.626) [-1005.946] (-1006.081) (-1003.543) * (-1005.809) (-1004.420) [-1003.920] (-1005.040) -- 0:00:55
127000 -- (-1004.970) (-1006.824) [-1005.563] (-1004.153) * [-1006.287] (-1006.258) (-1003.989) (-1005.180) -- 0:00:54
127500 -- (-1005.279) (-1005.974) (-1006.722) [-1007.127] * (-1008.698) [-1004.309] (-1004.587) (-1005.290) -- 0:01:01
128000 -- [-1005.893] (-1005.906) (-1006.901) (-1007.359) * (-1012.866) (-1003.658) [-1004.462] (-1004.751) -- 0:01:01
128500 -- (-1004.037) (-1003.417) (-1004.531) [-1005.504] * (-1006.654) [-1003.554] (-1010.933) (-1005.547) -- 0:01:01
129000 -- (-1007.666) (-1006.473) [-1005.771] (-1006.444) * (-1007.587) (-1003.551) (-1004.382) [-1003.809] -- 0:01:00
129500 -- (-1004.291) (-1003.628) [-1006.578] (-1004.733) * (-1008.305) (-1006.727) [-1009.465] (-1005.938) -- 0:01:00
130000 -- [-1005.295] (-1004.435) (-1004.446) (-1011.174) * [-1004.909] (-1007.346) (-1009.038) (-1006.394) -- 0:01:00
Average standard deviation of split frequencies: 0.033872
130500 -- (-1007.347) (-1003.953) (-1005.311) [-1005.835] * (-1005.573) [-1007.038] (-1009.248) (-1006.327) -- 0:00:59
131000 -- (-1004.969) [-1006.611] (-1005.793) (-1004.067) * (-1004.535) (-1007.741) (-1008.256) [-1006.746] -- 0:00:59
131500 -- (-1003.640) (-1010.399) [-1005.396] (-1004.038) * (-1004.283) (-1004.431) (-1008.009) [-1005.853] -- 0:00:59
132000 -- (-1004.652) [-1006.706] (-1005.194) (-1004.694) * (-1006.467) (-1004.676) [-1005.763] (-1004.148) -- 0:00:59
132500 -- [-1003.793] (-1004.727) (-1007.765) (-1006.006) * (-1006.088) [-1005.496] (-1011.454) (-1007.158) -- 0:00:58
133000 -- [-1005.762] (-1005.173) (-1008.701) (-1012.676) * (-1006.714) (-1004.101) [-1007.026] (-1003.132) -- 0:00:58
133500 -- (-1005.085) (-1009.336) [-1006.721] (-1004.972) * (-1006.836) [-1004.749] (-1004.362) (-1003.246) -- 0:00:58
134000 -- (-1006.751) (-1008.905) [-1004.681] (-1006.090) * (-1006.575) (-1006.148) (-1006.040) [-1004.478] -- 0:00:58
134500 -- [-1007.711] (-1003.862) (-1004.801) (-1007.307) * [-1003.809] (-1004.085) (-1009.003) (-1004.396) -- 0:00:57
135000 -- (-1004.335) (-1004.998) [-1003.291] (-1004.228) * (-1004.861) (-1004.380) [-1004.237] (-1005.426) -- 0:00:57
Average standard deviation of split frequencies: 0.031966
135500 -- [-1005.090] (-1004.205) (-1006.274) (-1007.751) * (-1004.892) [-1006.811] (-1004.905) (-1003.499) -- 0:00:57
136000 -- (-1003.930) [-1006.247] (-1005.014) (-1006.003) * (-1004.359) [-1005.017] (-1007.145) (-1003.830) -- 0:00:57
136500 -- (-1005.013) (-1008.686) [-1003.266] (-1006.632) * [-1005.426] (-1007.957) (-1004.269) (-1005.468) -- 0:00:56
137000 -- (-1006.271) (-1006.167) [-1004.208] (-1005.462) * [-1003.431] (-1007.587) (-1004.269) (-1006.406) -- 0:00:56
137500 -- (-1010.319) (-1003.793) [-1004.580] (-1006.173) * (-1003.400) (-1005.760) [-1005.299] (-1003.864) -- 0:00:56
138000 -- [-1005.691] (-1003.418) (-1005.548) (-1006.238) * (-1003.288) (-1003.725) (-1005.309) [-1007.038] -- 0:00:56
138500 -- (-1005.583) [-1003.426] (-1004.144) (-1005.810) * (-1005.044) [-1005.568] (-1006.962) (-1007.015) -- 0:00:55
139000 -- (-1009.292) (-1004.177) (-1003.651) [-1004.311] * (-1005.341) (-1007.026) (-1012.321) [-1005.772] -- 0:00:55
139500 -- (-1007.760) (-1006.961) [-1003.257] (-1003.988) * (-1007.879) [-1004.302] (-1006.244) (-1004.572) -- 0:00:55
140000 -- [-1004.357] (-1007.102) (-1008.264) (-1005.528) * (-1006.102) [-1005.047] (-1004.301) (-1006.147) -- 0:00:55
Average standard deviation of split frequencies: 0.030358
140500 -- [-1004.005] (-1007.766) (-1005.887) (-1004.865) * [-1007.070] (-1006.224) (-1005.654) (-1006.292) -- 0:00:55
141000 -- (-1007.231) [-1008.141] (-1005.653) (-1005.872) * (-1004.481) (-1007.621) (-1004.814) [-1008.535] -- 0:00:54
141500 -- (-1006.598) [-1004.235] (-1005.708) (-1008.549) * (-1004.556) (-1010.472) [-1008.196] (-1008.095) -- 0:00:54
142000 -- [-1006.409] (-1005.530) (-1004.663) (-1004.210) * (-1003.668) (-1005.652) [-1005.461] (-1005.639) -- 0:01:00
142500 -- (-1006.974) (-1005.875) [-1003.985] (-1005.409) * (-1007.574) (-1005.929) [-1003.755] (-1007.344) -- 0:01:00
143000 -- (-1004.413) (-1007.358) (-1009.238) [-1004.559] * (-1004.523) (-1006.532) (-1004.347) [-1006.246] -- 0:00:59
143500 -- [-1004.248] (-1012.163) (-1009.680) (-1004.222) * (-1003.420) (-1006.645) [-1004.730] (-1008.037) -- 0:00:59
144000 -- (-1004.070) (-1006.085) [-1004.125] (-1003.914) * (-1004.338) [-1005.327] (-1007.484) (-1005.319) -- 0:00:59
144500 -- (-1003.517) (-1006.714) (-1005.633) [-1009.370] * (-1004.281) [-1003.962] (-1004.565) (-1005.757) -- 0:00:59
145000 -- (-1006.661) [-1008.549] (-1004.502) (-1006.248) * (-1005.768) (-1003.661) [-1003.631] (-1004.861) -- 0:00:58
Average standard deviation of split frequencies: 0.028040
145500 -- [-1006.509] (-1009.598) (-1006.239) (-1006.928) * (-1004.751) (-1004.778) [-1005.513] (-1005.213) -- 0:00:58
146000 -- (-1004.411) (-1005.712) (-1005.264) [-1005.747] * (-1005.352) (-1004.468) [-1005.110] (-1006.520) -- 0:00:58
146500 -- (-1003.095) (-1005.586) [-1005.818] (-1007.383) * (-1005.059) [-1003.967] (-1006.878) (-1005.909) -- 0:00:58
147000 -- (-1003.579) [-1005.822] (-1005.802) (-1005.517) * (-1009.507) (-1003.706) (-1003.835) [-1005.616] -- 0:00:58
147500 -- (-1004.133) (-1006.115) (-1004.873) [-1005.186] * [-1007.419] (-1003.733) (-1004.673) (-1005.447) -- 0:00:57
148000 -- (-1003.519) [-1004.470] (-1008.559) (-1005.178) * (-1006.273) (-1006.714) (-1005.398) [-1004.199] -- 0:00:57
148500 -- [-1003.857] (-1006.587) (-1006.565) (-1005.769) * (-1008.236) (-1005.622) [-1005.847] (-1004.903) -- 0:00:57
149000 -- (-1003.949) (-1004.305) [-1006.419] (-1004.776) * (-1007.331) (-1008.201) [-1005.318] (-1006.778) -- 0:00:57
149500 -- (-1003.930) [-1004.675] (-1006.907) (-1007.126) * (-1006.213) (-1008.501) (-1005.359) [-1006.364] -- 0:00:56
150000 -- (-1006.582) [-1006.108] (-1006.311) (-1004.301) * (-1006.564) (-1003.915) [-1007.244] (-1005.510) -- 0:00:56
Average standard deviation of split frequencies: 0.027607
150500 -- (-1013.617) (-1004.786) [-1003.465] (-1007.241) * (-1005.465) (-1005.065) (-1008.048) [-1004.919] -- 0:00:56
151000 -- (-1012.110) (-1004.286) (-1005.629) [-1005.279] * (-1006.123) (-1006.237) [-1005.698] (-1004.986) -- 0:00:56
151500 -- (-1004.488) (-1004.681) [-1004.642] (-1006.400) * (-1004.788) (-1008.230) (-1005.229) [-1011.952] -- 0:00:56
152000 -- [-1005.522] (-1004.299) (-1007.352) (-1005.652) * (-1004.685) (-1005.418) [-1004.352] (-1004.570) -- 0:00:55
152500 -- (-1005.094) (-1010.860) (-1004.735) [-1006.658] * (-1004.535) (-1004.835) (-1003.921) [-1004.708] -- 0:00:55
153000 -- (-1008.590) (-1007.494) (-1006.561) [-1004.664] * (-1005.125) [-1006.853] (-1003.672) (-1006.967) -- 0:00:55
153500 -- [-1004.787] (-1007.177) (-1003.765) (-1006.448) * (-1007.779) (-1006.047) [-1004.923] (-1006.092) -- 0:00:55
154000 -- (-1005.332) (-1005.640) (-1006.220) [-1004.771] * (-1004.896) [-1006.253] (-1005.559) (-1007.837) -- 0:00:54
154500 -- (-1004.839) [-1006.397] (-1007.163) (-1004.819) * (-1005.083) [-1004.231] (-1005.851) (-1008.878) -- 0:00:54
155000 -- (-1006.028) [-1008.518] (-1005.609) (-1007.529) * (-1005.831) [-1004.299] (-1007.744) (-1008.249) -- 0:00:54
Average standard deviation of split frequencies: 0.026485
155500 -- (-1006.391) (-1004.546) (-1006.361) [-1006.110] * (-1006.354) [-1004.287] (-1009.527) (-1005.278) -- 0:00:54
156000 -- (-1005.609) (-1005.861) (-1005.138) [-1004.108] * (-1004.267) (-1005.262) [-1004.828] (-1007.840) -- 0:00:54
156500 -- (-1004.033) (-1005.758) [-1003.631] (-1005.411) * [-1004.343] (-1004.876) (-1004.409) (-1009.228) -- 0:00:53
157000 -- [-1004.506] (-1006.361) (-1005.594) (-1004.331) * [-1005.829] (-1006.989) (-1003.957) (-1006.194) -- 0:00:53
157500 -- (-1006.809) (-1006.096) (-1005.079) [-1005.108] * (-1006.338) (-1007.571) (-1003.732) [-1008.653] -- 0:00:58
158000 -- (-1004.193) [-1005.180] (-1007.221) (-1006.928) * [-1004.841] (-1003.805) (-1005.980) (-1009.411) -- 0:00:58
158500 -- (-1006.536) (-1006.362) (-1003.686) [-1005.577] * (-1005.900) (-1010.493) [-1005.303] (-1006.524) -- 0:00:58
159000 -- (-1011.339) (-1008.294) [-1004.444] (-1009.126) * (-1004.869) (-1004.123) (-1006.797) [-1010.368] -- 0:00:58
159500 -- (-1007.436) (-1006.244) [-1003.778] (-1005.525) * (-1007.596) (-1006.840) (-1005.048) [-1007.886] -- 0:00:57
160000 -- (-1004.635) (-1005.840) [-1004.894] (-1008.084) * (-1004.681) (-1003.232) (-1005.346) [-1003.818] -- 0:00:57
Average standard deviation of split frequencies: 0.025544
160500 -- [-1006.068] (-1005.033) (-1009.050) (-1005.772) * (-1004.464) (-1006.196) (-1003.530) [-1003.435] -- 0:00:57
161000 -- (-1004.249) (-1005.848) (-1008.447) [-1004.097] * (-1006.178) (-1003.528) (-1005.102) [-1003.452] -- 0:00:57
161500 -- [-1004.201] (-1005.887) (-1011.875) (-1004.492) * (-1006.899) [-1005.882] (-1009.498) (-1007.914) -- 0:00:57
162000 -- (-1006.313) [-1007.184] (-1005.294) (-1006.783) * (-1009.256) [-1004.930] (-1006.324) (-1004.686) -- 0:00:56
162500 -- (-1003.936) (-1009.449) [-1005.956] (-1005.356) * [-1006.836] (-1006.265) (-1007.624) (-1011.233) -- 0:00:56
163000 -- (-1007.110) [-1007.713] (-1006.481) (-1006.268) * (-1006.573) (-1006.571) (-1011.965) [-1008.883] -- 0:00:56
163500 -- [-1009.300] (-1003.159) (-1006.153) (-1005.185) * (-1010.717) (-1007.295) (-1006.418) [-1004.847] -- 0:00:56
164000 -- (-1013.657) (-1003.782) [-1003.634] (-1004.830) * (-1009.519) (-1009.295) (-1007.268) [-1006.558] -- 0:00:56
164500 -- (-1007.417) (-1003.781) (-1005.573) [-1003.699] * (-1004.874) [-1004.675] (-1007.228) (-1005.701) -- 0:00:55
165000 -- (-1006.091) (-1004.272) (-1005.907) [-1003.822] * (-1004.821) (-1004.419) [-1004.751] (-1007.281) -- 0:00:55
Average standard deviation of split frequencies: 0.024063
165500 -- [-1005.772] (-1005.121) (-1007.227) (-1004.351) * (-1006.176) [-1005.441] (-1004.993) (-1007.407) -- 0:00:55
166000 -- (-1005.206) (-1007.374) [-1008.479] (-1007.316) * (-1004.114) (-1004.562) (-1005.198) [-1005.962] -- 0:00:55
166500 -- (-1005.476) [-1003.505] (-1007.323) (-1005.467) * (-1004.041) [-1004.480] (-1005.222) (-1005.549) -- 0:00:55
167000 -- [-1005.207] (-1005.451) (-1003.478) (-1005.874) * (-1006.977) (-1007.106) [-1004.769] (-1008.380) -- 0:00:54
167500 -- (-1004.192) (-1006.570) (-1006.537) [-1004.787] * (-1005.510) (-1008.222) [-1005.091] (-1007.697) -- 0:00:54
168000 -- (-1006.898) (-1006.080) [-1005.742] (-1006.434) * [-1004.455] (-1004.642) (-1006.059) (-1007.312) -- 0:00:54
168500 -- (-1008.834) [-1005.372] (-1007.521) (-1008.056) * (-1004.494) [-1004.557] (-1005.909) (-1007.368) -- 0:00:54
169000 -- [-1003.812] (-1006.708) (-1007.243) (-1006.328) * (-1008.320) [-1006.446] (-1006.006) (-1007.107) -- 0:00:54
169500 -- (-1004.557) (-1005.450) [-1004.355] (-1005.142) * (-1007.532) (-1004.571) (-1003.984) [-1005.826] -- 0:00:53
170000 -- [-1004.451] (-1004.159) (-1004.854) (-1006.686) * (-1010.951) (-1003.613) (-1005.101) [-1004.151] -- 0:00:53
Average standard deviation of split frequencies: 0.023260
170500 -- (-1004.797) (-1003.614) [-1004.991] (-1005.856) * (-1010.007) (-1009.651) [-1003.999] (-1005.598) -- 0:00:53
171000 -- (-1004.750) (-1004.762) (-1005.137) [-1006.577] * (-1007.105) [-1004.955] (-1004.038) (-1006.285) -- 0:00:53
171500 -- (-1005.725) (-1005.783) (-1006.209) [-1004.540] * (-1007.294) (-1008.271) (-1005.273) [-1003.522] -- 0:00:53
172000 -- (-1006.813) (-1003.944) (-1006.973) [-1004.348] * (-1006.247) (-1006.355) (-1007.279) [-1005.149] -- 0:00:57
172500 -- [-1004.699] (-1003.651) (-1006.026) (-1006.458) * [-1005.935] (-1004.480) (-1009.021) (-1004.725) -- 0:00:57
173000 -- [-1004.212] (-1005.015) (-1006.118) (-1006.308) * (-1008.456) (-1005.585) [-1008.422] (-1006.968) -- 0:00:57
173500 -- (-1005.913) (-1005.520) [-1006.440] (-1005.839) * (-1008.436) [-1004.651] (-1007.359) (-1005.402) -- 0:00:57
174000 -- (-1006.885) (-1005.769) (-1006.076) [-1005.590] * (-1007.952) [-1007.570] (-1008.730) (-1004.502) -- 0:00:56
174500 -- (-1010.310) [-1006.403] (-1006.873) (-1004.115) * (-1006.966) (-1005.201) [-1003.273] (-1010.183) -- 0:00:56
175000 -- (-1007.182) [-1003.666] (-1005.326) (-1005.031) * [-1004.459] (-1006.697) (-1003.315) (-1005.473) -- 0:00:56
Average standard deviation of split frequencies: 0.020088
175500 -- [-1005.843] (-1004.647) (-1003.550) (-1003.362) * [-1005.480] (-1007.106) (-1006.735) (-1005.707) -- 0:00:56
176000 -- [-1005.297] (-1005.609) (-1006.966) (-1003.310) * (-1005.447) [-1009.002] (-1006.924) (-1004.487) -- 0:00:56
176500 -- [-1004.307] (-1003.753) (-1008.838) (-1003.348) * (-1010.471) (-1006.808) (-1005.041) [-1007.251] -- 0:00:55
177000 -- (-1005.300) (-1006.294) (-1008.981) [-1003.443] * (-1006.872) (-1007.312) [-1005.362] (-1006.493) -- 0:00:55
177500 -- (-1005.052) [-1005.302] (-1005.200) (-1003.773) * (-1008.089) (-1005.315) (-1004.779) [-1005.001] -- 0:00:55
178000 -- [-1006.432] (-1005.240) (-1004.709) (-1004.518) * [-1005.263] (-1005.816) (-1008.389) (-1007.661) -- 0:00:55
178500 -- (-1006.494) [-1005.628] (-1003.233) (-1003.821) * (-1004.720) (-1005.149) [-1006.140] (-1006.323) -- 0:00:55
179000 -- (-1007.567) (-1007.311) (-1003.632) [-1004.830] * [-1003.992] (-1004.562) (-1004.237) (-1003.602) -- 0:00:55
179500 -- (-1004.504) [-1003.983] (-1003.453) (-1003.659) * (-1004.490) [-1005.833] (-1006.305) (-1003.646) -- 0:00:54
180000 -- [-1004.309] (-1005.195) (-1005.341) (-1004.913) * (-1004.498) (-1004.084) [-1011.362] (-1006.723) -- 0:00:54
Average standard deviation of split frequencies: 0.020567
180500 -- (-1005.089) (-1004.801) [-1003.511] (-1004.802) * (-1004.560) (-1010.246) [-1005.388] (-1006.723) -- 0:00:54
181000 -- (-1004.572) (-1004.751) [-1004.731] (-1004.588) * (-1005.513) (-1006.714) [-1004.999] (-1007.215) -- 0:00:54
181500 -- (-1004.987) [-1004.670] (-1005.465) (-1007.217) * (-1004.628) [-1004.190] (-1004.214) (-1007.296) -- 0:00:54
182000 -- [-1003.847] (-1006.048) (-1005.625) (-1004.188) * (-1008.595) [-1003.570] (-1010.940) (-1005.049) -- 0:00:53
182500 -- [-1004.075] (-1004.195) (-1005.054) (-1004.435) * (-1006.681) (-1009.011) [-1005.929] (-1006.457) -- 0:00:53
183000 -- (-1003.955) [-1006.795] (-1003.699) (-1004.547) * [-1005.951] (-1007.218) (-1004.813) (-1005.818) -- 0:00:53
183500 -- (-1004.936) (-1006.311) (-1004.429) [-1004.083] * (-1006.063) (-1003.895) [-1004.893] (-1004.967) -- 0:00:53
184000 -- (-1005.406) [-1003.606] (-1006.975) (-1005.745) * (-1004.715) (-1004.480) (-1006.408) [-1004.648] -- 0:00:53
184500 -- (-1009.724) (-1004.173) (-1004.414) [-1005.562] * (-1010.231) (-1009.168) [-1005.372] (-1004.697) -- 0:00:53
185000 -- (-1005.855) (-1007.881) [-1003.364] (-1006.829) * (-1009.662) [-1004.665] (-1005.584) (-1004.781) -- 0:00:52
Average standard deviation of split frequencies: 0.019994
185500 -- (-1006.293) (-1005.524) [-1003.783] (-1006.613) * (-1005.020) (-1006.892) [-1005.406] (-1005.647) -- 0:00:52
186000 -- (-1006.898) (-1006.352) [-1003.783] (-1003.984) * [-1005.969] (-1007.950) (-1004.297) (-1004.961) -- 0:00:52
186500 -- (-1004.290) (-1005.428) (-1005.642) [-1004.664] * (-1007.680) (-1005.159) (-1004.561) [-1004.555] -- 0:00:52
187000 -- (-1005.661) (-1005.242) (-1007.320) [-1008.572] * (-1003.323) [-1004.137] (-1004.043) (-1005.496) -- 0:00:52
187500 -- (-1012.098) (-1005.547) (-1007.836) [-1004.938] * [-1006.257] (-1004.248) (-1005.036) (-1004.169) -- 0:00:56
188000 -- (-1010.802) [-1004.717] (-1008.002) (-1005.277) * (-1006.423) [-1003.434] (-1005.307) (-1005.487) -- 0:00:56
188500 -- [-1005.904] (-1006.179) (-1005.107) (-1004.745) * (-1005.870) (-1005.602) (-1005.052) [-1003.937] -- 0:00:55
189000 -- (-1005.074) (-1007.248) (-1009.247) [-1005.923] * (-1004.955) (-1007.076) (-1004.251) [-1004.783] -- 0:00:55
189500 -- [-1008.019] (-1004.071) (-1005.005) (-1005.607) * (-1008.084) [-1003.690] (-1003.600) (-1003.996) -- 0:00:55
190000 -- [-1004.194] (-1006.822) (-1004.358) (-1006.153) * [-1006.062] (-1006.421) (-1003.636) (-1004.597) -- 0:00:55
Average standard deviation of split frequencies: 0.018543
190500 -- [-1006.682] (-1009.344) (-1003.629) (-1005.564) * (-1007.010) (-1006.814) (-1003.926) [-1004.364] -- 0:00:55
191000 -- (-1004.401) (-1005.511) [-1004.884] (-1005.906) * (-1007.715) (-1005.864) (-1005.791) [-1003.719] -- 0:00:55
191500 -- (-1004.083) [-1003.618] (-1003.897) (-1006.064) * [-1006.204] (-1004.290) (-1005.632) (-1004.494) -- 0:00:54
192000 -- (-1005.702) (-1004.164) (-1008.114) [-1004.186] * [-1007.330] (-1004.094) (-1004.384) (-1004.494) -- 0:00:54
192500 -- (-1005.496) (-1003.695) (-1007.480) [-1005.434] * (-1005.077) (-1004.786) [-1003.369] (-1007.116) -- 0:00:54
193000 -- [-1004.098] (-1004.025) (-1005.025) (-1005.686) * (-1005.669) [-1004.721] (-1004.301) (-1005.475) -- 0:00:54
193500 -- (-1004.075) (-1003.735) (-1004.107) [-1007.276] * [-1004.401] (-1004.649) (-1004.046) (-1008.202) -- 0:00:54
194000 -- (-1004.672) (-1007.626) [-1007.380] (-1006.096) * (-1005.009) (-1004.588) (-1005.274) [-1006.656] -- 0:00:54
194500 -- (-1004.682) (-1006.496) [-1005.028] (-1006.424) * (-1005.378) (-1006.486) [-1004.600] (-1003.378) -- 0:00:53
195000 -- (-1005.337) (-1006.300) [-1003.779] (-1006.380) * [-1004.202] (-1006.503) (-1003.976) (-1005.181) -- 0:00:53
Average standard deviation of split frequencies: 0.017905
195500 -- (-1007.151) (-1005.515) [-1005.609] (-1004.596) * (-1005.653) [-1005.523] (-1008.876) (-1005.415) -- 0:00:53
196000 -- (-1003.306) (-1007.690) (-1007.952) [-1004.615] * (-1007.226) [-1004.051] (-1007.594) (-1005.396) -- 0:00:53
196500 -- (-1003.255) (-1008.118) (-1004.100) [-1005.723] * (-1005.960) (-1004.280) (-1009.142) [-1004.678] -- 0:00:53
197000 -- (-1005.480) (-1007.016) (-1004.045) [-1006.261] * (-1004.785) [-1004.306] (-1005.615) (-1007.307) -- 0:00:52
197500 -- (-1004.583) (-1006.381) [-1004.778] (-1009.175) * [-1005.097] (-1003.721) (-1005.609) (-1007.858) -- 0:00:52
198000 -- (-1004.943) (-1005.739) [-1004.419] (-1004.883) * (-1005.160) (-1003.713) [-1004.116] (-1008.167) -- 0:00:52
198500 -- (-1008.724) [-1008.429] (-1004.451) (-1004.284) * (-1004.919) (-1006.491) [-1003.744] (-1008.046) -- 0:00:52
199000 -- [-1004.741] (-1006.863) (-1003.914) (-1004.413) * (-1003.647) (-1008.231) [-1004.750] (-1007.647) -- 0:00:52
199500 -- (-1007.668) (-1005.626) (-1004.467) [-1005.033] * [-1004.105] (-1010.090) (-1005.062) (-1007.350) -- 0:00:52
200000 -- [-1007.636] (-1005.755) (-1006.330) (-1005.958) * (-1003.755) [-1004.240] (-1006.193) (-1007.232) -- 0:00:51
Average standard deviation of split frequencies: 0.016314
200500 -- [-1006.636] (-1012.921) (-1005.545) (-1005.940) * (-1003.359) (-1006.948) (-1005.081) [-1004.764] -- 0:00:51
201000 -- (-1006.085) (-1006.381) [-1005.169] (-1006.448) * (-1003.319) (-1004.130) (-1005.888) [-1004.397] -- 0:00:51
201500 -- (-1006.053) [-1006.278] (-1004.651) (-1005.147) * (-1004.180) (-1005.129) [-1004.923] (-1005.413) -- 0:00:51
202000 -- (-1004.367) [-1005.544] (-1004.416) (-1005.391) * (-1007.605) (-1005.384) (-1007.196) [-1004.445] -- 0:00:51
202500 -- (-1006.713) (-1003.568) (-1003.868) [-1007.475] * (-1007.392) [-1004.507] (-1006.682) (-1005.058) -- 0:00:51
203000 -- (-1005.610) [-1006.492] (-1010.073) (-1007.679) * [-1005.202] (-1005.445) (-1007.497) (-1004.709) -- 0:00:51
203500 -- [-1005.743] (-1012.657) (-1006.098) (-1007.791) * (-1004.134) [-1004.303] (-1008.171) (-1005.036) -- 0:00:54
204000 -- (-1005.683) [-1005.061] (-1008.374) (-1005.954) * [-1005.318] (-1004.903) (-1006.336) (-1004.891) -- 0:00:54
204500 -- (-1004.720) [-1006.371] (-1005.396) (-1005.205) * (-1005.487) (-1004.903) [-1006.450] (-1012.891) -- 0:00:54
205000 -- [-1005.708] (-1003.966) (-1005.128) (-1005.382) * (-1004.255) [-1003.747] (-1007.921) (-1010.334) -- 0:00:54
Average standard deviation of split frequencies: 0.016781
205500 -- (-1003.874) [-1004.361] (-1005.677) (-1005.450) * [-1005.805] (-1004.654) (-1007.103) (-1008.149) -- 0:00:54
206000 -- [-1004.041] (-1006.891) (-1005.563) (-1005.081) * (-1005.545) [-1007.668] (-1005.014) (-1005.417) -- 0:00:53
206500 -- (-1007.750) [-1008.085] (-1005.004) (-1005.395) * (-1003.927) [-1006.764] (-1004.710) (-1004.746) -- 0:00:53
207000 -- [-1004.919] (-1006.945) (-1012.640) (-1003.318) * (-1005.005) (-1008.731) [-1004.858] (-1005.190) -- 0:00:53
207500 -- (-1005.011) (-1008.577) [-1004.867] (-1006.896) * (-1005.617) (-1014.891) (-1003.345) [-1006.166] -- 0:00:53
208000 -- (-1005.593) (-1005.621) (-1007.977) [-1005.005] * [-1005.022] (-1006.823) (-1003.160) (-1007.684) -- 0:00:53
208500 -- (-1003.763) (-1007.805) (-1006.616) [-1004.040] * (-1004.398) (-1006.410) [-1003.431] (-1005.374) -- 0:00:53
209000 -- (-1004.103) [-1003.703] (-1004.099) (-1012.228) * [-1004.600] (-1003.871) (-1005.237) (-1012.866) -- 0:00:52
209500 -- [-1005.102] (-1005.323) (-1006.788) (-1005.522) * [-1004.540] (-1003.866) (-1006.927) (-1010.206) -- 0:00:52
210000 -- (-1005.135) (-1004.037) (-1005.049) [-1005.074] * [-1004.959] (-1006.977) (-1006.273) (-1007.771) -- 0:00:52
Average standard deviation of split frequencies: 0.016534
210500 -- [-1006.639] (-1012.320) (-1005.876) (-1006.376) * (-1005.827) (-1005.489) (-1007.780) [-1004.484] -- 0:00:52
211000 -- (-1008.692) (-1009.228) (-1005.583) [-1005.539] * (-1005.056) (-1008.264) [-1006.132] (-1006.330) -- 0:00:52
211500 -- (-1006.091) (-1007.661) [-1007.609] (-1005.399) * [-1005.707] (-1004.130) (-1005.901) (-1007.676) -- 0:00:52
212000 -- (-1003.697) (-1004.533) [-1008.203] (-1005.923) * (-1007.888) (-1003.420) [-1004.778] (-1006.338) -- 0:00:52
212500 -- [-1005.062] (-1003.178) (-1006.286) (-1004.406) * [-1005.890] (-1005.146) (-1006.877) (-1008.669) -- 0:00:51
213000 -- (-1003.911) (-1005.391) [-1007.255] (-1006.269) * (-1004.129) [-1005.859] (-1007.874) (-1005.368) -- 0:00:51
213500 -- (-1004.015) (-1004.639) [-1005.220] (-1006.142) * (-1003.604) [-1004.460] (-1005.590) (-1005.225) -- 0:00:51
214000 -- (-1011.357) (-1005.107) [-1009.308] (-1012.788) * (-1003.430) [-1007.683] (-1003.167) (-1005.760) -- 0:00:51
214500 -- [-1004.909] (-1005.941) (-1010.589) (-1006.194) * (-1005.606) [-1008.752] (-1004.617) (-1003.709) -- 0:00:51
215000 -- (-1005.426) [-1007.448] (-1008.258) (-1006.886) * (-1007.832) (-1009.392) (-1003.888) [-1007.185] -- 0:00:51
Average standard deviation of split frequencies: 0.014550
215500 -- (-1009.485) (-1007.322) (-1010.565) [-1005.112] * (-1005.135) [-1007.246] (-1006.954) (-1003.858) -- 0:00:50
216000 -- (-1006.536) (-1005.701) [-1005.120] (-1004.047) * (-1005.901) (-1006.495) [-1004.960] (-1006.135) -- 0:00:50
216500 -- [-1006.205] (-1004.310) (-1004.216) (-1004.951) * (-1003.170) (-1005.025) [-1003.948] (-1007.562) -- 0:00:50
217000 -- (-1006.848) [-1004.006] (-1008.243) (-1006.901) * (-1004.895) [-1003.331] (-1004.347) (-1003.740) -- 0:00:50
217500 -- (-1008.783) [-1004.007] (-1005.188) (-1009.388) * (-1006.032) [-1004.043] (-1004.681) (-1003.886) -- 0:00:50
218000 -- (-1006.520) [-1004.005] (-1005.121) (-1008.223) * (-1006.315) (-1005.242) [-1004.716] (-1006.528) -- 0:00:50
218500 -- (-1007.091) (-1006.609) [-1006.832] (-1005.944) * [-1003.941] (-1006.236) (-1003.888) (-1004.563) -- 0:00:50
219000 -- [-1003.412] (-1005.257) (-1007.045) (-1006.869) * [-1003.226] (-1005.179) (-1006.397) (-1004.551) -- 0:00:49
219500 -- (-1003.533) (-1006.189) (-1004.677) [-1007.484] * (-1003.890) (-1003.839) (-1006.635) [-1004.190] -- 0:00:53
220000 -- (-1004.081) (-1004.368) (-1004.524) [-1004.375] * [-1005.606] (-1008.328) (-1007.311) (-1004.075) -- 0:00:53
Average standard deviation of split frequencies: 0.015310
220500 -- (-1005.929) (-1005.802) (-1006.288) [-1004.562] * [-1007.030] (-1007.611) (-1005.494) (-1004.892) -- 0:00:53
221000 -- (-1005.470) (-1007.226) [-1006.288] (-1005.591) * (-1003.826) (-1007.985) (-1004.954) [-1004.432] -- 0:00:52
221500 -- (-1007.453) (-1007.250) [-1005.223] (-1004.251) * [-1005.693] (-1009.207) (-1005.048) (-1004.614) -- 0:00:52
222000 -- (-1007.580) [-1005.874] (-1004.402) (-1005.955) * [-1003.559] (-1008.616) (-1006.156) (-1005.074) -- 0:00:52
222500 -- (-1004.173) [-1006.552] (-1005.362) (-1005.893) * (-1004.776) [-1005.813] (-1005.804) (-1007.221) -- 0:00:52
223000 -- (-1006.472) (-1004.141) (-1009.391) [-1005.372] * (-1004.534) (-1004.463) [-1006.146] (-1005.400) -- 0:00:52
223500 -- (-1005.112) [-1004.294] (-1005.001) (-1005.403) * (-1004.266) (-1005.321) (-1004.631) [-1004.594] -- 0:00:52
224000 -- [-1005.505] (-1003.756) (-1006.245) (-1006.280) * (-1007.730) (-1008.023) (-1005.916) [-1005.963] -- 0:00:51
224500 -- (-1005.029) [-1005.156] (-1003.527) (-1005.835) * (-1008.859) (-1004.755) (-1006.017) [-1006.426] -- 0:00:51
225000 -- (-1003.803) (-1004.997) [-1004.082] (-1005.462) * (-1006.135) (-1005.112) [-1004.237] (-1008.168) -- 0:00:51
Average standard deviation of split frequencies: 0.014949
225500 -- (-1004.279) (-1004.963) [-1004.128] (-1004.795) * (-1006.558) (-1005.843) (-1005.686) [-1007.054] -- 0:00:51
226000 -- (-1005.862) (-1004.953) (-1004.619) [-1006.054] * (-1004.296) (-1005.816) [-1004.153] (-1010.264) -- 0:00:51
226500 -- (-1005.281) (-1006.728) (-1007.037) [-1005.672] * (-1005.027) (-1010.781) (-1004.134) [-1003.600] -- 0:00:51
227000 -- (-1005.850) [-1005.440] (-1004.533) (-1006.598) * [-1006.233] (-1010.352) (-1006.124) (-1003.763) -- 0:00:51
227500 -- (-1005.794) [-1005.506] (-1003.549) (-1006.388) * (-1004.124) (-1007.300) [-1007.484] (-1005.566) -- 0:00:50
228000 -- (-1005.391) [-1005.532] (-1004.264) (-1011.292) * (-1005.159) (-1005.317) (-1004.303) [-1005.168] -- 0:00:50
228500 -- [-1003.310] (-1007.805) (-1003.826) (-1004.664) * (-1004.879) (-1005.498) (-1006.411) [-1004.697] -- 0:00:50
229000 -- [-1005.175] (-1006.274) (-1008.317) (-1007.202) * (-1005.369) (-1007.538) [-1006.437] (-1008.353) -- 0:00:50
229500 -- (-1004.423) [-1005.904] (-1005.176) (-1006.743) * (-1004.753) [-1003.515] (-1007.164) (-1011.390) -- 0:00:50
230000 -- [-1003.797] (-1006.726) (-1004.299) (-1005.344) * [-1004.756] (-1004.198) (-1007.167) (-1009.525) -- 0:00:50
Average standard deviation of split frequencies: 0.014192
230500 -- [-1004.046] (-1007.791) (-1006.736) (-1005.121) * (-1006.490) (-1004.696) [-1005.809] (-1007.010) -- 0:00:50
231000 -- (-1004.489) [-1008.251] (-1007.954) (-1004.428) * (-1004.979) (-1005.467) [-1006.242] (-1004.489) -- 0:00:49
231500 -- (-1007.258) (-1008.292) [-1008.049] (-1004.222) * [-1004.281] (-1008.574) (-1004.539) (-1007.016) -- 0:00:49
232000 -- (-1006.880) (-1007.094) (-1003.415) [-1004.994] * (-1003.701) [-1003.159] (-1009.112) (-1003.377) -- 0:00:49
232500 -- (-1007.524) (-1008.031) [-1003.824] (-1006.266) * [-1003.917] (-1003.780) (-1004.507) (-1006.357) -- 0:00:49
233000 -- (-1006.915) (-1005.536) [-1003.369] (-1008.924) * (-1004.168) (-1004.439) [-1006.216] (-1007.820) -- 0:00:49
233500 -- [-1004.742] (-1004.886) (-1004.223) (-1008.086) * (-1003.369) (-1004.561) [-1008.291] (-1005.101) -- 0:00:49
234000 -- (-1006.263) [-1009.886] (-1004.771) (-1005.008) * (-1003.397) (-1004.569) [-1004.072] (-1006.982) -- 0:00:49
234500 -- (-1005.873) (-1011.778) (-1005.287) [-1004.299] * (-1003.950) (-1005.848) [-1004.360] (-1006.719) -- 0:00:48
235000 -- (-1004.108) [-1007.142] (-1009.272) (-1007.062) * (-1004.563) [-1006.602] (-1005.886) (-1010.181) -- 0:00:52
Average standard deviation of split frequencies: 0.014426
235500 -- (-1004.598) (-1007.516) [-1004.444] (-1006.855) * (-1003.810) (-1012.704) [-1004.990] (-1007.988) -- 0:00:51
236000 -- (-1006.503) (-1008.013) (-1004.959) [-1004.974] * [-1007.073] (-1006.109) (-1005.452) (-1006.207) -- 0:00:51
236500 -- (-1005.847) (-1007.441) [-1004.992] (-1006.407) * [-1006.462] (-1009.579) (-1006.218) (-1005.170) -- 0:00:51
237000 -- (-1008.204) (-1005.677) [-1005.119] (-1007.016) * (-1005.149) (-1005.862) (-1007.739) [-1005.938] -- 0:00:51
237500 -- (-1003.576) [-1003.536] (-1004.338) (-1005.248) * (-1004.983) (-1007.421) (-1003.841) [-1005.471] -- 0:00:51
238000 -- (-1003.864) [-1003.782] (-1004.001) (-1005.550) * (-1006.055) (-1005.463) (-1005.842) [-1007.373] -- 0:00:51
238500 -- (-1005.265) (-1004.989) (-1004.906) [-1004.076] * [-1004.294] (-1005.111) (-1004.640) (-1008.892) -- 0:00:51
239000 -- (-1008.330) (-1006.999) (-1004.845) [-1004.590] * (-1003.998) (-1008.726) [-1005.427] (-1009.640) -- 0:00:50
239500 -- [-1008.707] (-1006.791) (-1004.385) (-1005.944) * (-1007.539) (-1005.358) (-1004.294) [-1005.179] -- 0:00:50
240000 -- (-1008.623) (-1005.221) (-1004.807) [-1003.492] * (-1006.853) (-1004.242) (-1004.462) [-1005.011] -- 0:00:50
Average standard deviation of split frequencies: 0.013820
240500 -- (-1004.549) (-1004.285) [-1004.798] (-1006.857) * (-1008.146) (-1004.004) [-1007.269] (-1005.202) -- 0:00:50
241000 -- (-1003.632) (-1005.749) [-1007.558] (-1010.390) * (-1004.731) (-1007.420) (-1008.489) [-1005.155] -- 0:00:50
241500 -- (-1004.827) [-1005.281] (-1004.726) (-1005.402) * (-1009.229) (-1006.672) [-1005.220] (-1007.816) -- 0:00:50
242000 -- (-1004.867) [-1007.617] (-1011.711) (-1006.019) * [-1004.851] (-1005.261) (-1005.320) (-1006.387) -- 0:00:50
242500 -- (-1004.632) [-1004.174] (-1007.408) (-1007.544) * [-1006.792] (-1004.814) (-1003.873) (-1004.728) -- 0:00:49
243000 -- [-1004.962] (-1004.876) (-1005.890) (-1005.882) * (-1008.799) (-1007.233) [-1006.206] (-1004.576) -- 0:00:49
243500 -- (-1004.980) (-1004.146) (-1011.936) [-1007.558] * (-1005.592) (-1006.424) (-1005.407) [-1005.453] -- 0:00:49
244000 -- (-1005.948) [-1004.484] (-1005.187) (-1007.330) * (-1008.342) (-1005.721) (-1013.399) [-1003.636] -- 0:00:49
244500 -- (-1004.790) (-1006.054) [-1004.969] (-1005.121) * (-1007.457) (-1004.826) [-1008.212] (-1005.405) -- 0:00:49
245000 -- (-1005.870) (-1006.528) (-1008.978) [-1006.698] * (-1006.341) (-1005.657) [-1004.477] (-1005.654) -- 0:00:49
Average standard deviation of split frequencies: 0.013201
245500 -- (-1005.390) (-1006.530) (-1012.748) [-1004.187] * (-1007.758) (-1004.888) (-1005.010) [-1005.671] -- 0:00:49
246000 -- (-1008.497) (-1005.136) [-1004.456] (-1007.438) * (-1005.620) (-1005.140) [-1010.093] (-1004.974) -- 0:00:49
246500 -- [-1008.274] (-1004.774) (-1004.108) (-1007.231) * [-1005.666] (-1006.932) (-1011.444) (-1004.604) -- 0:00:48
247000 -- (-1006.758) [-1003.644] (-1004.070) (-1005.569) * (-1005.460) (-1004.925) [-1006.837] (-1008.089) -- 0:00:48
247500 -- [-1007.004] (-1003.894) (-1004.906) (-1006.301) * (-1006.555) (-1003.665) [-1006.245] (-1005.429) -- 0:00:48
248000 -- (-1005.051) (-1005.395) [-1004.024] (-1004.944) * (-1007.363) [-1004.103] (-1006.552) (-1003.262) -- 0:00:48
248500 -- (-1006.612) [-1004.891] (-1004.252) (-1004.725) * [-1006.628] (-1005.538) (-1005.739) (-1004.019) -- 0:00:48
249000 -- [-1005.723] (-1004.295) (-1004.445) (-1006.806) * (-1007.572) (-1006.707) [-1005.654] (-1007.106) -- 0:00:51
249500 -- (-1004.673) (-1004.390) (-1004.317) [-1008.038] * [-1005.421] (-1005.671) (-1003.737) (-1007.760) -- 0:00:51
250000 -- (-1013.188) (-1004.966) [-1003.975] (-1006.915) * (-1005.669) (-1007.366) [-1003.754] (-1006.819) -- 0:00:51
Average standard deviation of split frequencies: 0.012642
250500 -- (-1003.655) (-1006.598) [-1006.900] (-1005.938) * (-1004.104) [-1006.628] (-1005.562) (-1003.853) -- 0:00:50
251000 -- (-1003.703) [-1004.510] (-1004.171) (-1007.952) * (-1003.466) [-1004.551] (-1004.663) (-1003.451) -- 0:00:50
251500 -- [-1007.271] (-1008.240) (-1004.320) (-1010.339) * (-1004.225) (-1004.860) (-1006.239) [-1003.644] -- 0:00:50
252000 -- (-1006.218) (-1005.188) [-1011.636] (-1005.233) * (-1005.669) (-1007.656) [-1007.446] (-1003.710) -- 0:00:50
252500 -- (-1007.788) (-1005.559) [-1003.257] (-1006.375) * (-1004.247) [-1005.063] (-1005.670) (-1006.411) -- 0:00:50
253000 -- (-1006.842) (-1005.297) [-1005.884] (-1006.586) * (-1004.940) (-1004.412) (-1004.683) [-1007.250] -- 0:00:50
253500 -- (-1003.437) [-1004.751] (-1005.663) (-1004.607) * (-1003.801) (-1004.187) [-1004.134] (-1008.152) -- 0:00:50
254000 -- [-1004.503] (-1007.498) (-1007.100) (-1003.944) * [-1004.544] (-1003.690) (-1004.564) (-1008.086) -- 0:00:49
254500 -- [-1005.482] (-1009.792) (-1014.473) (-1005.269) * (-1007.527) [-1007.044] (-1005.949) (-1014.556) -- 0:00:49
255000 -- (-1007.158) [-1007.265] (-1006.885) (-1003.730) * [-1004.722] (-1005.514) (-1004.650) (-1009.765) -- 0:00:49
Average standard deviation of split frequencies: 0.012685
255500 -- (-1011.795) (-1005.550) (-1004.052) [-1004.357] * [-1005.582] (-1003.920) (-1004.005) (-1006.077) -- 0:00:49
256000 -- [-1009.791] (-1008.583) (-1005.813) (-1008.923) * (-1004.446) (-1003.516) (-1005.230) [-1005.193] -- 0:00:49
256500 -- [-1009.752] (-1008.144) (-1004.208) (-1007.553) * (-1004.446) (-1005.113) (-1005.452) [-1005.160] -- 0:00:49
257000 -- (-1008.470) [-1007.447] (-1004.252) (-1005.417) * (-1004.019) (-1007.012) [-1004.064] (-1005.407) -- 0:00:49
257500 -- (-1010.744) (-1007.143) (-1003.917) [-1003.748] * (-1004.341) [-1007.939] (-1006.264) (-1007.664) -- 0:00:49
258000 -- (-1006.423) (-1009.392) (-1004.833) [-1003.994] * [-1003.697] (-1005.852) (-1008.912) (-1005.280) -- 0:00:48
258500 -- (-1006.914) (-1006.128) (-1003.301) [-1006.746] * (-1004.640) [-1005.564] (-1005.167) (-1007.103) -- 0:00:48
259000 -- (-1008.082) (-1009.650) (-1007.460) [-1009.794] * (-1004.910) (-1012.236) [-1009.179] (-1006.521) -- 0:00:48
259500 -- (-1007.564) (-1003.355) (-1007.187) [-1005.462] * (-1005.099) (-1005.520) [-1004.684] (-1004.367) -- 0:00:48
260000 -- (-1003.684) (-1005.520) (-1005.877) [-1004.292] * (-1004.577) (-1003.574) (-1005.436) [-1004.063] -- 0:00:48
Average standard deviation of split frequencies: 0.010650
260500 -- (-1007.442) [-1006.130] (-1006.452) (-1008.260) * (-1004.438) (-1003.510) (-1007.573) [-1006.523] -- 0:00:48
261000 -- (-1004.293) [-1005.514] (-1004.085) (-1003.423) * [-1003.472] (-1003.434) (-1005.213) (-1009.216) -- 0:00:48
261500 -- (-1007.329) (-1007.030) [-1007.620] (-1008.354) * [-1004.924] (-1004.671) (-1004.614) (-1015.892) -- 0:00:48
262000 -- (-1006.057) (-1009.285) [-1005.850] (-1006.046) * (-1006.210) (-1006.231) (-1004.838) [-1006.125] -- 0:00:47
262500 -- (-1005.348) (-1004.794) [-1006.788] (-1003.828) * (-1003.912) [-1004.995] (-1005.201) (-1005.941) -- 0:00:47
263000 -- (-1004.651) (-1005.733) (-1005.687) [-1005.516] * (-1004.345) (-1006.941) (-1004.475) [-1004.814] -- 0:00:47
263500 -- (-1004.543) (-1011.504) (-1005.552) [-1005.826] * (-1004.207) (-1004.454) [-1003.964] (-1005.827) -- 0:00:50
264000 -- (-1006.862) (-1004.820) [-1003.270] (-1007.073) * (-1004.204) [-1003.262] (-1003.444) (-1007.022) -- 0:00:50
264500 -- (-1004.076) (-1006.445) [-1004.891] (-1006.147) * (-1006.245) (-1005.050) [-1004.708] (-1006.570) -- 0:00:50
265000 -- (-1004.006) (-1009.583) [-1003.826] (-1007.002) * (-1006.243) (-1008.141) [-1006.138] (-1006.805) -- 0:00:49
Average standard deviation of split frequencies: 0.010338
265500 -- (-1004.862) (-1005.709) [-1003.713] (-1005.757) * (-1003.626) (-1007.420) (-1005.654) [-1005.068] -- 0:00:49
266000 -- (-1005.928) [-1008.166] (-1010.912) (-1006.458) * (-1004.162) (-1007.854) (-1005.970) [-1005.076] -- 0:00:49
266500 -- (-1007.417) (-1007.082) (-1005.489) [-1005.034] * [-1003.418] (-1007.739) (-1009.604) (-1006.931) -- 0:00:49
267000 -- (-1008.557) (-1004.037) (-1004.746) [-1004.779] * (-1003.772) [-1005.337] (-1006.347) (-1005.901) -- 0:00:49
267500 -- (-1003.831) (-1004.037) [-1004.031] (-1005.833) * (-1004.991) [-1006.173] (-1006.625) (-1004.937) -- 0:00:49
268000 -- (-1005.083) [-1003.149] (-1006.622) (-1004.420) * (-1006.387) (-1007.109) (-1005.637) [-1006.563] -- 0:00:49
268500 -- [-1004.443] (-1004.066) (-1004.410) (-1007.303) * (-1005.304) (-1005.666) [-1004.267] (-1004.310) -- 0:00:49
269000 -- (-1004.618) (-1004.684) (-1005.135) [-1006.025] * (-1005.071) [-1004.090] (-1006.016) (-1007.322) -- 0:00:48
269500 -- [-1005.147] (-1010.209) (-1007.000) (-1005.575) * (-1006.843) [-1004.297] (-1007.822) (-1006.153) -- 0:00:48
270000 -- [-1004.749] (-1009.957) (-1006.614) (-1004.253) * [-1005.467] (-1004.148) (-1006.335) (-1003.265) -- 0:00:48
Average standard deviation of split frequencies: 0.007581
270500 -- (-1007.504) [-1009.481] (-1009.375) (-1004.772) * (-1005.220) [-1003.608] (-1008.967) (-1005.745) -- 0:00:48
271000 -- (-1009.970) (-1003.951) (-1007.063) [-1004.309] * [-1005.712] (-1009.048) (-1004.886) (-1004.758) -- 0:00:48
271500 -- (-1003.680) (-1003.909) [-1005.054] (-1006.450) * (-1005.144) [-1005.505] (-1005.492) (-1005.429) -- 0:00:48
272000 -- (-1005.714) (-1004.296) [-1004.389] (-1004.196) * (-1004.719) (-1006.610) (-1004.130) [-1004.687] -- 0:00:48
272500 -- (-1004.815) [-1003.933] (-1004.650) (-1005.429) * (-1005.067) (-1006.268) (-1005.412) [-1004.366] -- 0:00:48
273000 -- (-1005.615) (-1007.018) (-1004.134) [-1004.997] * (-1005.531) (-1005.903) (-1005.426) [-1004.873] -- 0:00:47
273500 -- (-1005.624) (-1008.810) (-1004.982) [-1007.719] * [-1006.171] (-1010.447) (-1008.184) (-1004.902) -- 0:00:47
274000 -- (-1008.548) (-1006.601) (-1004.695) [-1006.162] * (-1007.578) (-1005.760) (-1004.226) [-1004.886] -- 0:00:47
274500 -- (-1010.431) (-1006.524) (-1003.447) [-1005.760] * (-1009.584) (-1010.511) [-1006.943] (-1005.213) -- 0:00:47
275000 -- (-1008.241) [-1007.482] (-1004.509) (-1005.611) * (-1005.310) [-1006.733] (-1005.493) (-1005.402) -- 0:00:47
Average standard deviation of split frequencies: 0.008433
275500 -- (-1007.230) (-1005.212) [-1005.368] (-1006.640) * (-1004.549) (-1006.150) [-1006.105] (-1006.652) -- 0:00:47
276000 -- (-1007.013) (-1009.997) [-1003.614] (-1003.614) * (-1008.716) (-1005.302) (-1004.554) [-1004.987] -- 0:00:47
276500 -- (-1008.291) (-1006.696) [-1004.119] (-1005.707) * (-1010.258) (-1008.969) (-1007.501) [-1003.928] -- 0:00:47
277000 -- (-1005.042) [-1004.979] (-1006.719) (-1003.856) * (-1013.310) (-1007.917) [-1005.577] (-1008.519) -- 0:00:46
277500 -- (-1006.409) (-1005.881) [-1007.884] (-1003.592) * (-1003.919) (-1008.672) (-1007.761) [-1005.651] -- 0:00:49
278000 -- (-1006.029) (-1005.545) [-1004.942] (-1005.302) * (-1003.919) [-1006.261] (-1004.880) (-1006.860) -- 0:00:49
278500 -- (-1006.072) [-1005.127] (-1004.948) (-1004.569) * [-1005.236] (-1004.474) (-1005.467) (-1006.845) -- 0:00:49
279000 -- (-1008.647) (-1004.560) (-1006.620) [-1007.421] * (-1006.506) [-1005.250] (-1004.536) (-1005.388) -- 0:00:49
279500 -- (-1005.856) (-1009.077) [-1006.344] (-1007.812) * (-1006.893) (-1005.007) [-1004.071] (-1005.156) -- 0:00:48
280000 -- (-1006.123) [-1006.121] (-1005.884) (-1005.794) * [-1003.427] (-1005.536) (-1003.215) (-1004.407) -- 0:00:48
Average standard deviation of split frequencies: 0.007978
280500 -- (-1010.223) (-1004.068) (-1004.906) [-1007.650] * (-1004.598) (-1013.605) [-1004.561] (-1005.585) -- 0:00:48
281000 -- (-1008.507) (-1005.599) (-1005.682) [-1009.340] * (-1003.671) (-1007.911) [-1005.574] (-1004.911) -- 0:00:48
281500 -- [-1008.349] (-1005.864) (-1007.809) (-1007.915) * (-1005.327) [-1003.602] (-1006.246) (-1005.838) -- 0:00:48
282000 -- (-1006.531) (-1005.585) [-1007.928] (-1009.298) * [-1006.682] (-1006.173) (-1004.970) (-1004.567) -- 0:00:48
282500 -- (-1004.506) [-1005.879] (-1005.202) (-1007.416) * (-1007.500) (-1005.700) (-1005.101) [-1005.021] -- 0:00:48
283000 -- (-1006.313) [-1004.317] (-1006.455) (-1007.683) * (-1004.988) [-1004.121] (-1007.676) (-1004.180) -- 0:00:48
283500 -- (-1008.367) (-1006.355) (-1008.457) [-1005.830] * [-1005.153] (-1005.062) (-1008.192) (-1006.308) -- 0:00:48
284000 -- (-1004.480) [-1003.305] (-1003.951) (-1009.309) * (-1004.561) (-1004.435) [-1006.914] (-1004.146) -- 0:00:47
284500 -- [-1006.294] (-1007.874) (-1003.493) (-1007.162) * (-1004.801) (-1004.728) (-1004.355) [-1004.202] -- 0:00:47
285000 -- (-1005.204) (-1006.091) (-1006.943) [-1005.458] * (-1004.920) (-1008.595) (-1006.607) [-1005.786] -- 0:00:47
Average standard deviation of split frequencies: 0.008502
285500 -- (-1003.349) (-1005.394) (-1005.160) [-1004.463] * (-1004.812) (-1007.679) [-1005.912] (-1010.056) -- 0:00:47
286000 -- (-1005.057) (-1003.859) [-1004.323] (-1005.502) * (-1006.497) [-1005.397] (-1005.844) (-1006.419) -- 0:00:47
286500 -- (-1005.207) (-1009.579) (-1007.091) [-1003.631] * (-1003.988) [-1004.321] (-1009.214) (-1005.986) -- 0:00:47
287000 -- (-1004.618) (-1009.755) [-1007.498] (-1005.209) * [-1004.003] (-1005.212) (-1009.115) (-1006.548) -- 0:00:47
287500 -- (-1004.087) (-1008.990) [-1006.284] (-1004.285) * (-1007.011) (-1005.146) (-1005.457) [-1005.237] -- 0:00:47
288000 -- (-1004.392) [-1008.380] (-1005.911) (-1004.787) * [-1005.239] (-1006.503) (-1005.011) (-1012.512) -- 0:00:46
288500 -- (-1003.664) (-1004.520) [-1004.019] (-1009.138) * [-1005.035] (-1006.095) (-1003.334) (-1006.985) -- 0:00:46
289000 -- (-1006.063) [-1004.334] (-1004.567) (-1007.968) * [-1004.118] (-1006.904) (-1005.913) (-1004.594) -- 0:00:46
289500 -- [-1007.188] (-1003.809) (-1004.563) (-1008.236) * (-1004.233) (-1005.987) [-1005.306] (-1006.002) -- 0:00:46
290000 -- (-1005.495) (-1003.710) (-1004.184) [-1006.402] * [-1004.452] (-1007.567) (-1003.544) (-1009.105) -- 0:00:46
Average standard deviation of split frequencies: 0.008963
290500 -- [-1003.679] (-1003.916) (-1006.001) (-1006.861) * (-1003.976) (-1007.068) [-1004.691] (-1005.915) -- 0:00:46
291000 -- (-1004.154) (-1003.534) [-1008.186] (-1007.315) * (-1007.372) (-1012.482) (-1004.266) [-1005.239] -- 0:00:46
291500 -- (-1005.135) (-1004.615) [-1009.606] (-1005.714) * (-1007.419) (-1005.379) (-1006.543) [-1004.085] -- 0:00:48
292000 -- (-1007.822) (-1004.189) [-1007.048] (-1007.586) * (-1004.509) (-1006.077) (-1004.923) [-1005.810] -- 0:00:48
292500 -- (-1006.838) [-1003.628] (-1005.434) (-1006.198) * (-1006.729) [-1008.146] (-1004.070) (-1005.244) -- 0:00:48
293000 -- [-1004.757] (-1004.423) (-1006.802) (-1004.706) * (-1004.083) (-1008.289) [-1004.387] (-1003.591) -- 0:00:48
293500 -- (-1004.568) [-1005.875] (-1005.507) (-1005.290) * [-1005.231] (-1006.604) (-1009.189) (-1003.397) -- 0:00:48
294000 -- (-1006.589) [-1004.192] (-1006.065) (-1009.271) * (-1004.226) (-1007.702) (-1012.072) [-1003.802] -- 0:00:48
294500 -- (-1005.871) (-1004.968) [-1008.288] (-1005.429) * [-1003.182] (-1007.624) (-1007.009) (-1010.862) -- 0:00:47
295000 -- (-1005.550) [-1004.173] (-1008.182) (-1008.781) * [-1004.713] (-1004.468) (-1006.130) (-1005.567) -- 0:00:47
Average standard deviation of split frequencies: 0.008494
295500 -- [-1004.115] (-1005.158) (-1006.417) (-1006.894) * [-1004.848] (-1005.843) (-1008.765) (-1005.094) -- 0:00:47
296000 -- (-1003.923) [-1004.325] (-1007.586) (-1004.356) * (-1005.689) (-1006.273) (-1007.560) [-1004.172] -- 0:00:47
296500 -- (-1004.405) (-1004.076) [-1006.137] (-1007.711) * (-1005.764) [-1004.668] (-1005.396) (-1007.545) -- 0:00:47
297000 -- (-1004.053) (-1004.591) (-1009.321) [-1003.810] * (-1005.214) [-1005.882] (-1004.455) (-1007.398) -- 0:00:47
297500 -- [-1003.922] (-1003.689) (-1005.299) (-1006.495) * [-1005.036] (-1005.681) (-1004.964) (-1005.050) -- 0:00:47
298000 -- (-1006.626) [-1004.251] (-1003.716) (-1004.482) * (-1004.609) [-1003.803] (-1009.247) (-1005.590) -- 0:00:47
298500 -- (-1007.823) (-1003.556) [-1004.895] (-1005.727) * (-1003.863) (-1004.799) [-1006.037] (-1006.535) -- 0:00:47
299000 -- [-1004.206] (-1006.312) (-1004.968) (-1004.524) * (-1005.327) (-1003.626) [-1006.221] (-1004.010) -- 0:00:46
299500 -- (-1004.142) (-1006.173) [-1004.796] (-1006.535) * [-1003.968] (-1004.510) (-1006.573) (-1004.028) -- 0:00:46
300000 -- (-1004.668) (-1005.233) (-1003.428) [-1006.020] * (-1004.955) [-1003.880] (-1007.883) (-1004.465) -- 0:00:46
Average standard deviation of split frequencies: 0.008710
300500 -- (-1004.390) (-1005.855) (-1003.240) [-1006.045] * [-1003.791] (-1006.016) (-1007.071) (-1004.598) -- 0:00:46
301000 -- (-1006.328) (-1006.287) (-1004.162) [-1006.795] * [-1005.695] (-1006.581) (-1007.766) (-1004.522) -- 0:00:46
301500 -- [-1004.922] (-1004.770) (-1003.389) (-1006.702) * (-1005.659) (-1003.998) [-1006.639] (-1004.471) -- 0:00:46
302000 -- (-1004.058) (-1008.996) (-1004.856) [-1005.728] * (-1004.232) (-1003.140) (-1007.192) [-1007.356] -- 0:00:46
302500 -- (-1005.940) [-1008.913] (-1004.723) (-1006.819) * (-1007.973) [-1005.097] (-1005.138) (-1005.451) -- 0:00:46
303000 -- [-1006.433] (-1004.951) (-1006.814) (-1005.505) * (-1007.182) [-1005.810] (-1005.430) (-1005.438) -- 0:00:46
303500 -- (-1009.682) (-1004.834) [-1007.029] (-1005.395) * [-1004.636] (-1007.570) (-1008.430) (-1004.394) -- 0:00:45
304000 -- (-1004.167) (-1004.797) [-1005.268] (-1009.150) * [-1004.151] (-1004.966) (-1008.065) (-1005.189) -- 0:00:45
304500 -- [-1003.895] (-1009.601) (-1004.645) (-1005.697) * (-1004.487) (-1003.943) (-1006.078) [-1006.211] -- 0:00:45
305000 -- (-1003.922) (-1007.159) [-1004.315] (-1005.406) * (-1006.278) (-1005.304) (-1005.669) [-1004.975] -- 0:00:45
Average standard deviation of split frequencies: 0.009842
305500 -- (-1003.886) (-1005.191) [-1003.098] (-1006.828) * (-1006.284) (-1006.490) (-1004.526) [-1005.865] -- 0:00:45
306000 -- [-1004.125] (-1005.986) (-1003.212) (-1004.417) * [-1004.959] (-1007.516) (-1010.020) (-1004.878) -- 0:00:45
306500 -- (-1003.415) [-1007.326] (-1005.517) (-1006.007) * (-1004.026) (-1005.072) [-1009.472] (-1003.811) -- 0:00:45
307000 -- [-1003.415] (-1011.078) (-1007.624) (-1005.331) * (-1005.418) [-1005.190] (-1005.607) (-1003.841) -- 0:00:45
307500 -- (-1004.818) (-1007.365) (-1006.980) [-1004.471] * (-1010.351) [-1003.837] (-1006.416) (-1004.630) -- 0:00:47
308000 -- (-1008.095) (-1008.986) [-1003.726] (-1004.620) * [-1010.025] (-1003.690) (-1005.767) (-1006.756) -- 0:00:47
308500 -- (-1007.179) (-1009.393) [-1005.988] (-1005.900) * (-1005.304) [-1003.746] (-1005.215) (-1003.486) -- 0:00:47
309000 -- (-1005.156) [-1004.566] (-1005.690) (-1004.662) * (-1007.834) [-1005.367] (-1004.647) (-1003.599) -- 0:00:46
309500 -- [-1004.312] (-1006.712) (-1006.267) (-1009.113) * [-1004.827] (-1003.222) (-1003.716) (-1003.548) -- 0:00:46
310000 -- (-1006.855) (-1005.590) [-1004.266] (-1012.526) * [-1007.093] (-1004.668) (-1004.933) (-1003.181) -- 0:00:46
Average standard deviation of split frequencies: 0.010285
310500 -- [-1003.270] (-1010.993) (-1005.395) (-1005.974) * (-1004.765) [-1004.644] (-1006.413) (-1003.311) -- 0:00:46
311000 -- [-1005.589] (-1007.201) (-1009.347) (-1006.838) * (-1005.905) (-1009.599) (-1006.133) [-1004.537] -- 0:00:46
311500 -- (-1007.254) (-1005.540) [-1005.255] (-1007.485) * (-1005.532) [-1006.136] (-1005.497) (-1005.258) -- 0:00:46
312000 -- (-1005.968) (-1006.508) [-1010.295] (-1006.665) * (-1003.951) (-1006.627) (-1005.404) [-1006.591] -- 0:00:46
312500 -- [-1005.828] (-1004.455) (-1005.472) (-1005.303) * (-1007.334) (-1005.064) [-1004.501] (-1007.056) -- 0:00:46
313000 -- [-1009.822] (-1004.251) (-1004.164) (-1004.906) * (-1005.223) [-1006.387] (-1004.113) (-1007.343) -- 0:00:46
313500 -- [-1006.543] (-1004.554) (-1004.304) (-1005.343) * (-1003.556) (-1004.865) [-1003.700] (-1006.801) -- 0:00:45
314000 -- [-1003.496] (-1003.531) (-1005.899) (-1005.386) * (-1004.561) (-1005.374) [-1004.743] (-1007.484) -- 0:00:45
314500 -- [-1004.222] (-1003.531) (-1008.933) (-1004.502) * (-1003.537) (-1004.527) [-1005.888] (-1005.937) -- 0:00:45
315000 -- (-1003.950) (-1008.275) [-1004.124] (-1004.357) * (-1005.122) [-1004.163] (-1003.546) (-1004.510) -- 0:00:45
Average standard deviation of split frequencies: 0.010969
315500 -- [-1005.686] (-1004.758) (-1005.445) (-1003.917) * (-1005.054) (-1006.038) (-1003.856) [-1007.323] -- 0:00:45
316000 -- [-1004.386] (-1005.048) (-1004.798) (-1005.245) * (-1004.145) [-1004.396] (-1010.906) (-1006.315) -- 0:00:45
316500 -- (-1005.537) (-1003.865) [-1004.339] (-1007.269) * [-1004.261] (-1006.364) (-1006.511) (-1003.845) -- 0:00:45
317000 -- (-1006.155) (-1005.821) [-1004.661] (-1007.818) * [-1004.002] (-1004.590) (-1006.376) (-1004.475) -- 0:00:45
317500 -- [-1006.522] (-1009.287) (-1008.820) (-1010.293) * (-1010.758) [-1005.079] (-1008.619) (-1003.230) -- 0:00:45
318000 -- (-1004.944) (-1008.909) (-1006.262) [-1004.858] * (-1006.695) [-1004.635] (-1005.393) (-1006.731) -- 0:00:45
318500 -- (-1004.044) (-1004.188) (-1004.133) [-1004.786] * (-1005.649) [-1003.091] (-1007.819) (-1010.286) -- 0:00:44
319000 -- (-1003.873) [-1003.911] (-1005.717) (-1003.494) * (-1004.113) (-1013.878) [-1006.115] (-1005.722) -- 0:00:44
319500 -- [-1005.040] (-1010.796) (-1003.797) (-1006.767) * (-1005.869) (-1006.933) [-1005.547] (-1005.646) -- 0:00:44
320000 -- [-1007.759] (-1011.940) (-1004.185) (-1010.563) * (-1007.977) [-1005.991] (-1011.061) (-1006.467) -- 0:00:44
Average standard deviation of split frequencies: 0.011328
320500 -- [-1004.716] (-1010.548) (-1006.847) (-1005.336) * (-1006.581) (-1004.819) [-1005.039] (-1007.306) -- 0:00:44
321000 -- [-1005.801] (-1006.431) (-1010.902) (-1004.371) * [-1004.260] (-1004.911) (-1006.129) (-1003.140) -- 0:00:44
321500 -- [-1004.547] (-1006.803) (-1004.906) (-1005.897) * (-1005.242) (-1007.899) (-1008.421) [-1003.846] -- 0:00:44
322000 -- (-1005.522) [-1006.942] (-1005.330) (-1003.635) * [-1003.616] (-1005.525) (-1004.804) (-1007.162) -- 0:00:44
322500 -- (-1003.784) (-1006.419) [-1004.656] (-1008.395) * [-1004.102] (-1003.221) (-1010.781) (-1007.698) -- 0:00:44
323000 -- [-1004.548] (-1003.576) (-1004.760) (-1005.418) * [-1005.042] (-1004.272) (-1009.350) (-1005.725) -- 0:00:44
323500 -- (-1004.295) [-1008.498] (-1004.717) (-1005.703) * (-1004.973) (-1005.462) (-1005.257) [-1006.289] -- 0:00:43
324000 -- (-1005.198) (-1008.209) [-1009.566] (-1005.697) * (-1004.475) (-1004.066) (-1005.090) [-1004.918] -- 0:00:45
324500 -- (-1009.236) (-1008.057) (-1008.342) [-1005.333] * (-1005.571) (-1003.863) (-1009.341) [-1004.875] -- 0:00:45
325000 -- (-1008.414) (-1010.429) [-1005.539] (-1007.160) * (-1008.530) (-1006.094) [-1005.303] (-1009.382) -- 0:00:45
Average standard deviation of split frequencies: 0.011488
325500 -- (-1006.082) [-1010.538] (-1006.156) (-1008.055) * [-1004.299] (-1004.933) (-1008.407) (-1008.085) -- 0:00:45
326000 -- (-1007.081) [-1007.755] (-1006.437) (-1004.355) * (-1003.708) [-1009.653] (-1005.382) (-1008.292) -- 0:00:45
326500 -- (-1004.659) (-1003.674) [-1008.669] (-1005.243) * (-1003.757) (-1004.222) [-1003.897] (-1007.365) -- 0:00:45
327000 -- [-1004.827] (-1005.079) (-1005.863) (-1007.009) * (-1005.050) (-1005.963) [-1003.301] (-1005.678) -- 0:00:45
327500 -- (-1005.592) [-1005.356] (-1008.577) (-1008.174) * (-1004.678) (-1005.360) (-1005.174) [-1003.834] -- 0:00:45
328000 -- (-1004.280) (-1007.464) (-1007.141) [-1005.809] * (-1007.663) (-1005.044) [-1005.914] (-1005.141) -- 0:00:45
328500 -- (-1004.670) (-1008.842) [-1004.230] (-1006.707) * (-1005.813) (-1003.714) [-1004.800] (-1004.364) -- 0:00:44
329000 -- (-1004.511) [-1007.242] (-1004.232) (-1006.612) * (-1007.819) (-1004.316) [-1006.615] (-1005.867) -- 0:00:44
329500 -- (-1004.708) (-1007.360) (-1005.514) [-1003.949] * (-1005.121) [-1004.216] (-1006.449) (-1004.295) -- 0:00:44
330000 -- [-1005.842] (-1008.322) (-1007.922) (-1005.857) * [-1005.557] (-1003.969) (-1007.078) (-1003.397) -- 0:00:44
Average standard deviation of split frequencies: 0.012197
330500 -- (-1005.526) (-1004.359) (-1004.550) [-1004.536] * (-1008.383) (-1004.340) [-1006.911] (-1006.062) -- 0:00:44
331000 -- (-1008.644) [-1005.427] (-1007.481) (-1009.329) * (-1007.638) (-1004.096) [-1004.596] (-1008.544) -- 0:00:44
331500 -- [-1003.239] (-1008.135) (-1008.408) (-1004.102) * (-1006.067) (-1007.425) [-1003.612] (-1006.674) -- 0:00:44
332000 -- [-1003.736] (-1006.091) (-1004.094) (-1004.145) * [-1004.728] (-1005.650) (-1005.666) (-1007.574) -- 0:00:44
332500 -- [-1005.517] (-1009.806) (-1010.944) (-1004.749) * [-1004.603] (-1005.169) (-1004.663) (-1012.416) -- 0:00:44
333000 -- (-1010.236) (-1009.645) (-1008.031) [-1005.824] * (-1003.751) (-1006.584) (-1004.640) [-1005.809] -- 0:00:44
333500 -- (-1007.183) (-1005.772) [-1004.135] (-1004.145) * [-1004.152] (-1007.477) (-1008.506) (-1005.691) -- 0:00:43
334000 -- (-1005.697) (-1004.154) (-1005.238) [-1005.851] * (-1004.188) (-1004.870) (-1005.333) [-1004.958] -- 0:00:43
334500 -- [-1004.048] (-1004.579) (-1003.798) (-1007.010) * [-1006.898] (-1006.725) (-1004.784) (-1007.295) -- 0:00:43
335000 -- (-1009.643) [-1007.254] (-1003.580) (-1007.789) * (-1004.474) (-1003.733) [-1006.088] (-1005.910) -- 0:00:43
Average standard deviation of split frequencies: 0.012379
335500 -- (-1006.183) (-1008.623) [-1006.486] (-1005.265) * (-1004.739) (-1003.994) [-1004.771] (-1005.734) -- 0:00:43
336000 -- [-1006.226] (-1004.335) (-1006.285) (-1007.380) * [-1008.279] (-1011.083) (-1004.494) (-1004.915) -- 0:00:43
336500 -- (-1008.637) [-1003.585] (-1005.551) (-1005.175) * (-1003.891) (-1005.623) [-1003.965] (-1003.565) -- 0:00:43
337000 -- [-1004.249] (-1004.562) (-1004.488) (-1003.809) * [-1004.620] (-1005.144) (-1004.353) (-1007.321) -- 0:00:43
337500 -- (-1004.902) [-1004.137] (-1005.311) (-1003.445) * (-1005.370) [-1006.854] (-1005.536) (-1005.354) -- 0:00:43
338000 -- (-1008.267) (-1005.005) (-1004.145) [-1003.267] * (-1005.214) [-1003.685] (-1007.497) (-1006.809) -- 0:00:43
338500 -- (-1009.928) (-1004.740) [-1009.401] (-1005.773) * [-1008.825] (-1005.686) (-1004.954) (-1004.619) -- 0:00:42
339000 -- (-1004.446) (-1007.524) (-1007.306) [-1003.549] * [-1008.781] (-1003.460) (-1006.435) (-1004.417) -- 0:00:42
339500 -- [-1004.127] (-1006.752) (-1006.959) (-1004.925) * [-1004.307] (-1005.180) (-1003.933) (-1006.439) -- 0:00:44
340000 -- (-1005.916) (-1004.484) [-1005.132] (-1003.144) * (-1005.824) (-1004.216) (-1005.061) [-1006.027] -- 0:00:44
Average standard deviation of split frequencies: 0.011378
340500 -- (-1006.307) (-1005.143) (-1006.690) [-1006.352] * [-1004.077] (-1006.315) (-1004.411) (-1008.166) -- 0:00:44
341000 -- (-1009.685) (-1003.640) [-1006.517] (-1009.092) * [-1006.245] (-1004.962) (-1009.922) (-1006.896) -- 0:00:44
341500 -- [-1006.697] (-1005.506) (-1004.711) (-1009.247) * (-1005.249) (-1006.447) [-1006.661] (-1005.441) -- 0:00:44
342000 -- [-1003.557] (-1003.220) (-1005.522) (-1007.985) * (-1005.550) (-1008.002) (-1007.818) [-1007.367] -- 0:00:44
342500 -- (-1003.189) (-1007.425) [-1004.983] (-1011.888) * (-1005.125) (-1004.458) [-1007.964] (-1005.822) -- 0:00:44
343000 -- [-1006.218] (-1007.985) (-1010.201) (-1006.353) * (-1016.424) (-1004.435) [-1007.408] (-1006.373) -- 0:00:44
343500 -- (-1005.362) (-1005.572) (-1010.058) [-1006.004] * [-1006.216] (-1008.285) (-1008.202) (-1006.005) -- 0:00:43
344000 -- (-1004.730) (-1004.574) [-1006.278] (-1006.807) * [-1008.362] (-1006.089) (-1007.085) (-1009.167) -- 0:00:43
344500 -- (-1011.789) (-1009.199) (-1004.654) [-1004.014] * (-1005.168) (-1005.305) (-1006.057) [-1004.775] -- 0:00:43
345000 -- [-1007.118] (-1005.723) (-1006.449) (-1004.916) * (-1005.388) (-1007.364) [-1006.819] (-1005.395) -- 0:00:43
Average standard deviation of split frequencies: 0.010672
345500 -- (-1006.322) (-1006.146) (-1003.976) [-1007.397] * (-1007.214) (-1005.072) (-1005.973) [-1007.534] -- 0:00:43
346000 -- [-1005.619] (-1006.489) (-1005.312) (-1004.052) * (-1010.974) [-1006.312] (-1007.743) (-1004.455) -- 0:00:43
346500 -- (-1009.353) (-1013.513) [-1004.812] (-1004.932) * (-1005.052) [-1007.546] (-1005.149) (-1003.877) -- 0:00:43
347000 -- (-1007.459) (-1005.070) [-1005.602] (-1005.967) * (-1003.994) (-1007.386) [-1003.821] (-1004.426) -- 0:00:43
347500 -- (-1005.814) [-1004.006] (-1005.271) (-1004.602) * [-1005.285] (-1005.974) (-1004.376) (-1004.140) -- 0:00:43
348000 -- (-1008.477) (-1006.079) (-1004.885) [-1003.515] * [-1004.386] (-1005.485) (-1006.278) (-1005.901) -- 0:00:43
348500 -- (-1008.106) [-1005.067] (-1005.167) (-1007.271) * [-1007.298] (-1007.591) (-1004.622) (-1005.371) -- 0:00:42
349000 -- (-1005.143) (-1006.973) [-1006.921] (-1016.241) * (-1006.070) (-1005.001) [-1004.586] (-1007.434) -- 0:00:42
349500 -- (-1006.308) (-1004.444) (-1005.348) [-1006.949] * [-1004.821] (-1007.907) (-1004.011) (-1009.136) -- 0:00:42
350000 -- (-1004.445) (-1005.608) (-1005.153) [-1004.398] * (-1004.401) (-1006.857) [-1004.365] (-1006.612) -- 0:00:42
Average standard deviation of split frequencies: 0.010979
350500 -- (-1007.475) (-1006.368) (-1008.443) [-1005.909] * (-1005.301) [-1003.917] (-1006.780) (-1004.521) -- 0:00:42
351000 -- (-1004.053) [-1006.958] (-1008.480) (-1003.340) * [-1003.698] (-1003.678) (-1007.592) (-1004.816) -- 0:00:42
351500 -- (-1003.912) (-1005.288) (-1005.371) [-1003.651] * (-1003.742) [-1005.506] (-1003.416) (-1006.704) -- 0:00:42
352000 -- (-1004.691) (-1009.712) [-1007.758] (-1004.986) * [-1004.951] (-1006.067) (-1004.941) (-1004.302) -- 0:00:42
352500 -- [-1005.704] (-1005.617) (-1008.878) (-1007.490) * (-1008.648) (-1005.476) (-1006.741) [-1003.307] -- 0:00:42
353000 -- (-1005.633) [-1005.318] (-1007.784) (-1004.756) * [-1010.058] (-1003.843) (-1007.824) (-1003.660) -- 0:00:42
353500 -- (-1005.164) [-1004.930] (-1007.571) (-1004.740) * (-1005.215) (-1007.451) (-1006.371) [-1009.951] -- 0:00:42
354000 -- (-1007.292) (-1003.942) [-1003.221] (-1004.452) * (-1006.464) [-1005.155] (-1009.680) (-1005.805) -- 0:00:41
354500 -- (-1006.890) [-1006.337] (-1005.537) (-1005.847) * (-1018.820) [-1010.380] (-1007.056) (-1006.863) -- 0:00:41
355000 -- (-1004.829) (-1005.474) [-1004.679] (-1004.303) * [-1006.822] (-1009.169) (-1007.188) (-1007.816) -- 0:00:43
Average standard deviation of split frequencies: 0.011108
355500 -- [-1005.676] (-1004.628) (-1004.252) (-1005.232) * [-1003.593] (-1004.277) (-1006.364) (-1007.060) -- 0:00:43
356000 -- (-1005.619) (-1003.583) (-1007.067) [-1004.113] * [-1003.333] (-1006.211) (-1004.697) (-1005.690) -- 0:00:43
356500 -- (-1007.020) [-1003.329] (-1006.350) (-1004.820) * (-1003.605) [-1003.574] (-1006.962) (-1007.766) -- 0:00:43
357000 -- (-1004.078) [-1003.300] (-1008.943) (-1004.112) * (-1005.942) (-1007.670) [-1006.993] (-1009.490) -- 0:00:43
357500 -- (-1004.937) [-1005.610] (-1004.495) (-1006.552) * [-1005.630] (-1006.761) (-1004.791) (-1003.965) -- 0:00:43
358000 -- (-1006.847) (-1007.238) (-1004.766) [-1004.554] * (-1007.216) (-1005.694) [-1004.924] (-1004.128) -- 0:00:43
358500 -- (-1003.980) (-1003.873) [-1008.730] (-1007.685) * [-1003.781] (-1005.046) (-1005.739) (-1006.112) -- 0:00:42
359000 -- (-1003.925) (-1004.551) (-1009.934) [-1004.053] * [-1004.582] (-1009.024) (-1007.097) (-1007.399) -- 0:00:42
359500 -- (-1004.186) [-1003.543] (-1006.559) (-1010.142) * (-1006.893) (-1007.256) [-1004.944] (-1008.140) -- 0:00:42
360000 -- (-1004.140) [-1004.020] (-1008.474) (-1006.666) * (-1009.938) [-1009.079] (-1004.959) (-1006.966) -- 0:00:42
Average standard deviation of split frequencies: 0.010841
360500 -- (-1005.519) (-1004.241) [-1006.663] (-1005.073) * [-1004.119] (-1008.413) (-1008.168) (-1005.211) -- 0:00:42
361000 -- [-1006.820] (-1006.390) (-1006.479) (-1007.043) * (-1005.734) (-1005.475) [-1005.638] (-1004.223) -- 0:00:42
361500 -- (-1003.960) [-1007.676] (-1006.075) (-1006.770) * (-1006.420) [-1005.850] (-1003.689) (-1007.038) -- 0:00:42
362000 -- (-1005.092) (-1004.311) (-1005.307) [-1003.609] * (-1003.409) (-1003.434) (-1003.689) [-1006.067] -- 0:00:42
362500 -- [-1003.469] (-1005.544) (-1005.617) (-1003.617) * (-1003.158) (-1007.905) (-1003.869) [-1003.785] -- 0:00:42
363000 -- (-1003.872) [-1004.075] (-1006.421) (-1004.522) * (-1004.223) [-1003.530] (-1004.445) (-1007.484) -- 0:00:42
363500 -- (-1003.675) (-1007.958) (-1004.124) [-1004.501] * (-1007.805) (-1004.300) (-1005.021) [-1006.899] -- 0:00:42
364000 -- (-1004.583) [-1006.315] (-1004.435) (-1007.647) * [-1004.714] (-1005.820) (-1004.778) (-1007.675) -- 0:00:41
364500 -- (-1004.938) (-1007.808) (-1004.774) [-1005.960] * [-1005.590] (-1003.189) (-1008.091) (-1008.848) -- 0:00:41
365000 -- [-1006.721] (-1007.829) (-1005.458) (-1007.802) * (-1006.738) [-1004.970] (-1005.793) (-1004.815) -- 0:00:41
Average standard deviation of split frequencies: 0.010759
365500 -- (-1005.523) (-1007.476) (-1004.683) [-1004.074] * (-1005.065) (-1006.271) [-1006.115] (-1004.009) -- 0:00:41
366000 -- (-1005.560) (-1005.760) [-1010.279] (-1003.402) * (-1004.385) [-1006.264] (-1004.788) (-1012.727) -- 0:00:41
366500 -- (-1003.570) [-1004.470] (-1010.747) (-1005.158) * (-1004.066) (-1006.725) [-1003.185] (-1015.206) -- 0:00:41
367000 -- [-1004.031] (-1003.401) (-1012.842) (-1004.864) * [-1007.846] (-1006.752) (-1006.333) (-1004.068) -- 0:00:41
367500 -- (-1005.075) (-1003.221) (-1005.696) [-1003.984] * (-1006.595) (-1006.297) [-1004.493] (-1004.091) -- 0:00:41
368000 -- [-1005.165] (-1006.577) (-1005.712) (-1004.525) * (-1006.538) (-1012.700) [-1004.172] (-1003.634) -- 0:00:41
368500 -- (-1005.994) (-1006.628) (-1006.941) [-1005.161] * [-1006.799] (-1008.419) (-1006.697) (-1005.145) -- 0:00:41
369000 -- (-1009.938) (-1008.479) (-1007.407) [-1005.820] * (-1005.389) (-1005.204) (-1007.625) [-1005.732] -- 0:00:41
369500 -- (-1003.529) (-1003.998) (-1008.535) [-1005.816] * (-1003.161) [-1005.933] (-1004.399) (-1007.108) -- 0:00:40
370000 -- (-1005.178) (-1004.005) [-1004.655] (-1008.024) * [-1005.102] (-1009.207) (-1005.606) (-1004.754) -- 0:00:40
Average standard deviation of split frequencies: 0.010099
370500 -- [-1004.860] (-1003.489) (-1004.107) (-1005.608) * [-1005.444] (-1004.706) (-1006.170) (-1006.389) -- 0:00:42
371000 -- (-1005.073) [-1004.732] (-1004.870) (-1005.974) * [-1005.014] (-1004.193) (-1008.643) (-1004.678) -- 0:00:42
371500 -- [-1003.831] (-1003.726) (-1006.140) (-1008.577) * [-1008.592] (-1005.108) (-1007.901) (-1008.878) -- 0:00:42
372000 -- (-1003.985) [-1006.443] (-1010.162) (-1008.894) * [-1009.983] (-1003.467) (-1006.610) (-1003.100) -- 0:00:42
372500 -- (-1004.794) (-1004.547) (-1004.786) [-1004.219] * (-1007.677) [-1004.512] (-1007.296) (-1006.331) -- 0:00:42
373000 -- [-1007.528] (-1008.136) (-1004.385) (-1003.599) * (-1005.179) [-1007.614] (-1004.935) (-1005.336) -- 0:00:42
373500 -- [-1006.423] (-1010.861) (-1005.321) (-1003.464) * (-1009.246) (-1006.743) (-1005.356) [-1004.295] -- 0:00:41
374000 -- (-1005.013) (-1005.943) (-1003.334) [-1004.992] * (-1004.719) (-1007.456) (-1007.490) [-1007.244] -- 0:00:41
374500 -- (-1004.690) [-1006.828] (-1004.772) (-1007.884) * [-1005.063] (-1005.773) (-1006.628) (-1005.554) -- 0:00:41
375000 -- [-1004.640] (-1007.360) (-1005.383) (-1005.060) * (-1006.268) [-1007.510] (-1006.018) (-1005.364) -- 0:00:41
Average standard deviation of split frequencies: 0.010735
375500 -- (-1005.743) [-1005.413] (-1006.041) (-1007.181) * (-1005.882) [-1011.270] (-1006.226) (-1011.932) -- 0:00:41
376000 -- [-1004.157] (-1005.067) (-1006.484) (-1007.484) * [-1005.934] (-1005.545) (-1006.629) (-1012.611) -- 0:00:41
376500 -- (-1004.061) [-1005.048] (-1004.244) (-1011.050) * [-1003.825] (-1005.436) (-1007.079) (-1008.348) -- 0:00:41
377000 -- (-1007.489) (-1003.696) [-1003.489] (-1011.116) * [-1004.306] (-1009.573) (-1006.162) (-1010.108) -- 0:00:41
377500 -- (-1003.262) (-1007.362) (-1003.623) [-1005.270] * [-1007.533] (-1007.839) (-1007.476) (-1008.794) -- 0:00:41
378000 -- (-1006.235) [-1004.936] (-1006.599) (-1005.056) * (-1003.900) [-1004.214] (-1004.640) (-1006.095) -- 0:00:41
378500 -- (-1005.661) (-1008.998) [-1006.794] (-1003.550) * (-1005.383) [-1004.266] (-1004.710) (-1007.840) -- 0:00:41
379000 -- [-1006.093] (-1006.968) (-1006.174) (-1003.762) * (-1006.284) [-1003.961] (-1004.877) (-1004.989) -- 0:00:40
379500 -- (-1004.243) [-1006.812] (-1008.909) (-1003.256) * (-1006.531) (-1004.670) (-1004.329) [-1004.189] -- 0:00:40
380000 -- (-1004.283) [-1007.572] (-1008.578) (-1005.104) * (-1008.777) (-1006.604) [-1004.360] (-1003.183) -- 0:00:40
Average standard deviation of split frequencies: 0.010836
380500 -- (-1004.728) (-1007.004) [-1004.705] (-1003.811) * [-1005.528] (-1006.049) (-1003.756) (-1003.183) -- 0:00:40
381000 -- (-1004.561) (-1006.743) (-1009.343) [-1004.979] * (-1003.844) (-1005.959) (-1005.322) [-1003.101] -- 0:00:40
381500 -- [-1005.104] (-1007.147) (-1007.235) (-1007.310) * (-1005.084) [-1004.280] (-1004.243) (-1005.195) -- 0:00:40
382000 -- (-1005.988) [-1003.453] (-1005.068) (-1005.404) * (-1007.767) [-1006.717] (-1003.875) (-1003.571) -- 0:00:40
382500 -- [-1004.112] (-1007.494) (-1003.893) (-1004.928) * (-1006.280) [-1004.749] (-1005.181) (-1005.103) -- 0:00:40
383000 -- [-1004.463] (-1009.176) (-1006.471) (-1004.759) * [-1006.562] (-1004.370) (-1003.702) (-1009.756) -- 0:00:40
383500 -- (-1006.592) (-1006.102) [-1006.486] (-1005.107) * [-1005.535] (-1006.577) (-1003.808) (-1005.857) -- 0:00:40
384000 -- [-1004.481] (-1004.605) (-1005.404) (-1006.171) * [-1005.718] (-1005.074) (-1003.808) (-1004.870) -- 0:00:40
384500 -- (-1004.215) [-1005.851] (-1003.711) (-1005.849) * (-1006.230) [-1004.996] (-1003.849) (-1005.135) -- 0:00:40
385000 -- (-1004.635) (-1003.334) [-1007.295] (-1007.959) * [-1004.286] (-1004.305) (-1006.783) (-1004.855) -- 0:00:39
Average standard deviation of split frequencies: 0.010632
385500 -- (-1005.436) (-1004.279) [-1005.180] (-1009.542) * (-1006.314) (-1004.680) [-1005.070] (-1008.626) -- 0:00:39
386000 -- (-1006.684) (-1003.952) (-1006.288) [-1004.405] * (-1004.708) (-1004.441) [-1006.155] (-1006.594) -- 0:00:39
386500 -- [-1005.415] (-1004.971) (-1004.989) (-1006.503) * (-1004.709) [-1005.581] (-1003.766) (-1003.426) -- 0:00:39
387000 -- (-1004.707) (-1004.920) (-1003.486) [-1003.459] * [-1005.027] (-1004.351) (-1005.436) (-1005.783) -- 0:00:41
387500 -- (-1004.359) (-1005.088) (-1004.861) [-1003.575] * (-1006.226) (-1005.981) [-1005.644] (-1008.431) -- 0:00:41
388000 -- (-1004.116) (-1006.816) [-1006.129] (-1004.939) * (-1009.511) (-1006.082) [-1007.818] (-1009.273) -- 0:00:41
388500 -- (-1005.569) (-1004.342) (-1004.552) [-1004.326] * (-1005.514) (-1007.916) (-1005.562) [-1004.784] -- 0:00:40
389000 -- (-1004.404) [-1005.203] (-1011.569) (-1006.537) * (-1004.089) (-1004.882) (-1004.648) [-1005.724] -- 0:00:40
389500 -- (-1006.630) (-1011.021) [-1007.816] (-1005.434) * (-1003.319) (-1004.231) [-1005.634] (-1006.330) -- 0:00:40
390000 -- [-1004.155] (-1010.224) (-1007.545) (-1006.212) * (-1003.875) (-1010.982) (-1005.981) [-1003.763] -- 0:00:40
Average standard deviation of split frequencies: 0.011388
390500 -- [-1006.528] (-1007.934) (-1006.851) (-1006.538) * (-1006.177) [-1006.336] (-1007.696) (-1008.245) -- 0:00:40
391000 -- (-1004.716) (-1007.102) (-1004.269) [-1006.649] * (-1006.663) [-1005.805] (-1012.971) (-1006.086) -- 0:00:40
391500 -- (-1005.812) [-1011.289] (-1006.105) (-1005.100) * (-1005.864) [-1004.318] (-1006.656) (-1006.890) -- 0:00:40
392000 -- (-1007.643) (-1008.381) [-1005.316] (-1004.103) * [-1004.850] (-1004.987) (-1005.560) (-1004.957) -- 0:00:40
392500 -- (-1003.639) [-1005.054] (-1005.863) (-1004.847) * (-1009.411) (-1005.394) [-1006.839] (-1009.704) -- 0:00:40
393000 -- (-1003.528) [-1007.175] (-1004.047) (-1005.430) * (-1005.530) [-1005.259] (-1010.339) (-1006.382) -- 0:00:40
393500 -- (-1005.483) [-1006.022] (-1004.303) (-1007.539) * (-1005.427) (-1007.396) [-1009.206] (-1008.129) -- 0:00:40
394000 -- (-1009.363) (-1005.821) [-1004.341] (-1004.472) * (-1005.263) (-1004.123) (-1006.809) [-1005.599] -- 0:00:39
394500 -- (-1008.183) [-1003.345] (-1003.828) (-1004.045) * (-1009.576) (-1004.776) [-1004.195] (-1006.846) -- 0:00:39
395000 -- (-1008.051) [-1004.169] (-1005.980) (-1003.407) * [-1006.992] (-1003.998) (-1004.582) (-1004.547) -- 0:00:39
Average standard deviation of split frequencies: 0.011458
395500 -- [-1004.157] (-1005.393) (-1008.205) (-1003.342) * (-1005.959) (-1004.310) [-1005.037] (-1005.706) -- 0:00:39
396000 -- (-1004.479) [-1004.472] (-1004.828) (-1003.147) * (-1010.621) (-1005.371) (-1005.034) [-1003.188] -- 0:00:39
396500 -- (-1004.239) [-1006.967] (-1004.316) (-1005.425) * [-1006.841] (-1006.289) (-1006.452) (-1007.095) -- 0:00:39
397000 -- [-1004.670] (-1003.522) (-1005.024) (-1009.413) * (-1005.487) (-1005.421) (-1004.004) [-1007.739] -- 0:00:39
397500 -- (-1004.986) [-1005.551] (-1005.608) (-1009.669) * (-1003.338) (-1004.790) [-1003.547] (-1006.574) -- 0:00:39
398000 -- (-1004.569) (-1004.779) [-1010.590] (-1003.520) * (-1006.045) [-1004.671] (-1003.952) (-1004.409) -- 0:00:39
398500 -- (-1004.403) [-1003.526] (-1005.800) (-1004.139) * (-1007.050) (-1007.696) (-1008.532) [-1004.202] -- 0:00:39
399000 -- (-1006.874) (-1003.938) (-1006.674) [-1006.724] * (-1005.927) (-1004.019) [-1005.555] (-1004.675) -- 0:00:39
399500 -- [-1004.317] (-1004.873) (-1004.732) (-1006.564) * (-1003.296) (-1005.865) (-1007.803) [-1004.910] -- 0:00:39
400000 -- (-1006.491) [-1008.475] (-1005.009) (-1006.053) * (-1005.890) (-1004.541) (-1010.651) [-1005.921] -- 0:00:39
Average standard deviation of split frequencies: 0.012133
400500 -- (-1005.933) (-1004.279) [-1005.126] (-1007.888) * (-1008.406) (-1005.790) [-1010.644] (-1006.185) -- 0:00:38
401000 -- (-1005.776) (-1004.654) (-1005.105) [-1009.191] * (-1006.463) (-1007.820) (-1007.379) [-1008.171] -- 0:00:38
401500 -- [-1004.889] (-1004.633) (-1003.769) (-1009.291) * (-1006.976) (-1006.343) [-1003.517] (-1004.024) -- 0:00:38
402000 -- (-1007.312) (-1005.230) [-1006.599] (-1007.318) * (-1005.031) (-1005.606) (-1004.684) [-1005.951] -- 0:00:38
402500 -- (-1004.071) (-1009.382) [-1004.171] (-1004.674) * (-1006.307) (-1005.009) (-1005.548) [-1005.243] -- 0:00:38
403000 -- (-1005.610) (-1005.393) (-1004.505) [-1006.190] * (-1004.479) (-1006.099) [-1005.250] (-1005.006) -- 0:00:38
403500 -- [-1005.786] (-1003.606) (-1006.305) (-1003.607) * (-1005.421) (-1005.451) [-1004.060] (-1007.225) -- 0:00:39
404000 -- (-1005.351) [-1003.723] (-1004.938) (-1004.283) * (-1004.341) (-1004.585) [-1005.455] (-1003.754) -- 0:00:39
404500 -- [-1005.015] (-1004.837) (-1007.321) (-1009.495) * (-1006.799) [-1005.129] (-1011.400) (-1005.835) -- 0:00:39
405000 -- [-1004.581] (-1004.585) (-1006.848) (-1004.892) * (-1007.387) (-1004.817) (-1008.607) [-1005.085] -- 0:00:39
Average standard deviation of split frequencies: 0.012191
405500 -- [-1005.587] (-1004.632) (-1014.972) (-1005.357) * (-1007.161) (-1007.576) (-1008.211) [-1004.603] -- 0:00:39
406000 -- [-1005.461] (-1005.485) (-1014.899) (-1003.758) * (-1003.993) [-1010.129] (-1005.938) (-1005.323) -- 0:00:39
406500 -- [-1006.335] (-1007.039) (-1017.438) (-1006.756) * [-1003.526] (-1007.079) (-1004.833) (-1006.383) -- 0:00:39
407000 -- (-1007.298) (-1009.313) [-1005.610] (-1005.092) * [-1003.923] (-1005.496) (-1006.538) (-1010.242) -- 0:00:39
407500 -- [-1008.098] (-1006.636) (-1005.484) (-1005.733) * [-1003.531] (-1006.367) (-1005.747) (-1005.049) -- 0:00:39
408000 -- (-1007.036) (-1004.863) [-1009.588] (-1006.838) * (-1003.788) (-1007.043) (-1005.011) [-1005.339] -- 0:00:39
408500 -- (-1005.140) (-1005.352) (-1009.580) [-1006.582] * (-1005.314) (-1004.607) [-1009.188] (-1003.656) -- 0:00:39
409000 -- (-1005.473) (-1005.579) (-1005.531) [-1006.856] * (-1005.577) [-1004.754] (-1006.510) (-1003.549) -- 0:00:39
409500 -- (-1007.703) (-1009.447) [-1004.690] (-1007.166) * (-1006.242) (-1007.024) (-1005.071) [-1004.395] -- 0:00:38
410000 -- (-1006.267) [-1009.372] (-1005.645) (-1007.664) * (-1006.493) [-1006.411] (-1007.514) (-1003.998) -- 0:00:38
Average standard deviation of split frequencies: 0.012340
410500 -- (-1003.906) [-1006.780] (-1006.524) (-1006.429) * [-1004.272] (-1007.261) (-1004.942) (-1004.359) -- 0:00:38
411000 -- (-1003.920) [-1005.678] (-1005.860) (-1006.761) * [-1006.033] (-1007.296) (-1005.130) (-1004.716) -- 0:00:38
411500 -- (-1004.518) (-1005.662) (-1005.823) [-1006.330] * (-1006.472) (-1007.804) (-1005.216) [-1005.601] -- 0:00:38
412000 -- (-1004.864) (-1009.931) (-1004.179) [-1005.225] * (-1005.089) (-1005.192) [-1004.535] (-1009.333) -- 0:00:38
412500 -- (-1004.882) [-1007.866] (-1005.111) (-1005.302) * (-1007.106) [-1007.601] (-1004.818) (-1008.803) -- 0:00:38
413000 -- (-1003.253) [-1005.568] (-1005.274) (-1005.182) * (-1005.257) (-1006.118) [-1005.339] (-1006.461) -- 0:00:38
413500 -- (-1004.140) [-1007.375] (-1006.530) (-1003.991) * (-1006.662) [-1007.021] (-1004.796) (-1007.775) -- 0:00:38
414000 -- (-1004.599) [-1004.713] (-1005.978) (-1003.486) * (-1005.439) (-1006.986) [-1005.277] (-1006.912) -- 0:00:38
414500 -- [-1006.499] (-1006.995) (-1004.569) (-1003.468) * (-1004.136) (-1004.568) (-1007.420) [-1006.508] -- 0:00:38
415000 -- (-1003.815) (-1004.452) [-1003.201] (-1004.327) * [-1007.965] (-1005.263) (-1004.813) (-1005.511) -- 0:00:38
Average standard deviation of split frequencies: 0.012890
415500 -- (-1006.379) [-1003.927] (-1006.652) (-1003.554) * (-1004.951) [-1003.917] (-1011.014) (-1005.076) -- 0:00:37
416000 -- [-1005.188] (-1007.330) (-1004.861) (-1003.401) * (-1006.236) (-1004.836) [-1010.019] (-1004.138) -- 0:00:37
416500 -- (-1007.302) (-1005.872) [-1006.793] (-1009.749) * [-1005.322] (-1005.544) (-1008.517) (-1007.134) -- 0:00:37
417000 -- (-1008.597) [-1006.378] (-1006.431) (-1004.744) * (-1004.410) [-1005.528] (-1007.900) (-1003.357) -- 0:00:37
417500 -- [-1005.717] (-1005.959) (-1005.846) (-1003.743) * (-1007.845) (-1005.455) [-1004.679] (-1004.516) -- 0:00:37
418000 -- (-1003.458) (-1005.989) [-1004.720] (-1006.118) * (-1006.604) (-1008.327) [-1005.644] (-1007.232) -- 0:00:37
418500 -- (-1003.547) [-1004.707] (-1005.105) (-1003.602) * [-1007.904] (-1004.109) (-1005.475) (-1008.461) -- 0:00:37
419000 -- (-1004.194) [-1005.523] (-1004.997) (-1008.956) * (-1010.623) [-1005.311] (-1003.659) (-1003.771) -- 0:00:37
419500 -- [-1008.484] (-1006.398) (-1008.008) (-1005.397) * [-1007.612] (-1005.323) (-1007.223) (-1004.253) -- 0:00:38
420000 -- [-1004.852] (-1006.533) (-1005.085) (-1006.134) * (-1005.310) (-1003.594) [-1003.982] (-1005.354) -- 0:00:38
Average standard deviation of split frequencies: 0.012607
420500 -- (-1006.288) (-1004.851) (-1005.250) [-1003.569] * (-1007.993) [-1004.043] (-1007.848) (-1004.550) -- 0:00:38
421000 -- (-1003.323) [-1004.959] (-1006.475) (-1004.814) * (-1005.472) (-1009.305) [-1007.792] (-1008.723) -- 0:00:38
421500 -- (-1003.270) (-1008.451) [-1005.480] (-1005.450) * (-1004.738) (-1004.647) (-1005.072) [-1005.807] -- 0:00:38
422000 -- (-1004.159) (-1006.961) [-1008.846] (-1003.774) * (-1005.275) (-1008.880) (-1006.299) [-1004.838] -- 0:00:38
422500 -- (-1005.660) (-1004.270) [-1004.992] (-1006.538) * (-1005.035) (-1005.267) [-1007.073] (-1005.319) -- 0:00:38
423000 -- (-1006.490) (-1004.083) (-1005.841) [-1006.527] * (-1004.947) [-1005.913] (-1007.406) (-1006.581) -- 0:00:38
423500 -- (-1006.421) [-1004.852] (-1004.050) (-1006.139) * (-1004.935) [-1005.923] (-1004.529) (-1006.650) -- 0:00:38
424000 -- (-1006.578) [-1004.827] (-1007.395) (-1004.142) * (-1007.323) (-1004.359) [-1004.828] (-1005.864) -- 0:00:38
424500 -- (-1004.128) [-1003.747] (-1007.847) (-1003.503) * (-1006.363) (-1004.749) (-1005.860) [-1004.885] -- 0:00:37
425000 -- (-1003.687) (-1007.817) (-1007.200) [-1007.628] * (-1009.479) (-1003.881) (-1005.248) [-1004.293] -- 0:00:37
Average standard deviation of split frequencies: 0.012933
425500 -- (-1004.833) (-1009.089) [-1004.280] (-1007.719) * (-1007.000) (-1005.076) [-1004.377] (-1004.454) -- 0:00:37
426000 -- (-1007.301) (-1005.029) [-1004.669] (-1007.282) * [-1003.893] (-1004.206) (-1011.655) (-1010.075) -- 0:00:37
426500 -- [-1006.643] (-1007.027) (-1004.938) (-1004.613) * [-1003.483] (-1004.296) (-1004.812) (-1006.934) -- 0:00:37
427000 -- (-1005.872) (-1008.080) (-1007.831) [-1009.947] * [-1004.559] (-1003.933) (-1007.015) (-1003.712) -- 0:00:37
427500 -- (-1007.205) (-1005.142) [-1005.861] (-1005.402) * (-1005.452) (-1006.795) (-1005.279) [-1005.466] -- 0:00:37
428000 -- [-1004.000] (-1011.202) (-1004.313) (-1007.436) * (-1006.140) [-1004.467] (-1005.316) (-1005.791) -- 0:00:37
428500 -- (-1006.671) (-1003.991) [-1004.885] (-1004.579) * (-1006.698) (-1003.860) [-1004.756] (-1005.574) -- 0:00:37
429000 -- [-1005.039] (-1004.316) (-1006.440) (-1004.572) * (-1006.863) (-1004.970) [-1003.911] (-1005.006) -- 0:00:37
429500 -- [-1004.488] (-1005.320) (-1007.681) (-1005.430) * (-1009.371) (-1005.629) (-1005.375) [-1005.261] -- 0:00:37
430000 -- (-1004.528) (-1005.597) [-1004.387] (-1004.170) * [-1006.581] (-1006.957) (-1006.291) (-1006.813) -- 0:00:37
Average standard deviation of split frequencies: 0.012656
430500 -- [-1005.068] (-1006.015) (-1005.534) (-1003.810) * (-1009.108) (-1016.471) (-1006.984) [-1006.666] -- 0:00:37
431000 -- [-1005.992] (-1006.480) (-1005.549) (-1005.899) * [-1005.643] (-1011.063) (-1005.444) (-1004.605) -- 0:00:36
431500 -- (-1009.927) (-1004.767) (-1008.420) [-1006.578] * (-1004.435) (-1009.567) (-1005.999) [-1006.997] -- 0:00:36
432000 -- (-1006.568) (-1005.973) (-1008.260) [-1005.332] * (-1004.059) (-1006.422) (-1007.034) [-1007.012] -- 0:00:36
432500 -- [-1005.501] (-1006.526) (-1007.305) (-1005.385) * [-1004.508] (-1003.884) (-1008.912) (-1003.173) -- 0:00:36
433000 -- (-1007.050) (-1005.412) [-1004.638] (-1006.388) * (-1005.439) [-1004.915] (-1005.247) (-1004.656) -- 0:00:36
433500 -- (-1007.330) (-1004.418) (-1008.918) [-1005.971] * [-1003.721] (-1003.825) (-1004.198) (-1009.474) -- 0:00:36
434000 -- (-1008.532) [-1003.705] (-1003.306) (-1006.200) * (-1004.009) (-1005.962) [-1004.421] (-1009.936) -- 0:00:36
434500 -- [-1006.253] (-1003.949) (-1007.603) (-1006.291) * (-1004.419) [-1006.030] (-1004.081) (-1004.201) -- 0:00:36
435000 -- (-1006.109) [-1004.026] (-1005.542) (-1004.266) * [-1004.637] (-1004.665) (-1004.128) (-1006.259) -- 0:00:36
Average standard deviation of split frequencies: 0.013515
435500 -- (-1003.887) [-1005.540] (-1008.611) (-1005.561) * [-1004.600] (-1004.356) (-1006.255) (-1007.061) -- 0:00:37
436000 -- (-1003.905) [-1004.343] (-1005.361) (-1003.586) * (-1010.183) (-1007.146) (-1007.616) [-1005.019] -- 0:00:37
436500 -- (-1003.571) (-1006.994) (-1003.991) [-1003.441] * (-1010.774) (-1005.212) [-1005.188] (-1007.849) -- 0:00:37
437000 -- (-1004.430) (-1007.947) [-1003.910] (-1003.949) * (-1004.382) [-1004.861] (-1007.589) (-1007.942) -- 0:00:37
437500 -- (-1005.934) [-1007.700] (-1003.947) (-1006.494) * (-1004.260) (-1005.857) (-1007.162) [-1006.658] -- 0:00:37
438000 -- [-1005.573] (-1005.444) (-1004.698) (-1010.076) * (-1003.321) (-1005.451) (-1009.099) [-1005.316] -- 0:00:37
438500 -- (-1007.564) (-1005.489) (-1007.018) [-1006.122] * [-1003.483] (-1008.301) (-1008.472) (-1007.926) -- 0:00:37
439000 -- (-1007.549) [-1004.546] (-1007.454) (-1004.996) * (-1005.686) [-1003.542] (-1006.182) (-1008.005) -- 0:00:37
439500 -- (-1004.738) (-1006.094) (-1004.168) [-1003.991] * (-1003.668) (-1004.331) [-1006.216] (-1008.094) -- 0:00:36
440000 -- (-1009.483) (-1011.650) [-1007.056] (-1004.048) * (-1003.359) [-1004.150] (-1004.677) (-1004.637) -- 0:00:36
Average standard deviation of split frequencies: 0.014174
440500 -- (-1006.866) (-1005.563) [-1004.033] (-1005.695) * [-1007.177] (-1003.887) (-1004.945) (-1005.689) -- 0:00:36
441000 -- [-1004.222] (-1005.452) (-1005.608) (-1005.291) * (-1005.350) (-1006.931) (-1005.079) [-1004.885] -- 0:00:36
441500 -- [-1006.188] (-1005.265) (-1005.315) (-1005.014) * [-1003.789] (-1007.584) (-1005.683) (-1004.705) -- 0:00:36
442000 -- (-1005.921) (-1005.964) (-1003.955) [-1005.616] * [-1008.982] (-1003.773) (-1006.505) (-1006.449) -- 0:00:36
442500 -- (-1005.377) (-1005.138) [-1004.488] (-1005.617) * (-1006.016) (-1005.901) (-1007.751) [-1004.884] -- 0:00:36
443000 -- (-1004.876) [-1003.236] (-1006.050) (-1003.581) * (-1007.441) [-1005.757] (-1006.722) (-1006.784) -- 0:00:36
443500 -- (-1004.484) (-1007.437) (-1003.776) [-1005.394] * [-1012.009] (-1006.858) (-1008.450) (-1008.330) -- 0:00:36
444000 -- (-1005.262) [-1005.846] (-1003.294) (-1004.717) * (-1012.086) [-1004.217] (-1008.991) (-1007.337) -- 0:00:36
444500 -- (-1006.496) (-1003.866) [-1004.237] (-1005.320) * (-1006.092) (-1003.818) [-1006.451] (-1009.205) -- 0:00:36
445000 -- (-1007.854) (-1005.723) (-1003.568) [-1006.718] * (-1007.393) (-1004.889) (-1006.111) [-1007.661] -- 0:00:36
Average standard deviation of split frequencies: 0.014930
445500 -- (-1007.079) (-1005.709) [-1004.606] (-1009.306) * [-1006.583] (-1004.161) (-1004.378) (-1005.739) -- 0:00:36
446000 -- (-1005.958) (-1006.198) (-1004.035) [-1005.242] * (-1008.781) [-1007.975] (-1004.319) (-1007.164) -- 0:00:36
446500 -- (-1004.508) [-1004.834] (-1005.978) (-1005.679) * (-1005.785) (-1008.784) [-1005.026] (-1006.585) -- 0:00:35
447000 -- [-1004.420] (-1004.445) (-1006.011) (-1006.023) * (-1004.675) (-1006.413) [-1004.022] (-1006.377) -- 0:00:35
447500 -- (-1012.107) (-1004.222) (-1008.014) [-1004.124] * (-1004.769) (-1003.360) [-1004.061] (-1005.010) -- 0:00:35
448000 -- (-1007.593) [-1005.872] (-1008.245) (-1003.381) * [-1004.801] (-1007.023) (-1005.107) (-1004.287) -- 0:00:35
448500 -- (-1007.591) (-1006.351) (-1004.553) [-1004.450] * (-1006.395) (-1004.492) [-1008.957] (-1006.387) -- 0:00:35
449000 -- (-1011.045) (-1003.494) [-1004.707] (-1003.571) * [-1004.458] (-1003.940) (-1009.794) (-1005.731) -- 0:00:35
449500 -- (-1005.810) (-1007.568) (-1004.638) [-1005.057] * (-1009.984) (-1003.598) [-1008.761] (-1006.450) -- 0:00:35
450000 -- (-1012.411) (-1006.533) (-1005.784) [-1008.536] * (-1005.604) (-1005.790) (-1006.427) [-1007.153] -- 0:00:35
Average standard deviation of split frequencies: 0.015756
450500 -- (-1005.529) [-1005.391] (-1008.607) (-1003.637) * (-1007.286) [-1005.166] (-1003.361) (-1005.220) -- 0:00:35
451000 -- (-1004.570) (-1006.321) (-1006.178) [-1007.200] * (-1006.165) (-1007.257) [-1003.626] (-1005.321) -- 0:00:35
451500 -- [-1007.675] (-1004.829) (-1005.238) (-1007.526) * (-1007.321) (-1004.736) [-1003.495] (-1006.266) -- 0:00:35
452000 -- [-1004.705] (-1005.508) (-1008.006) (-1006.433) * (-1010.355) (-1005.769) [-1003.244] (-1005.391) -- 0:00:36
452500 -- (-1006.135) (-1004.540) [-1006.263] (-1005.079) * (-1013.180) (-1004.942) [-1003.207] (-1005.045) -- 0:00:36
453000 -- [-1005.644] (-1007.233) (-1008.051) (-1004.319) * (-1006.762) (-1004.744) [-1005.182] (-1009.287) -- 0:00:36
453500 -- (-1006.828) (-1005.770) (-1010.985) [-1004.817] * (-1005.698) (-1004.209) [-1006.410] (-1009.810) -- 0:00:36
454000 -- (-1003.999) (-1005.734) [-1007.204] (-1003.438) * (-1004.617) (-1007.644) (-1006.533) [-1006.793] -- 0:00:36
454500 -- (-1006.688) [-1003.730] (-1008.460) (-1004.547) * [-1004.618] (-1007.484) (-1007.057) (-1006.390) -- 0:00:36
455000 -- (-1007.758) (-1008.023) [-1006.101] (-1004.747) * (-1004.642) (-1004.742) [-1007.236] (-1005.981) -- 0:00:35
Average standard deviation of split frequencies: 0.016153
455500 -- (-1006.239) (-1006.770) [-1004.698] (-1003.292) * [-1009.939] (-1006.097) (-1007.223) (-1006.467) -- 0:00:35
456000 -- (-1005.679) (-1007.622) [-1004.913] (-1004.642) * (-1010.204) [-1006.758] (-1005.037) (-1003.490) -- 0:00:35
456500 -- [-1003.533] (-1008.802) (-1005.089) (-1006.446) * (-1005.949) (-1007.395) (-1004.670) [-1003.709] -- 0:00:35
457000 -- (-1006.324) [-1007.904] (-1005.635) (-1004.610) * (-1005.042) (-1005.355) (-1006.077) [-1008.911] -- 0:00:35
457500 -- (-1007.041) [-1007.459] (-1005.276) (-1009.047) * (-1006.465) (-1006.762) (-1004.577) [-1007.882] -- 0:00:35
458000 -- (-1006.558) (-1005.365) [-1004.114] (-1007.107) * (-1006.930) [-1004.657] (-1004.610) (-1005.998) -- 0:00:35
458500 -- (-1007.813) (-1009.291) (-1006.385) [-1006.693] * (-1006.634) (-1005.084) [-1003.611] (-1005.730) -- 0:00:35
459000 -- (-1006.503) (-1008.567) (-1008.617) [-1007.450] * (-1004.993) (-1005.405) (-1005.447) [-1005.757] -- 0:00:35
459500 -- (-1009.861) (-1007.844) (-1010.648) [-1005.758] * (-1009.090) (-1005.813) (-1007.735) [-1003.671] -- 0:00:35
460000 -- (-1006.485) (-1005.270) (-1006.610) [-1008.862] * [-1004.512] (-1010.917) (-1005.165) (-1008.396) -- 0:00:35
Average standard deviation of split frequencies: 0.016437
460500 -- (-1005.141) (-1003.656) (-1006.500) [-1003.621] * [-1005.808] (-1006.522) (-1004.917) (-1007.230) -- 0:00:35
461000 -- (-1010.497) (-1004.547) (-1005.902) [-1004.407] * [-1004.922] (-1008.907) (-1007.926) (-1007.916) -- 0:00:35
461500 -- [-1008.555] (-1008.213) (-1003.935) (-1008.300) * (-1004.245) (-1004.936) [-1007.072] (-1005.273) -- 0:00:35
462000 -- [-1006.226] (-1008.201) (-1004.081) (-1007.686) * (-1013.011) [-1003.371] (-1004.077) (-1006.894) -- 0:00:34
462500 -- (-1004.724) [-1006.377] (-1005.112) (-1005.688) * (-1007.525) (-1006.231) [-1005.631] (-1007.318) -- 0:00:34
463000 -- [-1007.623] (-1004.203) (-1006.320) (-1005.234) * (-1006.404) (-1006.349) (-1005.410) [-1007.788] -- 0:00:34
463500 -- (-1006.043) (-1004.901) (-1004.400) [-1005.529] * (-1005.018) [-1004.197] (-1004.960) (-1006.701) -- 0:00:34
464000 -- (-1005.777) (-1007.369) (-1003.826) [-1005.549] * (-1007.230) [-1004.770] (-1004.437) (-1007.094) -- 0:00:34
464500 -- (-1011.118) [-1005.245] (-1006.172) (-1005.496) * (-1004.825) [-1004.996] (-1005.877) (-1003.977) -- 0:00:34
465000 -- (-1009.246) [-1004.408] (-1007.242) (-1007.240) * (-1010.332) (-1005.531) (-1005.470) [-1006.352] -- 0:00:34
Average standard deviation of split frequencies: 0.017007
465500 -- [-1006.375] (-1003.974) (-1005.202) (-1005.445) * [-1004.845] (-1010.108) (-1003.460) (-1004.956) -- 0:00:34
466000 -- (-1005.250) (-1003.528) (-1004.345) [-1004.618] * (-1007.681) (-1007.494) [-1005.414] (-1003.731) -- 0:00:34
466500 -- (-1005.015) (-1006.577) [-1004.098] (-1004.929) * (-1006.551) (-1008.686) (-1004.738) [-1008.112] -- 0:00:34
467000 -- (-1005.747) [-1003.561] (-1004.863) (-1007.470) * [-1004.748] (-1007.845) (-1006.221) (-1006.531) -- 0:00:34
467500 -- (-1006.352) [-1003.399] (-1005.035) (-1003.598) * (-1005.038) (-1006.187) [-1008.349] (-1005.165) -- 0:00:34
468000 -- [-1003.970] (-1004.674) (-1008.002) (-1008.773) * [-1003.953] (-1006.358) (-1009.777) (-1004.249) -- 0:00:34
468500 -- (-1004.111) (-1006.152) [-1005.438] (-1005.212) * (-1005.410) [-1007.517] (-1006.781) (-1006.402) -- 0:00:35
469000 -- (-1004.518) (-1004.565) [-1004.882] (-1005.650) * (-1005.424) (-1009.402) (-1006.753) [-1003.737] -- 0:00:35
469500 -- [-1004.475] (-1004.529) (-1005.796) (-1003.859) * (-1004.583) [-1009.078] (-1006.491) (-1004.202) -- 0:00:35
470000 -- [-1005.587] (-1005.637) (-1007.537) (-1005.096) * (-1003.582) (-1008.203) [-1003.690] (-1007.573) -- 0:00:34
Average standard deviation of split frequencies: 0.016964
470500 -- [-1006.482] (-1008.047) (-1006.168) (-1005.792) * (-1007.313) (-1003.817) (-1005.497) [-1006.515] -- 0:00:34
471000 -- (-1006.380) (-1004.862) [-1007.281] (-1005.942) * [-1003.960] (-1006.793) (-1006.960) (-1009.017) -- 0:00:34
471500 -- [-1007.645] (-1006.713) (-1004.602) (-1005.986) * (-1004.401) (-1004.521) [-1004.102] (-1007.946) -- 0:00:34
472000 -- (-1006.045) (-1006.863) (-1006.972) [-1008.500] * (-1008.134) [-1003.948] (-1005.649) (-1005.461) -- 0:00:34
472500 -- (-1007.922) (-1006.588) (-1006.299) [-1005.294] * [-1004.288] (-1003.639) (-1006.184) (-1004.875) -- 0:00:34
473000 -- [-1007.698] (-1007.456) (-1005.462) (-1005.067) * (-1003.917) (-1005.445) [-1004.432] (-1004.829) -- 0:00:34
473500 -- (-1005.899) (-1005.843) (-1004.489) [-1007.259] * (-1007.017) (-1004.474) [-1004.909] (-1004.861) -- 0:00:34
474000 -- (-1004.269) [-1006.278] (-1004.578) (-1007.020) * [-1005.542] (-1005.057) (-1005.937) (-1004.654) -- 0:00:34
474500 -- (-1005.703) (-1006.632) (-1006.199) [-1004.000] * [-1003.856] (-1004.851) (-1004.659) (-1008.510) -- 0:00:34
475000 -- (-1004.535) (-1006.410) [-1008.020] (-1004.789) * (-1004.458) [-1005.887] (-1004.440) (-1008.726) -- 0:00:34
Average standard deviation of split frequencies: 0.016279
475500 -- (-1005.390) (-1006.317) (-1006.889) [-1009.286] * (-1004.989) [-1004.962] (-1009.848) (-1005.256) -- 0:00:34
476000 -- (-1004.344) (-1008.357) [-1005.207] (-1010.321) * [-1004.398] (-1007.690) (-1012.102) (-1005.347) -- 0:00:34
476500 -- [-1004.607] (-1008.035) (-1006.676) (-1010.938) * (-1003.502) [-1010.724] (-1011.500) (-1005.144) -- 0:00:34
477000 -- (-1004.706) (-1007.770) [-1005.022] (-1003.977) * [-1006.973] (-1004.893) (-1005.729) (-1007.347) -- 0:00:33
477500 -- (-1014.132) (-1005.019) [-1004.116] (-1003.838) * (-1006.381) (-1011.906) (-1005.085) [-1004.505] -- 0:00:33
478000 -- (-1007.662) (-1006.473) (-1004.846) [-1004.856] * (-1007.190) (-1005.406) [-1008.075] (-1008.130) -- 0:00:33
478500 -- (-1005.639) (-1003.761) [-1006.387] (-1004.856) * (-1003.862) (-1003.549) [-1005.858] (-1007.302) -- 0:00:33
479000 -- (-1005.651) (-1005.229) [-1006.174] (-1003.864) * (-1005.499) (-1005.355) [-1004.637] (-1004.473) -- 0:00:33
479500 -- (-1004.285) (-1004.344) [-1005.953] (-1009.603) * [-1003.934] (-1004.889) (-1004.048) (-1004.659) -- 0:00:33
480000 -- (-1005.177) (-1007.901) [-1005.720] (-1004.739) * (-1004.971) (-1008.478) (-1008.433) [-1004.691] -- 0:00:33
Average standard deviation of split frequencies: 0.016611
480500 -- (-1006.669) (-1004.099) [-1004.830] (-1004.481) * [-1006.720] (-1011.626) (-1004.227) (-1006.083) -- 0:00:33
481000 -- [-1003.321] (-1005.027) (-1005.706) (-1007.149) * [-1004.059] (-1003.816) (-1004.243) (-1007.358) -- 0:00:33
481500 -- (-1004.142) [-1005.340] (-1004.790) (-1011.886) * [-1004.707] (-1006.121) (-1005.873) (-1004.140) -- 0:00:33
482000 -- (-1007.080) [-1007.629] (-1005.770) (-1007.632) * (-1004.906) (-1008.028) (-1007.472) [-1005.508] -- 0:00:33
482500 -- [-1004.988] (-1006.958) (-1006.691) (-1005.189) * (-1005.667) (-1008.645) (-1008.381) [-1004.672] -- 0:00:33
483000 -- (-1005.570) (-1004.353) (-1005.168) [-1006.426] * (-1005.044) (-1005.298) (-1009.450) [-1004.273] -- 0:00:33
483500 -- (-1004.754) [-1004.033] (-1005.183) (-1006.617) * (-1004.740) (-1005.661) (-1006.288) [-1005.365] -- 0:00:33
484000 -- [-1005.065] (-1004.252) (-1003.407) (-1004.123) * [-1007.606] (-1004.005) (-1003.907) (-1005.578) -- 0:00:33
484500 -- (-1004.253) (-1003.948) [-1006.039] (-1003.703) * (-1007.761) (-1005.274) [-1005.788] (-1005.507) -- 0:00:32
485000 -- (-1004.368) (-1005.408) (-1007.282) [-1006.091] * [-1005.997] (-1006.572) (-1011.832) (-1005.966) -- 0:00:33
Average standard deviation of split frequencies: 0.016732
485500 -- (-1004.533) (-1007.523) [-1006.027] (-1005.082) * (-1005.781) [-1005.360] (-1006.998) (-1005.603) -- 0:00:33
486000 -- (-1003.821) (-1010.431) (-1004.228) [-1006.102] * (-1004.539) [-1004.761] (-1005.593) (-1004.844) -- 0:00:33
486500 -- (-1005.590) [-1007.036] (-1004.813) (-1006.999) * (-1004.596) [-1005.148] (-1007.662) (-1005.546) -- 0:00:33
487000 -- (-1007.700) (-1008.311) (-1003.970) [-1005.611] * (-1004.224) (-1005.128) (-1005.715) [-1005.561] -- 0:00:33
487500 -- (-1005.554) (-1004.692) [-1006.784] (-1004.485) * (-1004.241) (-1005.191) (-1007.131) [-1005.899] -- 0:00:33
488000 -- [-1004.651] (-1004.784) (-1005.742) (-1005.066) * (-1005.121) [-1004.734] (-1009.279) (-1007.893) -- 0:00:33
488500 -- [-1003.532] (-1003.839) (-1008.633) (-1007.649) * [-1005.280] (-1007.843) (-1004.917) (-1008.391) -- 0:00:33
489000 -- [-1005.226] (-1003.456) (-1005.743) (-1006.116) * (-1009.195) (-1005.432) [-1005.701] (-1008.417) -- 0:00:33
489500 -- (-1004.875) (-1005.521) [-1007.329] (-1006.536) * (-1006.873) (-1003.093) (-1006.750) [-1009.398] -- 0:00:33
490000 -- (-1004.257) (-1007.404) (-1003.903) [-1004.246] * (-1007.636) [-1003.585] (-1004.860) (-1004.320) -- 0:00:33
Average standard deviation of split frequencies: 0.017293
490500 -- (-1005.655) (-1015.123) [-1004.271] (-1004.579) * (-1006.278) (-1003.775) (-1005.795) [-1004.124] -- 0:00:33
491000 -- [-1005.486] (-1012.712) (-1005.786) (-1004.005) * (-1005.767) [-1003.365] (-1004.310) (-1010.016) -- 0:00:33
491500 -- (-1006.512) (-1007.663) [-1007.591] (-1003.805) * [-1008.003] (-1003.483) (-1008.391) (-1004.517) -- 0:00:33
492000 -- (-1007.095) (-1004.672) (-1004.452) [-1003.900] * (-1008.106) [-1003.457] (-1005.066) (-1004.218) -- 0:00:33
492500 -- (-1005.589) (-1004.774) [-1003.922] (-1004.218) * (-1006.022) (-1003.701) (-1004.205) [-1006.884] -- 0:00:32
493000 -- (-1005.106) (-1007.817) (-1004.299) [-1005.340] * (-1006.754) (-1008.233) (-1003.817) [-1008.468] -- 0:00:32
493500 -- (-1007.034) (-1006.206) [-1005.576] (-1004.696) * (-1005.301) [-1004.291] (-1004.966) (-1006.536) -- 0:00:32
494000 -- (-1006.690) (-1009.368) [-1005.576] (-1003.788) * (-1005.340) [-1003.152] (-1005.670) (-1007.031) -- 0:00:32
494500 -- (-1008.802) (-1005.263) (-1005.577) [-1007.240] * (-1004.605) [-1004.602] (-1003.434) (-1005.398) -- 0:00:32
495000 -- (-1010.338) (-1009.346) (-1003.753) [-1005.930] * [-1004.056] (-1003.768) (-1006.079) (-1003.829) -- 0:00:32
Average standard deviation of split frequencies: 0.016692
495500 -- (-1008.042) (-1004.695) (-1006.910) [-1004.668] * (-1004.828) [-1007.105] (-1009.491) (-1004.297) -- 0:00:32
496000 -- [-1004.305] (-1005.762) (-1011.140) (-1006.264) * (-1004.593) (-1004.701) (-1008.339) [-1007.296] -- 0:00:32
496500 -- (-1005.874) [-1004.608] (-1004.395) (-1004.925) * (-1006.066) [-1006.215] (-1006.434) (-1004.795) -- 0:00:32
497000 -- [-1003.426] (-1004.276) (-1004.531) (-1013.252) * [-1004.857] (-1006.582) (-1004.088) (-1004.297) -- 0:00:32
497500 -- [-1004.215] (-1003.556) (-1004.071) (-1003.354) * (-1005.349) (-1005.513) [-1003.846] (-1003.997) -- 0:00:32
498000 -- [-1003.265] (-1005.839) (-1006.670) (-1005.681) * (-1003.746) (-1006.006) [-1003.908] (-1005.298) -- 0:00:32
498500 -- (-1004.392) (-1003.553) (-1005.813) [-1004.525] * [-1003.327] (-1005.663) (-1012.043) (-1004.000) -- 0:00:32
499000 -- [-1004.200] (-1012.622) (-1004.398) (-1005.535) * (-1003.443) [-1005.595] (-1004.027) (-1008.408) -- 0:00:32
499500 -- [-1005.226] (-1004.518) (-1005.111) (-1004.716) * (-1006.183) (-1007.563) [-1004.008] (-1005.801) -- 0:00:32
500000 -- (-1005.223) (-1007.746) (-1005.246) [-1004.381] * (-1005.486) (-1007.010) [-1010.445] (-1004.605) -- 0:00:32
Average standard deviation of split frequencies: 0.015674
500500 -- (-1004.781) [-1004.633] (-1005.110) (-1007.551) * (-1004.138) [-1007.442] (-1008.765) (-1004.001) -- 0:00:31
501000 -- (-1004.886) [-1003.986] (-1003.361) (-1003.693) * (-1003.392) [-1006.906] (-1004.716) (-1004.265) -- 0:00:32
501500 -- [-1005.721] (-1006.012) (-1005.017) (-1005.510) * (-1005.339) (-1006.177) [-1004.151] (-1004.251) -- 0:00:32
502000 -- [-1005.894] (-1006.810) (-1006.062) (-1008.038) * (-1003.620) [-1006.106] (-1006.220) (-1005.933) -- 0:00:32
502500 -- (-1005.653) (-1005.163) (-1009.759) [-1004.161] * [-1003.530] (-1005.368) (-1007.410) (-1008.326) -- 0:00:32
503000 -- (-1004.838) (-1004.182) (-1006.084) [-1004.231] * (-1003.711) [-1004.462] (-1004.699) (-1007.970) -- 0:00:32
503500 -- (-1005.697) (-1004.104) (-1006.803) [-1005.501] * (-1004.295) (-1003.719) [-1004.941] (-1004.773) -- 0:00:32
504000 -- (-1007.600) (-1005.635) [-1003.463] (-1007.362) * [-1003.947] (-1003.821) (-1005.997) (-1004.431) -- 0:00:32
504500 -- [-1004.086] (-1006.431) (-1003.299) (-1004.993) * (-1004.994) (-1004.182) [-1007.868] (-1005.754) -- 0:00:32
505000 -- (-1009.409) (-1006.299) (-1003.366) [-1006.283] * (-1007.733) [-1005.046] (-1004.686) (-1007.420) -- 0:00:32
Average standard deviation of split frequencies: 0.015673
505500 -- [-1006.670] (-1005.451) (-1007.910) (-1010.498) * (-1004.338) (-1006.053) (-1007.432) [-1008.726] -- 0:00:32
506000 -- (-1007.621) [-1003.515] (-1005.212) (-1006.253) * (-1003.577) (-1005.465) [-1007.923] (-1008.992) -- 0:00:32
506500 -- [-1004.559] (-1007.352) (-1006.845) (-1004.105) * (-1003.456) (-1004.260) (-1004.703) [-1005.514] -- 0:00:32
507000 -- (-1007.601) [-1008.227] (-1004.733) (-1004.855) * [-1005.801] (-1005.558) (-1004.074) (-1007.429) -- 0:00:32
507500 -- (-1005.694) [-1006.335] (-1006.018) (-1003.407) * (-1006.602) (-1010.549) (-1003.490) [-1007.136] -- 0:00:32
508000 -- (-1007.990) (-1008.804) [-1003.927] (-1003.725) * [-1005.367] (-1006.179) (-1003.303) (-1007.437) -- 0:00:31
508500 -- (-1006.303) (-1008.181) (-1006.492) [-1006.293] * [-1003.538] (-1007.130) (-1005.042) (-1007.190) -- 0:00:31
509000 -- [-1004.551] (-1004.700) (-1007.013) (-1005.931) * (-1004.700) (-1005.942) (-1004.431) [-1004.511] -- 0:00:31
509500 -- [-1005.483] (-1006.204) (-1008.780) (-1005.511) * (-1006.753) (-1007.685) (-1003.637) [-1008.452] -- 0:00:31
510000 -- [-1006.697] (-1006.091) (-1006.622) (-1008.235) * [-1004.062] (-1006.351) (-1006.164) (-1007.645) -- 0:00:31
Average standard deviation of split frequencies: 0.015856
510500 -- (-1003.780) (-1004.921) (-1005.302) [-1004.666] * (-1005.908) (-1004.407) [-1005.627] (-1005.052) -- 0:00:31
511000 -- [-1003.828] (-1006.227) (-1003.653) (-1013.127) * (-1005.745) (-1004.218) [-1005.887] (-1004.344) -- 0:00:31
511500 -- (-1006.976) [-1004.463] (-1008.661) (-1009.379) * [-1003.396] (-1012.347) (-1011.002) (-1003.949) -- 0:00:31
512000 -- [-1006.912] (-1003.944) (-1003.498) (-1005.682) * (-1006.234) [-1010.289] (-1012.938) (-1005.885) -- 0:00:31
512500 -- (-1006.179) (-1006.579) [-1004.072] (-1009.139) * [-1004.618] (-1009.605) (-1006.553) (-1005.576) -- 0:00:31
513000 -- (-1009.739) (-1005.276) (-1003.304) [-1007.495] * [-1005.623] (-1003.911) (-1004.776) (-1010.439) -- 0:00:31
513500 -- (-1005.579) (-1006.461) (-1005.738) [-1006.444] * (-1007.701) (-1006.487) [-1004.060] (-1010.549) -- 0:00:31
514000 -- [-1005.202] (-1008.954) (-1005.458) (-1005.166) * [-1007.899] (-1007.574) (-1006.140) (-1005.443) -- 0:00:31
514500 -- (-1006.248) [-1007.945] (-1005.332) (-1003.951) * (-1008.850) (-1005.641) [-1006.346] (-1006.079) -- 0:00:31
515000 -- (-1004.800) [-1004.139] (-1007.122) (-1005.631) * (-1006.688) [-1007.113] (-1005.805) (-1003.349) -- 0:00:31
Average standard deviation of split frequencies: 0.016283
515500 -- (-1007.343) [-1004.660] (-1007.384) (-1008.065) * (-1007.340) [-1004.284] (-1009.610) (-1005.733) -- 0:00:31
516000 -- [-1005.428] (-1005.354) (-1007.422) (-1009.960) * (-1009.218) [-1004.410] (-1007.143) (-1007.868) -- 0:00:30
516500 -- (-1006.773) [-1004.028] (-1005.128) (-1005.907) * (-1006.983) (-1003.558) (-1005.417) [-1005.303] -- 0:00:30
517000 -- (-1006.816) (-1008.864) (-1005.175) [-1007.283] * (-1003.631) (-1003.735) [-1004.004] (-1007.357) -- 0:00:30
517500 -- (-1003.962) (-1010.819) (-1010.700) [-1008.016] * [-1005.678] (-1006.665) (-1006.068) (-1007.753) -- 0:00:31
518000 -- (-1006.983) [-1009.446] (-1008.243) (-1007.406) * (-1004.922) (-1006.696) (-1004.758) [-1013.652] -- 0:00:31
518500 -- (-1005.985) (-1004.743) [-1004.719] (-1010.676) * (-1006.425) [-1005.360] (-1007.663) (-1007.676) -- 0:00:31
519000 -- (-1006.927) (-1006.384) [-1006.676] (-1005.577) * (-1006.907) (-1004.758) (-1007.540) [-1006.171] -- 0:00:31
519500 -- [-1004.061] (-1005.490) (-1006.483) (-1003.946) * (-1005.325) (-1005.408) (-1007.292) [-1008.032] -- 0:00:31
520000 -- (-1005.064) (-1004.553) (-1004.627) [-1003.760] * [-1004.364] (-1004.978) (-1005.329) (-1005.505) -- 0:00:31
Average standard deviation of split frequencies: 0.016617
520500 -- (-1004.118) (-1008.957) (-1004.363) [-1004.636] * (-1004.469) (-1006.171) (-1004.508) [-1004.991] -- 0:00:31
521000 -- [-1003.912] (-1004.121) (-1009.624) (-1008.332) * (-1005.025) (-1004.428) (-1006.685) [-1004.683] -- 0:00:31
521500 -- (-1004.539) (-1003.633) [-1004.454] (-1005.044) * [-1004.553] (-1004.378) (-1009.780) (-1009.371) -- 0:00:31
522000 -- (-1005.587) (-1004.018) (-1009.522) [-1004.260] * [-1005.178] (-1004.437) (-1004.004) (-1003.727) -- 0:00:31
522500 -- [-1006.086] (-1005.943) (-1007.089) (-1004.353) * (-1004.451) (-1006.024) [-1006.000] (-1007.549) -- 0:00:31
523000 -- [-1006.668] (-1006.041) (-1007.988) (-1009.135) * (-1007.716) (-1008.562) (-1005.916) [-1006.860] -- 0:00:31
523500 -- (-1003.586) (-1006.118) (-1009.432) [-1009.346] * (-1003.633) [-1004.954] (-1009.550) (-1008.764) -- 0:00:30
524000 -- (-1007.277) (-1003.872) [-1007.023] (-1008.249) * (-1005.483) (-1004.480) (-1005.176) [-1005.236] -- 0:00:30
524500 -- (-1006.760) (-1003.899) (-1005.931) [-1004.507] * (-1005.839) [-1004.803] (-1006.550) (-1006.146) -- 0:00:30
525000 -- (-1005.325) (-1004.678) (-1004.422) [-1004.948] * [-1005.536] (-1006.615) (-1008.110) (-1007.679) -- 0:00:30
Average standard deviation of split frequencies: 0.016659
525500 -- [-1005.946] (-1008.153) (-1004.828) (-1005.163) * [-1007.444] (-1003.766) (-1009.074) (-1008.229) -- 0:00:30
526000 -- (-1005.226) (-1009.413) (-1004.827) [-1005.358] * [-1004.184] (-1006.194) (-1005.663) (-1009.315) -- 0:00:30
526500 -- (-1008.821) (-1004.488) (-1004.794) [-1006.165] * [-1003.558] (-1010.793) (-1005.169) (-1005.403) -- 0:00:30
527000 -- (-1005.851) [-1004.567] (-1007.000) (-1008.085) * [-1005.499] (-1005.357) (-1005.014) (-1004.082) -- 0:00:30
527500 -- (-1008.627) [-1007.143] (-1003.824) (-1004.306) * (-1011.338) [-1005.266] (-1003.920) (-1004.663) -- 0:00:30
528000 -- (-1005.891) [-1005.507] (-1006.907) (-1005.354) * (-1011.316) [-1005.307] (-1010.148) (-1006.099) -- 0:00:30
528500 -- (-1005.862) [-1003.954] (-1005.540) (-1004.206) * (-1004.026) [-1012.228] (-1003.744) (-1006.084) -- 0:00:30
529000 -- (-1009.254) (-1010.489) (-1004.246) [-1004.427] * (-1006.076) (-1005.610) [-1004.442] (-1004.159) -- 0:00:30
529500 -- (-1004.703) [-1003.491] (-1006.671) (-1006.984) * (-1005.808) (-1004.729) (-1008.860) [-1006.149] -- 0:00:30
530000 -- (-1005.741) (-1003.447) (-1008.834) [-1003.841] * [-1004.801] (-1004.593) (-1008.845) (-1006.734) -- 0:00:30
Average standard deviation of split frequencies: 0.015676
530500 -- [-1007.449] (-1010.457) (-1007.976) (-1006.871) * (-1006.414) (-1007.628) [-1008.739] (-1005.448) -- 0:00:30
531000 -- (-1007.705) [-1004.860] (-1005.873) (-1005.533) * (-1004.704) (-1004.121) (-1006.738) [-1006.833] -- 0:00:30
531500 -- (-1008.073) (-1005.315) [-1005.443] (-1004.782) * (-1006.696) (-1004.713) (-1009.531) [-1005.541] -- 0:00:29
532000 -- (-1003.973) (-1008.749) (-1005.039) [-1011.422] * (-1005.178) (-1005.482) (-1004.141) [-1007.462] -- 0:00:29
532500 -- (-1007.791) (-1005.141) [-1006.285] (-1006.335) * (-1004.000) (-1005.894) [-1006.066] (-1006.609) -- 0:00:29
533000 -- (-1005.384) (-1006.289) (-1004.337) [-1003.938] * [-1003.716] (-1006.568) (-1004.733) (-1004.835) -- 0:00:29
533500 -- [-1006.851] (-1005.058) (-1004.324) (-1005.149) * (-1003.737) (-1003.397) (-1004.772) [-1006.784] -- 0:00:29
534000 -- (-1005.636) [-1006.663] (-1004.005) (-1004.512) * (-1003.804) (-1003.366) [-1009.766] (-1007.064) -- 0:00:30
534500 -- (-1007.372) [-1005.243] (-1004.748) (-1004.004) * (-1003.425) (-1003.849) [-1003.723] (-1004.374) -- 0:00:30
535000 -- (-1008.137) (-1004.629) (-1003.937) [-1004.430] * [-1005.506] (-1005.045) (-1005.965) (-1003.309) -- 0:00:30
Average standard deviation of split frequencies: 0.016038
535500 -- [-1009.498] (-1003.436) (-1003.868) (-1006.812) * (-1004.864) [-1004.384] (-1003.803) (-1003.640) -- 0:00:30
536000 -- (-1008.504) (-1008.047) [-1004.700] (-1015.484) * (-1004.635) (-1003.409) (-1005.084) [-1006.060] -- 0:00:30
536500 -- (-1004.682) (-1008.946) [-1004.336] (-1011.848) * (-1004.237) (-1003.553) (-1006.322) [-1009.116] -- 0:00:30
537000 -- (-1004.546) (-1003.976) (-1004.746) [-1008.338] * (-1004.135) (-1004.089) [-1006.258] (-1004.914) -- 0:00:30
537500 -- (-1004.104) (-1004.034) [-1003.992] (-1010.568) * (-1005.345) (-1006.721) [-1006.541] (-1007.403) -- 0:00:30
538000 -- (-1006.009) [-1006.668] (-1004.265) (-1014.681) * (-1004.880) (-1006.394) [-1006.446] (-1007.197) -- 0:00:30
538500 -- (-1004.681) (-1005.910) [-1004.605] (-1004.652) * (-1004.166) (-1010.727) (-1004.700) [-1003.515] -- 0:00:29
539000 -- (-1006.369) [-1004.547] (-1004.468) (-1003.451) * (-1004.062) (-1005.158) [-1004.727] (-1005.928) -- 0:00:29
539500 -- [-1006.321] (-1003.784) (-1005.060) (-1004.611) * (-1004.148) (-1004.831) [-1004.721] (-1003.331) -- 0:00:29
540000 -- (-1006.416) (-1004.628) (-1004.989) [-1003.746] * (-1004.784) (-1005.022) [-1004.006] (-1007.675) -- 0:00:29
Average standard deviation of split frequencies: 0.015912
540500 -- (-1004.259) (-1004.301) [-1005.315] (-1003.718) * (-1004.459) (-1004.840) [-1003.641] (-1008.680) -- 0:00:29
541000 -- [-1005.204] (-1003.242) (-1004.785) (-1008.402) * (-1005.797) [-1004.669] (-1005.559) (-1005.981) -- 0:00:29
541500 -- [-1005.070] (-1008.930) (-1006.152) (-1006.455) * (-1004.339) (-1004.510) [-1007.709] (-1007.546) -- 0:00:29
542000 -- (-1005.413) (-1006.978) (-1004.705) [-1009.112] * [-1004.758] (-1006.134) (-1006.595) (-1008.418) -- 0:00:29
542500 -- [-1004.173] (-1012.415) (-1006.192) (-1007.057) * (-1006.492) (-1005.867) [-1003.947] (-1005.559) -- 0:00:29
543000 -- (-1006.553) (-1004.917) (-1010.082) [-1006.720] * (-1004.655) (-1005.783) (-1004.283) [-1008.263] -- 0:00:29
543500 -- [-1009.277] (-1006.069) (-1005.724) (-1006.632) * (-1005.395) (-1004.738) (-1004.389) [-1008.631] -- 0:00:29
544000 -- (-1005.959) (-1004.985) (-1004.212) [-1004.965] * (-1004.399) (-1006.630) [-1005.911] (-1004.649) -- 0:00:29
544500 -- (-1005.183) (-1011.934) (-1004.120) [-1005.657] * (-1006.477) (-1005.549) (-1005.872) [-1006.585] -- 0:00:29
545000 -- (-1004.495) [-1010.154] (-1003.482) (-1004.811) * (-1004.703) (-1005.918) (-1006.231) [-1003.966] -- 0:00:29
Average standard deviation of split frequencies: 0.016188
545500 -- [-1004.638] (-1007.876) (-1008.518) (-1003.445) * (-1007.083) (-1004.885) [-1012.464] (-1004.983) -- 0:00:29
546000 -- (-1004.846) [-1010.052] (-1008.233) (-1004.773) * [-1006.701] (-1008.352) (-1009.717) (-1007.844) -- 0:00:29
546500 -- (-1004.430) (-1011.135) (-1005.905) [-1003.609] * [-1004.313] (-1005.404) (-1008.990) (-1006.325) -- 0:00:29
547000 -- [-1004.228] (-1004.016) (-1008.039) (-1004.259) * (-1007.567) (-1007.138) [-1005.856] (-1012.052) -- 0:00:28
547500 -- (-1005.104) (-1005.818) (-1005.330) [-1005.112] * (-1007.711) (-1008.026) [-1005.822] (-1005.922) -- 0:00:28
548000 -- (-1009.481) (-1005.046) (-1007.874) [-1004.743] * (-1007.526) (-1007.517) [-1004.227] (-1007.160) -- 0:00:28
548500 -- (-1005.561) (-1005.920) (-1007.722) [-1005.388] * (-1005.336) (-1008.133) (-1005.763) [-1009.099] -- 0:00:28
549000 -- (-1007.535) [-1004.523] (-1008.886) (-1005.402) * (-1003.443) [-1005.325] (-1005.323) (-1005.796) -- 0:00:28
549500 -- (-1007.380) (-1006.565) (-1006.251) [-1005.030] * (-1005.973) (-1010.498) (-1008.902) [-1004.206] -- 0:00:28
550000 -- [-1005.889] (-1010.604) (-1003.686) (-1006.593) * [-1003.789] (-1006.202) (-1008.167) (-1004.899) -- 0:00:29
Average standard deviation of split frequencies: 0.015963
550500 -- [-1006.426] (-1007.917) (-1010.737) (-1008.589) * (-1003.767) (-1005.245) (-1010.980) [-1004.660] -- 0:00:29
551000 -- (-1005.241) (-1004.971) (-1005.997) [-1005.216] * (-1005.492) (-1006.015) (-1008.240) [-1004.308] -- 0:00:29
551500 -- [-1008.407] (-1006.600) (-1004.390) (-1006.993) * (-1004.662) [-1006.808] (-1004.223) (-1005.728) -- 0:00:29
552000 -- (-1005.168) [-1005.879] (-1008.938) (-1007.743) * [-1004.337] (-1007.463) (-1003.753) (-1003.310) -- 0:00:29
552500 -- (-1004.588) (-1005.011) [-1005.720] (-1006.385) * [-1010.536] (-1004.704) (-1004.837) (-1005.107) -- 0:00:29
553000 -- [-1005.308] (-1007.973) (-1008.813) (-1005.712) * [-1004.612] (-1005.510) (-1004.192) (-1005.217) -- 0:00:29
553500 -- [-1003.967] (-1008.383) (-1010.648) (-1004.147) * (-1003.717) [-1005.520] (-1005.737) (-1006.171) -- 0:00:29
554000 -- (-1006.825) (-1005.120) [-1006.276] (-1005.125) * (-1005.613) [-1006.832] (-1004.961) (-1008.351) -- 0:00:28
554500 -- (-1003.524) [-1004.352] (-1005.551) (-1008.243) * [-1004.123] (-1005.864) (-1005.284) (-1005.546) -- 0:00:28
555000 -- (-1005.506) [-1004.609] (-1003.812) (-1012.388) * (-1004.665) (-1003.289) (-1008.095) [-1006.093] -- 0:00:28
Average standard deviation of split frequencies: 0.015660
555500 -- [-1008.608] (-1004.348) (-1009.955) (-1014.665) * [-1003.975] (-1003.329) (-1007.068) (-1008.076) -- 0:00:28
556000 -- [-1004.941] (-1010.553) (-1005.145) (-1006.212) * (-1005.280) [-1003.667] (-1003.219) (-1007.311) -- 0:00:28
556500 -- (-1008.739) (-1009.479) [-1003.754] (-1006.618) * (-1006.352) [-1003.120] (-1004.635) (-1008.823) -- 0:00:28
557000 -- [-1005.039] (-1003.703) (-1008.745) (-1004.322) * (-1003.874) (-1005.881) [-1004.174] (-1004.685) -- 0:00:28
557500 -- (-1006.006) (-1007.249) (-1008.672) [-1005.434] * (-1005.892) (-1005.558) (-1009.253) [-1007.554] -- 0:00:28
558000 -- (-1003.855) (-1007.430) (-1008.658) [-1004.373] * [-1006.817] (-1009.824) (-1005.401) (-1008.326) -- 0:00:28
558500 -- [-1006.170] (-1007.268) (-1003.470) (-1007.319) * (-1003.991) (-1006.129) [-1006.032] (-1005.305) -- 0:00:28
559000 -- (-1004.509) [-1005.900] (-1003.111) (-1005.811) * [-1004.308] (-1003.857) (-1003.868) (-1004.545) -- 0:00:28
559500 -- (-1004.212) (-1006.057) [-1004.292] (-1004.985) * (-1004.590) [-1003.605] (-1006.352) (-1004.972) -- 0:00:28
560000 -- (-1005.244) [-1005.055] (-1004.485) (-1007.886) * (-1004.251) (-1006.137) [-1006.869] (-1004.550) -- 0:00:28
Average standard deviation of split frequencies: 0.015579
560500 -- (-1006.472) [-1005.400] (-1005.777) (-1004.508) * (-1004.221) (-1005.057) [-1005.433] (-1003.743) -- 0:00:28
561000 -- (-1005.447) [-1005.551] (-1007.013) (-1007.150) * (-1004.135) [-1004.266] (-1005.451) (-1003.871) -- 0:00:28
561500 -- (-1006.939) [-1006.491] (-1003.738) (-1004.994) * (-1006.567) (-1004.844) [-1003.547] (-1007.171) -- 0:00:28
562000 -- (-1007.436) [-1004.048] (-1003.521) (-1006.189) * (-1006.520) [-1004.053] (-1003.985) (-1003.530) -- 0:00:28
562500 -- (-1005.448) (-1005.406) (-1005.257) [-1007.405] * (-1008.632) [-1003.848] (-1005.142) (-1006.685) -- 0:00:28
563000 -- (-1003.659) [-1006.633] (-1005.528) (-1011.701) * [-1004.775] (-1004.985) (-1005.359) (-1004.000) -- 0:00:27
563500 -- (-1004.255) (-1007.390) [-1004.069] (-1004.530) * (-1006.214) (-1007.762) [-1007.139] (-1007.724) -- 0:00:27
564000 -- (-1009.128) (-1004.007) [-1005.978] (-1006.215) * (-1005.670) (-1004.478) (-1003.647) [-1005.346] -- 0:00:27
564500 -- [-1005.112] (-1005.372) (-1004.718) (-1006.153) * (-1004.869) (-1003.889) [-1004.640] (-1006.126) -- 0:00:27
565000 -- [-1004.278] (-1003.892) (-1005.908) (-1008.548) * (-1007.724) (-1005.685) [-1004.000] (-1005.827) -- 0:00:27
Average standard deviation of split frequencies: 0.014404
565500 -- (-1004.845) [-1004.722] (-1004.067) (-1003.946) * (-1003.953) (-1007.716) (-1003.461) [-1007.098] -- 0:00:27
566000 -- (-1005.841) (-1005.724) (-1007.805) [-1004.154] * (-1003.299) [-1004.360] (-1005.306) (-1004.318) -- 0:00:28
566500 -- (-1005.827) [-1007.448] (-1005.497) (-1005.150) * (-1003.299) [-1004.531] (-1005.122) (-1004.411) -- 0:00:28
567000 -- (-1006.070) (-1004.872) (-1004.223) [-1005.602] * [-1007.803] (-1012.241) (-1005.385) (-1005.455) -- 0:00:28
567500 -- [-1004.465] (-1004.442) (-1004.577) (-1005.118) * (-1006.722) (-1004.576) (-1003.534) [-1011.324] -- 0:00:28
568000 -- [-1003.714] (-1005.941) (-1004.336) (-1009.237) * (-1007.186) (-1006.509) [-1003.182] (-1008.083) -- 0:00:28
568500 -- (-1006.584) [-1004.254] (-1004.277) (-1007.135) * (-1008.105) (-1009.428) [-1006.621] (-1005.955) -- 0:00:28
569000 -- (-1004.665) (-1005.165) [-1007.412] (-1009.128) * (-1007.490) (-1006.255) (-1004.538) [-1005.916] -- 0:00:28
569500 -- (-1003.544) [-1004.883] (-1010.122) (-1006.753) * (-1006.018) (-1006.552) (-1004.601) [-1004.939] -- 0:00:27
570000 -- (-1005.218) (-1004.776) (-1006.905) [-1003.624] * (-1006.141) [-1007.249] (-1004.944) (-1007.011) -- 0:00:27
Average standard deviation of split frequencies: 0.014918
570500 -- (-1005.349) [-1004.910] (-1007.664) (-1004.911) * (-1005.720) [-1005.888] (-1007.441) (-1009.783) -- 0:00:27
571000 -- (-1004.380) (-1005.853) (-1009.661) [-1005.354] * (-1008.764) (-1004.222) (-1005.542) [-1006.109] -- 0:00:27
571500 -- [-1006.077] (-1006.351) (-1007.324) (-1010.265) * (-1007.302) [-1005.059] (-1005.733) (-1011.335) -- 0:00:27
572000 -- (-1005.966) [-1005.412] (-1004.838) (-1004.820) * [-1004.331] (-1004.847) (-1007.272) (-1005.248) -- 0:00:27
572500 -- (-1006.162) [-1006.316] (-1003.757) (-1007.211) * (-1005.156) (-1005.889) [-1006.723] (-1005.970) -- 0:00:27
573000 -- (-1012.418) [-1005.454] (-1009.725) (-1004.896) * [-1006.523] (-1011.439) (-1005.946) (-1007.671) -- 0:00:27
573500 -- (-1006.210) (-1007.508) (-1004.127) [-1005.323] * [-1005.094] (-1008.470) (-1005.105) (-1008.341) -- 0:00:27
574000 -- (-1004.438) (-1010.291) [-1005.335] (-1012.403) * (-1004.591) (-1005.211) (-1004.973) [-1004.725] -- 0:00:27
574500 -- (-1006.912) (-1005.694) [-1004.365] (-1008.815) * (-1006.999) (-1003.762) (-1004.481) [-1005.569] -- 0:00:27
575000 -- (-1005.888) (-1009.391) [-1005.026] (-1004.845) * (-1007.448) (-1004.133) [-1003.663] (-1003.534) -- 0:00:27
Average standard deviation of split frequencies: 0.015652
575500 -- (-1007.007) (-1004.803) (-1006.030) [-1003.571] * [-1005.857] (-1009.452) (-1006.589) (-1005.704) -- 0:00:27
576000 -- (-1007.042) [-1004.114] (-1007.974) (-1004.049) * (-1005.813) (-1005.981) [-1007.351] (-1004.851) -- 0:00:27
576500 -- (-1008.902) (-1005.448) (-1004.965) [-1009.280] * (-1005.541) [-1004.304] (-1007.006) (-1009.140) -- 0:00:27
577000 -- [-1008.738] (-1005.659) (-1008.207) (-1006.410) * (-1007.899) [-1004.734] (-1006.787) (-1009.017) -- 0:00:27
577500 -- (-1008.393) (-1008.028) (-1004.548) [-1003.257] * (-1005.926) (-1005.966) (-1004.781) [-1003.807] -- 0:00:27
578000 -- (-1006.835) (-1005.618) [-1005.338] (-1009.299) * [-1007.123] (-1007.296) (-1008.138) (-1005.039) -- 0:00:27
578500 -- (-1004.514) (-1005.637) (-1006.439) [-1005.134] * [-1003.335] (-1005.957) (-1009.034) (-1007.596) -- 0:00:26
579000 -- (-1008.640) (-1006.825) [-1007.161] (-1004.876) * (-1004.327) (-1006.772) [-1003.886] (-1006.989) -- 0:00:26
579500 -- (-1003.647) (-1005.520) (-1008.151) [-1004.268] * (-1004.561) (-1008.881) [-1004.492] (-1007.300) -- 0:00:26
580000 -- (-1005.416) (-1004.953) (-1007.196) [-1005.164] * (-1010.868) (-1005.447) (-1004.398) [-1003.658] -- 0:00:26
Average standard deviation of split frequencies: 0.014765
580500 -- [-1004.145] (-1005.522) (-1005.754) (-1005.366) * (-1010.372) (-1004.891) [-1006.220] (-1003.790) -- 0:00:26
581000 -- [-1003.286] (-1011.572) (-1005.274) (-1004.178) * (-1003.825) [-1003.397] (-1005.863) (-1004.494) -- 0:00:26
581500 -- (-1006.077) (-1006.032) [-1005.998] (-1004.584) * (-1004.419) (-1003.393) (-1004.914) [-1005.045] -- 0:00:26
582000 -- (-1009.649) (-1006.986) (-1008.096) [-1007.160] * (-1004.527) [-1003.262] (-1005.729) (-1005.546) -- 0:00:26
582500 -- (-1004.093) (-1006.868) (-1006.908) [-1008.626] * (-1004.263) [-1006.144] (-1005.867) (-1003.617) -- 0:00:27
583000 -- (-1003.685) [-1004.313] (-1005.705) (-1005.310) * (-1006.547) [-1009.142] (-1003.099) (-1004.804) -- 0:00:27
583500 -- [-1006.150] (-1008.225) (-1005.223) (-1005.725) * (-1006.432) (-1005.061) [-1004.812] (-1007.693) -- 0:00:27
584000 -- (-1005.970) (-1004.159) [-1003.292] (-1005.054) * (-1005.763) [-1004.439] (-1007.489) (-1003.433) -- 0:00:27
584500 -- (-1008.979) (-1007.522) [-1006.390] (-1005.810) * (-1008.904) (-1006.085) [-1004.814] (-1004.562) -- 0:00:27
585000 -- (-1007.677) (-1005.800) (-1003.778) [-1005.134] * [-1005.197] (-1005.440) (-1007.126) (-1005.130) -- 0:00:26
Average standard deviation of split frequencies: 0.014933
585500 -- (-1007.624) (-1003.799) (-1005.760) [-1006.142] * [-1003.549] (-1005.179) (-1005.203) (-1005.881) -- 0:00:26
586000 -- (-1004.155) [-1004.499] (-1005.070) (-1010.687) * (-1009.446) (-1003.981) (-1004.709) [-1003.504] -- 0:00:26
586500 -- (-1004.275) (-1006.208) (-1005.584) [-1009.386] * (-1005.835) [-1005.593] (-1004.238) (-1003.232) -- 0:00:26
587000 -- [-1004.291] (-1005.955) (-1005.388) (-1004.942) * (-1004.545) (-1006.746) [-1003.570] (-1004.477) -- 0:00:26
587500 -- [-1005.227] (-1003.799) (-1006.551) (-1004.357) * (-1005.824) (-1006.125) (-1004.489) [-1004.380] -- 0:00:26
588000 -- (-1005.095) (-1005.673) (-1006.977) [-1005.166] * (-1006.891) (-1005.100) (-1005.546) [-1003.982] -- 0:00:26
588500 -- [-1005.001] (-1005.764) (-1005.353) (-1008.589) * (-1003.568) [-1004.063] (-1004.929) (-1004.950) -- 0:00:26
589000 -- (-1006.001) (-1007.477) [-1011.180] (-1005.758) * (-1005.507) (-1005.764) [-1005.486] (-1007.192) -- 0:00:26
589500 -- (-1005.182) (-1003.545) [-1006.844] (-1005.338) * (-1005.132) [-1004.839] (-1006.338) (-1004.432) -- 0:00:26
590000 -- (-1007.039) [-1005.183] (-1004.683) (-1010.203) * (-1004.637) [-1005.050] (-1003.662) (-1007.420) -- 0:00:26
Average standard deviation of split frequencies: 0.014415
590500 -- [-1005.485] (-1006.371) (-1004.067) (-1009.982) * (-1004.985) (-1007.064) [-1005.656] (-1003.959) -- 0:00:26
591000 -- (-1004.751) (-1003.944) [-1003.981] (-1010.743) * (-1007.138) (-1004.411) (-1004.496) [-1005.031] -- 0:00:26
591500 -- (-1006.093) [-1004.061] (-1009.483) (-1004.619) * (-1003.520) [-1005.036] (-1004.619) (-1004.802) -- 0:00:26
592000 -- (-1006.083) (-1005.488) (-1008.544) [-1003.891] * [-1005.007] (-1006.463) (-1005.059) (-1006.062) -- 0:00:26
592500 -- [-1007.470] (-1006.441) (-1007.719) (-1004.423) * (-1004.484) [-1006.943] (-1003.796) (-1007.777) -- 0:00:26
593000 -- [-1006.838] (-1004.850) (-1005.183) (-1006.653) * (-1005.554) [-1005.439] (-1003.934) (-1006.163) -- 0:00:26
593500 -- (-1006.035) (-1005.930) (-1007.587) [-1004.690] * (-1006.975) [-1004.713] (-1008.963) (-1005.065) -- 0:00:26
594000 -- (-1007.195) [-1003.865] (-1010.263) (-1006.345) * (-1003.405) [-1003.986] (-1004.529) (-1006.767) -- 0:00:25
594500 -- (-1005.531) [-1004.305] (-1010.703) (-1011.380) * (-1003.637) (-1006.096) (-1004.656) [-1004.312] -- 0:00:25
595000 -- [-1007.417] (-1003.957) (-1005.297) (-1010.350) * (-1004.329) [-1005.922] (-1004.065) (-1004.057) -- 0:00:25
Average standard deviation of split frequencies: 0.014286
595500 -- (-1004.251) [-1006.258] (-1005.434) (-1005.007) * (-1004.039) (-1009.841) (-1005.320) [-1004.455] -- 0:00:25
596000 -- [-1004.263] (-1010.056) (-1005.778) (-1004.604) * (-1004.072) (-1007.833) [-1005.774] (-1004.085) -- 0:00:25
596500 -- (-1004.415) [-1007.314] (-1006.366) (-1004.795) * [-1003.828] (-1004.957) (-1005.088) (-1006.470) -- 0:00:25
597000 -- (-1005.322) (-1007.908) (-1006.199) [-1004.997] * (-1004.493) (-1004.339) [-1004.515] (-1009.568) -- 0:00:25
597500 -- (-1005.296) (-1005.418) (-1006.495) [-1003.822] * (-1004.881) (-1006.076) [-1005.251] (-1005.626) -- 0:00:25
598000 -- [-1005.339] (-1005.579) (-1006.356) (-1004.307) * [-1006.055] (-1007.571) (-1009.144) (-1005.330) -- 0:00:25
598500 -- [-1007.228] (-1005.627) (-1004.128) (-1003.431) * (-1005.611) (-1005.074) [-1005.301] (-1006.649) -- 0:00:25
599000 -- (-1004.710) (-1006.661) (-1003.831) [-1005.531] * (-1005.374) (-1005.456) [-1005.799] (-1005.383) -- 0:00:26
599500 -- [-1005.930] (-1004.737) (-1004.194) (-1005.103) * (-1010.193) (-1008.960) (-1006.505) [-1005.349] -- 0:00:26
600000 -- (-1006.726) (-1008.482) (-1007.163) [-1004.114] * (-1003.541) [-1005.094] (-1005.759) (-1005.877) -- 0:00:25
Average standard deviation of split frequencies: 0.014274
600500 -- [-1004.248] (-1006.206) (-1007.038) (-1006.812) * (-1003.855) (-1005.216) [-1008.247] (-1007.765) -- 0:00:25
601000 -- (-1005.673) (-1007.235) [-1005.294] (-1006.651) * (-1004.080) [-1007.744] (-1004.357) (-1003.671) -- 0:00:25
601500 -- [-1004.228] (-1008.118) (-1006.058) (-1006.702) * [-1004.763] (-1005.189) (-1004.054) (-1005.640) -- 0:00:25
602000 -- (-1004.092) (-1005.669) [-1004.886] (-1005.979) * (-1010.651) [-1004.964] (-1004.450) (-1005.579) -- 0:00:25
602500 -- (-1005.844) [-1007.397] (-1005.290) (-1004.857) * [-1009.949] (-1007.786) (-1004.069) (-1004.946) -- 0:00:25
603000 -- (-1004.399) (-1007.642) [-1005.307] (-1005.914) * [-1005.804] (-1007.598) (-1004.795) (-1004.545) -- 0:00:25
603500 -- [-1004.327] (-1006.481) (-1005.718) (-1005.553) * (-1004.621) (-1004.613) (-1003.726) [-1004.163] -- 0:00:25
604000 -- (-1004.066) [-1006.483] (-1004.456) (-1006.916) * [-1004.610] (-1005.374) (-1007.567) (-1004.024) -- 0:00:25
604500 -- (-1003.954) [-1007.328] (-1004.716) (-1006.326) * [-1006.849] (-1008.215) (-1004.885) (-1005.511) -- 0:00:25
605000 -- [-1004.257] (-1008.759) (-1005.178) (-1007.434) * (-1005.555) (-1007.544) (-1006.020) [-1004.906] -- 0:00:25
Average standard deviation of split frequencies: 0.013865
605500 -- (-1004.463) (-1004.874) (-1006.663) [-1004.655] * (-1005.812) (-1006.837) [-1005.900] (-1004.849) -- 0:00:25
606000 -- (-1006.635) (-1005.056) (-1006.086) [-1004.372] * (-1005.439) (-1006.122) [-1006.995] (-1004.974) -- 0:00:25
606500 -- (-1008.947) (-1004.739) (-1007.741) [-1006.159] * (-1005.202) (-1006.348) (-1004.824) [-1005.871] -- 0:00:25
607000 -- (-1007.781) [-1006.031] (-1008.344) (-1008.939) * [-1005.992] (-1005.551) (-1005.239) (-1004.458) -- 0:00:25
607500 -- (-1005.469) (-1006.198) [-1006.709] (-1008.770) * [-1006.429] (-1006.643) (-1004.049) (-1011.594) -- 0:00:25
608000 -- [-1005.166] (-1010.613) (-1007.741) (-1005.195) * (-1008.352) (-1005.333) (-1008.157) [-1004.888] -- 0:00:25
608500 -- [-1005.245] (-1006.024) (-1004.945) (-1004.344) * (-1009.601) (-1004.718) [-1005.712] (-1009.093) -- 0:00:25
609000 -- (-1007.027) [-1003.975] (-1004.698) (-1005.461) * (-1006.755) [-1005.072] (-1004.483) (-1008.653) -- 0:00:25
609500 -- (-1003.905) (-1012.705) [-1004.806] (-1010.984) * (-1005.421) [-1003.577] (-1004.454) (-1008.558) -- 0:00:24
610000 -- [-1005.627] (-1006.169) (-1008.980) (-1004.884) * (-1005.660) (-1005.750) [-1005.039] (-1004.988) -- 0:00:24
Average standard deviation of split frequencies: 0.013532
610500 -- [-1005.099] (-1003.481) (-1005.033) (-1006.783) * (-1005.074) [-1004.006] (-1005.461) (-1007.493) -- 0:00:24
611000 -- (-1006.226) (-1005.601) (-1004.500) [-1009.224] * (-1004.984) (-1004.736) (-1006.407) [-1006.358] -- 0:00:24
611500 -- (-1013.350) (-1004.773) (-1006.652) [-1007.935] * (-1006.041) [-1006.846] (-1004.338) (-1008.319) -- 0:00:24
612000 -- (-1003.666) (-1009.788) [-1004.627] (-1003.640) * (-1006.900) [-1008.310] (-1006.041) (-1007.645) -- 0:00:24
612500 -- (-1004.337) [-1007.539] (-1005.006) (-1005.098) * (-1006.783) (-1009.194) (-1007.640) [-1004.846] -- 0:00:24
613000 -- (-1005.235) (-1009.738) [-1004.640] (-1005.407) * (-1004.552) (-1012.129) [-1006.967] (-1003.272) -- 0:00:24
613500 -- (-1005.752) (-1004.559) (-1010.405) [-1005.714] * (-1006.498) (-1009.622) (-1006.930) [-1004.917] -- 0:00:24
614000 -- (-1007.983) (-1006.124) [-1006.940] (-1007.058) * (-1009.209) [-1007.356] (-1008.629) (-1005.613) -- 0:00:24
614500 -- (-1010.520) [-1004.153] (-1003.745) (-1005.533) * (-1016.196) (-1007.679) [-1006.882] (-1003.513) -- 0:00:24
615000 -- (-1008.272) (-1004.719) (-1003.788) [-1005.457] * (-1006.696) [-1005.031] (-1007.273) (-1004.408) -- 0:00:24
Average standard deviation of split frequencies: 0.013595
615500 -- (-1005.095) [-1005.183] (-1004.927) (-1004.249) * (-1004.587) (-1005.706) [-1005.843] (-1004.399) -- 0:00:24
616000 -- (-1004.606) (-1006.982) [-1004.347] (-1006.465) * (-1003.958) (-1006.396) [-1007.342] (-1007.073) -- 0:00:24
616500 -- (-1005.167) [-1006.636] (-1003.597) (-1006.504) * (-1004.387) (-1006.738) [-1008.984] (-1004.565) -- 0:00:24
617000 -- [-1004.435] (-1006.681) (-1003.980) (-1008.598) * (-1004.934) (-1003.746) [-1005.948] (-1004.692) -- 0:00:24
617500 -- [-1003.637] (-1006.855) (-1005.827) (-1004.428) * (-1006.595) [-1005.573] (-1006.228) (-1003.593) -- 0:00:24
618000 -- (-1007.751) (-1008.009) [-1009.469] (-1004.603) * (-1005.386) [-1005.128] (-1006.333) (-1004.418) -- 0:00:24
618500 -- (-1005.086) (-1007.748) (-1004.161) [-1004.980] * (-1004.892) (-1005.306) [-1008.535] (-1003.814) -- 0:00:24
619000 -- [-1005.607] (-1009.445) (-1006.698) (-1008.331) * [-1007.359] (-1004.361) (-1005.064) (-1010.585) -- 0:00:24
619500 -- (-1005.221) (-1006.593) (-1004.199) [-1005.701] * (-1009.084) (-1005.851) (-1007.109) [-1008.847] -- 0:00:24
620000 -- [-1004.463] (-1005.046) (-1009.453) (-1006.496) * [-1003.928] (-1007.890) (-1004.114) (-1006.385) -- 0:00:24
Average standard deviation of split frequencies: 0.013244
620500 -- [-1005.641] (-1010.718) (-1004.664) (-1004.193) * (-1004.032) [-1005.654] (-1004.391) (-1004.050) -- 0:00:24
621000 -- (-1008.526) (-1004.598) [-1005.475] (-1006.352) * (-1005.310) [-1005.010] (-1004.560) (-1009.483) -- 0:00:24
621500 -- [-1004.054] (-1005.886) (-1003.477) (-1004.785) * (-1005.907) (-1004.780) (-1011.104) [-1006.981] -- 0:00:24
622000 -- (-1007.403) (-1006.572) [-1005.736] (-1005.459) * (-1005.813) (-1005.567) [-1007.058] (-1004.637) -- 0:00:24
622500 -- (-1005.672) (-1004.065) (-1006.617) [-1004.682] * (-1005.416) (-1006.411) (-1005.030) [-1007.481] -- 0:00:24
623000 -- (-1006.930) (-1005.138) [-1007.716] (-1004.390) * (-1003.666) (-1005.849) (-1003.790) [-1004.631] -- 0:00:24
623500 -- [-1003.464] (-1007.514) (-1007.200) (-1006.999) * (-1003.555) [-1003.468] (-1005.188) (-1007.274) -- 0:00:24
624000 -- (-1003.290) [-1006.832] (-1006.310) (-1004.190) * (-1007.047) (-1007.385) [-1006.251] (-1005.299) -- 0:00:24
624500 -- (-1003.723) (-1006.433) (-1004.522) [-1004.295] * (-1005.767) (-1010.173) [-1004.405] (-1007.227) -- 0:00:24
625000 -- [-1005.480] (-1005.806) (-1007.291) (-1013.276) * [-1003.562] (-1005.932) (-1005.984) (-1007.411) -- 0:00:24
Average standard deviation of split frequencies: 0.013743
625500 -- (-1005.177) (-1005.649) [-1004.725] (-1006.319) * [-1006.116] (-1004.931) (-1006.227) (-1005.883) -- 0:00:23
626000 -- [-1004.299] (-1008.975) (-1006.170) (-1003.755) * (-1005.885) (-1006.707) (-1005.314) [-1004.464] -- 0:00:23
626500 -- (-1007.500) [-1006.600] (-1008.320) (-1003.933) * (-1005.418) [-1006.092] (-1007.057) (-1007.713) -- 0:00:23
627000 -- (-1009.032) (-1005.040) (-1008.047) [-1005.309] * (-1006.609) (-1006.126) [-1006.700] (-1005.299) -- 0:00:23
627500 -- (-1007.129) [-1008.051] (-1006.051) (-1007.197) * (-1004.914) (-1011.662) [-1004.327] (-1008.154) -- 0:00:23
628000 -- (-1004.998) (-1005.752) [-1004.856] (-1004.199) * (-1006.608) [-1007.779] (-1005.559) (-1005.022) -- 0:00:23
628500 -- (-1005.140) (-1005.789) [-1003.925] (-1005.683) * (-1007.284) (-1009.665) (-1008.905) [-1003.779] -- 0:00:23
629000 -- [-1004.466] (-1007.307) (-1003.759) (-1006.603) * (-1007.917) (-1008.044) (-1004.867) [-1004.166] -- 0:00:23
629500 -- (-1004.000) (-1004.053) [-1003.981] (-1006.857) * (-1006.218) (-1007.412) (-1004.038) [-1004.979] -- 0:00:23
630000 -- [-1003.661] (-1005.080) (-1006.791) (-1006.072) * (-1004.450) [-1005.266] (-1004.768) (-1007.606) -- 0:00:23
Average standard deviation of split frequencies: 0.012473
630500 -- (-1003.695) [-1005.025] (-1006.262) (-1004.144) * (-1007.042) (-1005.644) [-1004.048] (-1013.465) -- 0:00:23
631000 -- (-1004.548) (-1011.721) (-1004.582) [-1005.451] * (-1008.844) (-1006.678) (-1003.618) [-1004.854] -- 0:00:23
631500 -- [-1003.677] (-1010.453) (-1003.958) (-1005.567) * [-1004.424] (-1004.642) (-1006.129) (-1004.856) -- 0:00:23
632000 -- (-1007.078) (-1007.744) (-1003.454) [-1004.275] * [-1003.988] (-1008.529) (-1012.167) (-1004.000) -- 0:00:23
632500 -- (-1008.668) (-1003.565) (-1003.702) [-1006.377] * (-1005.088) (-1004.837) [-1003.299] (-1005.262) -- 0:00:23
633000 -- (-1005.201) (-1004.430) (-1003.998) [-1004.490] * [-1009.211] (-1004.832) (-1007.521) (-1006.998) -- 0:00:23
633500 -- [-1005.425] (-1004.184) (-1006.846) (-1009.489) * (-1003.537) [-1004.050] (-1007.041) (-1003.760) -- 0:00:23
634000 -- [-1005.618] (-1004.516) (-1006.664) (-1004.474) * [-1003.509] (-1005.986) (-1004.913) (-1008.279) -- 0:00:23
634500 -- [-1006.768] (-1003.631) (-1004.519) (-1010.036) * (-1005.278) [-1006.429] (-1007.159) (-1005.690) -- 0:00:23
635000 -- (-1004.391) (-1008.316) [-1004.515] (-1009.070) * (-1008.021) (-1003.744) (-1004.908) [-1007.816] -- 0:00:23
Average standard deviation of split frequencies: 0.012832
635500 -- (-1005.003) [-1004.824] (-1003.991) (-1009.210) * (-1005.280) [-1003.824] (-1008.437) (-1006.358) -- 0:00:23
636000 -- (-1005.588) [-1004.571] (-1005.454) (-1010.056) * (-1008.185) [-1004.630] (-1004.960) (-1005.190) -- 0:00:23
636500 -- (-1005.578) (-1010.573) [-1009.251] (-1010.258) * (-1006.877) (-1004.072) [-1005.082] (-1005.818) -- 0:00:23
637000 -- (-1006.791) (-1004.753) (-1004.302) [-1008.964] * [-1005.531] (-1004.783) (-1004.083) (-1011.636) -- 0:00:23
637500 -- (-1006.843) [-1005.007] (-1004.087) (-1004.438) * [-1004.763] (-1004.233) (-1004.482) (-1012.988) -- 0:00:23
638000 -- (-1009.245) [-1004.625] (-1004.810) (-1003.249) * (-1007.384) (-1004.121) (-1004.821) [-1005.073] -- 0:00:23
638500 -- (-1004.784) (-1004.517) [-1004.901] (-1003.403) * (-1005.706) (-1008.983) (-1003.529) [-1004.493] -- 0:00:23
639000 -- [-1005.101] (-1004.004) (-1004.675) (-1003.360) * [-1006.767] (-1005.189) (-1004.126) (-1003.806) -- 0:00:23
639500 -- [-1003.771] (-1006.566) (-1006.669) (-1003.320) * (-1009.666) [-1004.523] (-1003.903) (-1006.359) -- 0:00:23
640000 -- [-1006.441] (-1004.961) (-1006.230) (-1004.582) * (-1006.149) (-1006.349) (-1004.982) [-1004.422] -- 0:00:23
Average standard deviation of split frequencies: 0.012877
640500 -- (-1005.094) [-1004.961] (-1004.140) (-1009.882) * [-1004.838] (-1004.529) (-1004.490) (-1004.634) -- 0:00:23
641000 -- [-1004.379] (-1005.443) (-1003.992) (-1004.986) * (-1008.194) [-1003.477] (-1004.081) (-1008.163) -- 0:00:22
641500 -- (-1003.695) (-1005.123) [-1005.860] (-1004.822) * [-1007.901] (-1004.869) (-1006.271) (-1007.931) -- 0:00:22
642000 -- [-1005.081] (-1006.296) (-1006.749) (-1008.665) * [-1007.143] (-1004.285) (-1005.754) (-1005.556) -- 0:00:22
642500 -- (-1004.714) (-1006.349) [-1007.453] (-1006.714) * (-1006.804) (-1003.929) [-1004.941] (-1004.989) -- 0:00:22
643000 -- [-1004.286] (-1007.033) (-1005.552) (-1007.450) * (-1005.961) (-1005.230) [-1004.468] (-1005.752) -- 0:00:22
643500 -- (-1005.595) (-1004.893) [-1003.756] (-1007.968) * (-1004.822) [-1005.812] (-1005.877) (-1003.310) -- 0:00:22
644000 -- (-1005.550) (-1004.574) (-1006.163) [-1005.203] * [-1005.584] (-1005.676) (-1007.791) (-1004.368) -- 0:00:22
644500 -- [-1004.300] (-1004.766) (-1006.081) (-1013.669) * (-1005.187) [-1004.191] (-1011.479) (-1003.932) -- 0:00:22
645000 -- (-1004.310) (-1008.564) (-1012.217) [-1005.804] * (-1004.411) [-1004.950] (-1008.218) (-1004.870) -- 0:00:22
Average standard deviation of split frequencies: 0.013090
645500 -- [-1003.746] (-1007.243) (-1006.056) (-1006.324) * (-1004.444) (-1005.791) [-1005.739] (-1004.034) -- 0:00:22
646000 -- (-1010.434) (-1010.386) [-1006.095] (-1004.234) * (-1003.072) (-1004.279) (-1009.289) [-1006.141] -- 0:00:22
646500 -- (-1013.768) (-1005.268) [-1005.255] (-1005.299) * (-1003.072) (-1003.826) [-1004.905] (-1003.772) -- 0:00:22
647000 -- [-1009.416] (-1006.749) (-1003.332) (-1004.585) * (-1006.589) (-1004.053) (-1005.546) [-1004.247] -- 0:00:22
647500 -- (-1011.378) [-1004.627] (-1005.856) (-1006.236) * [-1005.107] (-1007.711) (-1004.372) (-1005.305) -- 0:00:22
648000 -- (-1004.401) [-1007.412] (-1005.576) (-1006.028) * (-1004.998) (-1004.842) [-1005.218] (-1005.372) -- 0:00:22
648500 -- (-1004.453) (-1008.526) (-1006.603) [-1004.824] * [-1005.248] (-1005.248) (-1007.790) (-1006.872) -- 0:00:22
649000 -- (-1003.755) (-1004.592) [-1003.579] (-1005.539) * (-1006.378) (-1005.285) [-1003.830] (-1004.429) -- 0:00:22
649500 -- [-1005.207] (-1004.243) (-1003.843) (-1006.875) * [-1005.290] (-1005.613) (-1006.745) (-1003.808) -- 0:00:22
650000 -- (-1008.609) (-1006.890) [-1003.711] (-1006.617) * (-1004.886) (-1005.496) (-1005.729) [-1004.203] -- 0:00:22
Average standard deviation of split frequencies: 0.012860
650500 -- [-1009.366] (-1005.546) (-1003.711) (-1006.179) * [-1004.858] (-1006.739) (-1006.710) (-1003.599) -- 0:00:22
651000 -- [-1004.564] (-1006.485) (-1003.833) (-1005.752) * (-1005.067) (-1003.885) (-1006.204) [-1008.740] -- 0:00:22
651500 -- (-1007.251) [-1005.939] (-1004.505) (-1007.817) * [-1004.725] (-1005.132) (-1005.498) (-1006.542) -- 0:00:22
652000 -- (-1004.635) [-1004.847] (-1004.175) (-1009.243) * (-1005.286) [-1005.602] (-1009.511) (-1007.199) -- 0:00:22
652500 -- [-1004.723] (-1009.128) (-1003.866) (-1004.826) * (-1006.953) (-1005.626) (-1010.115) [-1009.928] -- 0:00:22
653000 -- [-1006.348] (-1005.482) (-1006.649) (-1009.338) * (-1009.139) (-1005.738) [-1006.588] (-1005.669) -- 0:00:22
653500 -- (-1009.258) [-1006.110] (-1006.131) (-1005.133) * (-1004.606) (-1005.210) [-1005.257] (-1008.121) -- 0:00:22
654000 -- (-1005.875) [-1008.711] (-1016.905) (-1005.864) * (-1006.167) (-1003.759) [-1003.384] (-1005.118) -- 0:00:22
654500 -- (-1004.490) (-1006.826) (-1013.112) [-1005.883] * (-1008.411) (-1004.484) [-1003.716] (-1006.491) -- 0:00:22
655000 -- (-1004.366) (-1003.887) (-1004.736) [-1009.799] * (-1005.267) (-1003.481) (-1007.859) [-1005.319] -- 0:00:22
Average standard deviation of split frequencies: 0.012351
655500 -- (-1005.368) (-1005.502) [-1004.358] (-1007.736) * (-1004.973) (-1006.322) [-1004.740] (-1003.550) -- 0:00:22
656000 -- (-1005.556) (-1008.674) [-1003.627] (-1009.165) * (-1005.694) (-1008.471) (-1004.474) [-1003.319] -- 0:00:22
656500 -- (-1006.493) [-1006.708] (-1011.352) (-1003.477) * (-1005.847) (-1006.545) (-1006.117) [-1003.632] -- 0:00:21
657000 -- (-1007.446) (-1009.662) [-1006.366] (-1003.272) * (-1004.201) (-1007.015) (-1004.012) [-1004.936] -- 0:00:21
657500 -- [-1007.446] (-1009.393) (-1004.388) (-1004.509) * (-1004.127) (-1006.111) (-1005.220) [-1007.015] -- 0:00:21
658000 -- (-1006.787) (-1007.676) (-1004.210) [-1004.519] * (-1004.698) [-1004.591] (-1007.302) (-1005.292) -- 0:00:21
658500 -- (-1006.658) (-1007.075) [-1009.801] (-1006.979) * (-1006.067) [-1004.064] (-1004.492) (-1004.739) -- 0:00:21
659000 -- (-1006.922) (-1006.943) [-1006.062] (-1004.960) * [-1007.157] (-1006.162) (-1008.400) (-1008.388) -- 0:00:21
659500 -- (-1004.298) (-1005.512) (-1003.590) [-1003.760] * [-1004.262] (-1005.707) (-1008.333) (-1006.083) -- 0:00:21
660000 -- (-1007.243) [-1003.952] (-1007.081) (-1003.739) * (-1004.828) (-1008.282) [-1006.475] (-1005.026) -- 0:00:21
Average standard deviation of split frequencies: 0.013156
660500 -- (-1009.067) [-1007.212] (-1005.772) (-1008.192) * (-1007.142) (-1009.949) [-1010.202] (-1004.048) -- 0:00:21
661000 -- (-1009.271) (-1007.878) [-1004.269] (-1006.803) * [-1007.754] (-1005.593) (-1011.292) (-1004.547) -- 0:00:21
661500 -- (-1010.428) (-1004.657) [-1006.509] (-1004.287) * (-1003.636) (-1012.168) (-1007.178) [-1005.856] -- 0:00:21
662000 -- [-1004.673] (-1003.640) (-1004.803) (-1005.093) * (-1005.422) [-1005.932] (-1007.068) (-1005.930) -- 0:00:21
662500 -- (-1004.933) (-1005.544) (-1006.033) [-1004.283] * (-1004.591) (-1005.273) [-1005.124] (-1006.331) -- 0:00:21
663000 -- (-1006.526) (-1003.868) (-1007.440) [-1005.249] * (-1007.098) (-1004.909) (-1004.540) [-1008.691] -- 0:00:21
663500 -- (-1006.070) [-1004.822] (-1005.022) (-1005.396) * (-1006.126) (-1003.543) [-1006.316] (-1003.677) -- 0:00:21
664000 -- (-1007.583) (-1004.896) [-1006.628] (-1007.794) * (-1004.620) [-1004.495] (-1004.354) (-1004.705) -- 0:00:21
664500 -- (-1003.816) (-1010.058) [-1006.861] (-1005.762) * (-1003.484) (-1004.170) [-1005.005] (-1005.660) -- 0:00:21
665000 -- [-1004.569] (-1012.844) (-1005.544) (-1007.680) * (-1004.550) (-1004.320) [-1006.429] (-1004.974) -- 0:00:21
Average standard deviation of split frequencies: 0.012657
665500 -- (-1005.583) (-1004.891) [-1004.551] (-1011.524) * [-1004.588] (-1005.254) (-1006.152) (-1006.351) -- 0:00:21
666000 -- (-1006.296) (-1004.145) [-1003.755] (-1006.226) * (-1007.238) [-1004.140] (-1005.957) (-1007.200) -- 0:00:21
666500 -- (-1006.425) (-1004.561) [-1003.979] (-1005.668) * (-1006.052) (-1004.675) (-1006.834) [-1003.687] -- 0:00:21
667000 -- (-1006.497) (-1004.112) [-1004.181] (-1004.291) * [-1005.303] (-1004.193) (-1005.270) (-1007.743) -- 0:00:21
667500 -- [-1006.619] (-1006.330) (-1005.762) (-1005.438) * (-1004.965) (-1008.600) (-1004.391) [-1006.043] -- 0:00:21
668000 -- [-1005.288] (-1012.045) (-1004.867) (-1005.192) * (-1004.831) (-1005.103) [-1005.122] (-1004.203) -- 0:00:21
668500 -- [-1004.859] (-1008.112) (-1006.770) (-1006.005) * (-1007.077) [-1004.798] (-1005.592) (-1005.881) -- 0:00:21
669000 -- [-1003.800] (-1007.479) (-1005.638) (-1004.930) * [-1007.597] (-1006.454) (-1004.354) (-1004.662) -- 0:00:21
669500 -- [-1003.745] (-1015.729) (-1005.420) (-1003.888) * (-1004.456) [-1004.250] (-1003.531) (-1006.005) -- 0:00:21
670000 -- (-1004.989) [-1005.171] (-1004.576) (-1005.375) * [-1004.724] (-1004.456) (-1003.643) (-1007.773) -- 0:00:21
Average standard deviation of split frequencies: 0.012817
670500 -- [-1009.567] (-1006.457) (-1008.763) (-1003.903) * (-1003.255) [-1004.043] (-1005.213) (-1007.051) -- 0:00:21
671000 -- (-1010.740) [-1007.317] (-1004.795) (-1003.724) * (-1003.631) [-1004.019] (-1004.964) (-1005.002) -- 0:00:21
671500 -- (-1011.767) [-1005.412] (-1004.733) (-1005.032) * (-1004.518) [-1007.341] (-1005.870) (-1005.703) -- 0:00:21
672000 -- (-1005.420) [-1006.242] (-1003.959) (-1004.867) * (-1006.053) (-1004.909) (-1007.297) [-1004.256] -- 0:00:20
672500 -- (-1006.215) (-1007.429) (-1004.183) [-1005.168] * (-1006.202) [-1004.888] (-1005.154) (-1006.145) -- 0:00:20
673000 -- (-1006.982) [-1005.944] (-1004.455) (-1008.408) * (-1004.897) (-1006.712) (-1003.570) [-1005.285] -- 0:00:20
673500 -- (-1003.917) [-1007.219] (-1008.549) (-1005.455) * (-1006.580) (-1010.784) (-1008.178) [-1003.830] -- 0:00:20
674000 -- [-1004.648] (-1005.385) (-1006.385) (-1006.982) * (-1004.685) (-1005.175) (-1008.472) [-1006.164] -- 0:00:20
674500 -- [-1005.105] (-1005.129) (-1008.775) (-1006.222) * (-1003.894) (-1006.416) [-1003.860] (-1010.994) -- 0:00:20
675000 -- [-1003.431] (-1003.447) (-1010.553) (-1007.681) * (-1003.840) (-1004.926) [-1007.473] (-1009.477) -- 0:00:20
Average standard deviation of split frequencies: 0.013291
675500 -- (-1007.967) (-1005.855) (-1005.898) [-1003.505] * (-1004.132) (-1004.929) [-1003.970] (-1005.388) -- 0:00:20
676000 -- (-1007.286) [-1004.761] (-1005.918) (-1005.413) * (-1004.581) [-1007.047] (-1007.014) (-1008.452) -- 0:00:20
676500 -- (-1006.673) (-1004.302) [-1003.362] (-1006.243) * (-1005.736) (-1004.836) (-1005.216) [-1005.461] -- 0:00:20
677000 -- (-1006.506) [-1004.143] (-1006.854) (-1004.688) * [-1004.170] (-1007.347) (-1006.340) (-1003.527) -- 0:00:20
677500 -- (-1006.553) [-1004.179] (-1006.532) (-1004.805) * (-1003.758) (-1006.191) (-1004.103) [-1004.394] -- 0:00:20
678000 -- (-1006.643) [-1003.778] (-1006.245) (-1003.345) * (-1006.721) (-1004.959) [-1003.365] (-1003.999) -- 0:00:20
678500 -- [-1005.044] (-1006.160) (-1007.544) (-1004.032) * (-1004.455) [-1006.556] (-1004.257) (-1003.870) -- 0:00:20
679000 -- (-1005.165) (-1004.091) (-1017.750) [-1007.997] * (-1003.605) (-1008.649) (-1004.303) [-1006.775] -- 0:00:20
679500 -- (-1009.325) (-1010.223) (-1006.850) [-1003.789] * (-1003.702) (-1010.944) (-1006.092) [-1005.988] -- 0:00:20
680000 -- (-1004.878) (-1004.014) [-1005.906] (-1006.165) * [-1004.658] (-1005.508) (-1010.158) (-1006.903) -- 0:00:20
Average standard deviation of split frequencies: 0.013072
680500 -- (-1006.285) [-1003.489] (-1005.831) (-1004.054) * [-1003.577] (-1005.508) (-1007.205) (-1010.170) -- 0:00:20
681000 -- (-1008.113) [-1004.534] (-1005.156) (-1004.549) * (-1003.927) [-1004.331] (-1007.385) (-1004.200) -- 0:00:20
681500 -- (-1005.627) [-1003.762] (-1004.766) (-1005.950) * (-1012.138) (-1004.411) (-1006.082) [-1004.975] -- 0:00:20
682000 -- (-1006.477) [-1003.445] (-1004.294) (-1006.735) * [-1004.599] (-1004.963) (-1005.682) (-1005.925) -- 0:00:20
682500 -- (-1004.008) [-1003.153] (-1004.437) (-1004.075) * (-1005.530) (-1005.546) (-1004.757) [-1005.504] -- 0:00:20
683000 -- (-1003.654) (-1003.202) [-1007.480] (-1006.099) * (-1008.416) [-1003.834] (-1005.319) (-1005.153) -- 0:00:20
683500 -- [-1004.453] (-1003.157) (-1006.276) (-1005.468) * [-1005.353] (-1003.804) (-1003.539) (-1007.100) -- 0:00:20
684000 -- (-1004.663) (-1007.684) [-1006.460] (-1009.645) * (-1007.915) (-1003.715) [-1006.865] (-1005.589) -- 0:00:20
684500 -- (-1004.671) (-1004.612) [-1004.877] (-1006.931) * [-1004.206] (-1005.605) (-1003.412) (-1004.511) -- 0:00:20
685000 -- (-1003.837) (-1004.147) (-1003.596) [-1004.872] * (-1004.249) (-1006.568) [-1004.691] (-1004.381) -- 0:00:20
Average standard deviation of split frequencies: 0.013228
685500 -- [-1006.025] (-1008.133) (-1007.411) (-1005.137) * (-1005.116) (-1005.440) (-1008.055) [-1007.950] -- 0:00:20
686000 -- (-1009.898) (-1006.784) [-1006.893] (-1003.963) * [-1005.121] (-1004.276) (-1006.832) (-1005.944) -- 0:00:20
686500 -- (-1008.314) (-1009.312) (-1003.970) [-1003.822] * (-1008.098) (-1005.722) (-1009.113) [-1006.351] -- 0:00:20
687000 -- (-1006.287) (-1008.666) (-1004.689) [-1006.999] * [-1004.183] (-1006.170) (-1009.704) (-1006.193) -- 0:00:20
687500 -- (-1004.473) (-1008.700) (-1006.654) [-1008.349] * (-1010.390) [-1004.026] (-1008.551) (-1006.923) -- 0:00:20
688000 -- (-1005.016) (-1005.299) [-1006.395] (-1007.104) * (-1003.938) (-1004.386) (-1006.491) [-1005.263] -- 0:00:19
688500 -- (-1009.498) [-1005.994] (-1007.927) (-1007.084) * (-1004.622) (-1004.963) [-1004.834] (-1003.370) -- 0:00:19
689000 -- (-1007.410) (-1004.177) [-1005.311] (-1005.601) * (-1003.808) [-1006.173] (-1004.344) (-1003.297) -- 0:00:19
689500 -- (-1008.263) (-1006.797) [-1007.225] (-1003.560) * (-1006.654) (-1006.494) (-1007.104) [-1003.836] -- 0:00:19
690000 -- (-1008.356) (-1006.196) [-1004.631] (-1005.010) * [-1005.888] (-1004.275) (-1004.700) (-1006.553) -- 0:00:19
Average standard deviation of split frequencies: 0.012486
690500 -- (-1005.137) [-1005.740] (-1009.127) (-1007.046) * [-1006.171] (-1003.742) (-1004.469) (-1007.280) -- 0:00:19
691000 -- [-1005.585] (-1004.641) (-1006.331) (-1006.096) * [-1004.174] (-1005.108) (-1004.661) (-1005.032) -- 0:00:19
691500 -- (-1005.126) (-1004.704) (-1006.777) [-1005.095] * (-1005.781) [-1006.029] (-1006.235) (-1003.745) -- 0:00:19
692000 -- (-1004.337) (-1004.140) [-1004.808] (-1005.215) * (-1006.064) (-1004.975) (-1007.123) [-1003.745] -- 0:00:19
692500 -- (-1004.813) (-1006.235) [-1006.162] (-1005.489) * (-1006.026) [-1004.193] (-1005.268) (-1010.051) -- 0:00:19
693000 -- (-1006.229) [-1004.761] (-1009.999) (-1004.829) * (-1005.576) (-1005.351) (-1008.283) [-1008.406] -- 0:00:19
693500 -- [-1006.010] (-1003.399) (-1004.597) (-1007.620) * (-1005.772) [-1004.203] (-1003.891) (-1008.361) -- 0:00:19
694000 -- (-1005.988) (-1004.764) [-1005.886] (-1004.350) * [-1005.529] (-1005.489) (-1009.070) (-1008.992) -- 0:00:19
694500 -- (-1005.967) [-1005.542] (-1004.175) (-1004.421) * (-1005.540) [-1003.841] (-1004.825) (-1006.046) -- 0:00:19
695000 -- [-1005.929] (-1004.903) (-1005.200) (-1005.664) * (-1007.984) [-1004.758] (-1006.374) (-1009.760) -- 0:00:19
Average standard deviation of split frequencies: 0.012191
695500 -- [-1005.847] (-1006.045) (-1003.983) (-1003.605) * (-1004.551) (-1012.228) [-1007.018] (-1005.885) -- 0:00:19
696000 -- (-1004.054) (-1006.595) [-1003.750] (-1004.353) * [-1004.386] (-1010.823) (-1005.137) (-1004.039) -- 0:00:19
696500 -- (-1006.983) (-1008.728) [-1011.160] (-1004.656) * (-1006.734) (-1007.700) (-1005.150) [-1006.898] -- 0:00:19
697000 -- (-1006.859) (-1003.541) (-1007.155) [-1005.741] * (-1008.138) (-1004.503) (-1007.155) [-1006.004] -- 0:00:19
697500 -- (-1003.726) (-1003.501) (-1006.470) [-1004.702] * (-1006.782) [-1004.435] (-1004.680) (-1007.855) -- 0:00:19
698000 -- (-1004.338) (-1003.954) [-1006.678] (-1004.683) * [-1007.653] (-1003.980) (-1007.812) (-1005.627) -- 0:00:19
698500 -- (-1005.099) (-1004.496) (-1003.566) [-1004.408] * (-1010.834) [-1005.210] (-1005.437) (-1009.424) -- 0:00:19
699000 -- [-1004.194] (-1004.517) (-1008.585) (-1004.013) * (-1006.219) [-1003.481] (-1003.601) (-1008.692) -- 0:00:19
699500 -- (-1005.632) (-1006.851) [-1004.697] (-1005.044) * (-1005.948) (-1005.238) [-1008.810] (-1007.996) -- 0:00:19
700000 -- (-1005.465) [-1003.748] (-1008.833) (-1005.010) * [-1004.677] (-1006.350) (-1005.539) (-1005.119) -- 0:00:19
Average standard deviation of split frequencies: 0.012189
700500 -- [-1005.770] (-1004.410) (-1007.316) (-1008.115) * (-1005.196) (-1005.835) (-1006.749) [-1004.408] -- 0:00:19
701000 -- (-1010.510) (-1008.388) [-1007.420] (-1005.322) * [-1005.321] (-1004.728) (-1004.123) (-1004.728) -- 0:00:19
701500 -- (-1008.215) [-1004.192] (-1005.696) (-1005.242) * [-1004.449] (-1008.099) (-1004.649) (-1006.309) -- 0:00:19
702000 -- (-1006.035) (-1006.061) [-1005.308] (-1006.962) * (-1003.612) [-1009.204] (-1005.228) (-1006.091) -- 0:00:19
702500 -- [-1003.554] (-1005.249) (-1004.294) (-1007.161) * (-1006.143) [-1006.533] (-1004.257) (-1006.311) -- 0:00:19
703000 -- (-1004.325) (-1004.387) (-1004.775) [-1004.582] * [-1007.512] (-1005.305) (-1004.337) (-1007.058) -- 0:00:19
703500 -- (-1005.694) (-1007.770) (-1003.731) [-1005.011] * (-1008.650) [-1005.596] (-1004.269) (-1005.947) -- 0:00:18
704000 -- [-1006.568] (-1006.124) (-1004.387) (-1006.995) * [-1006.561] (-1004.402) (-1004.571) (-1007.858) -- 0:00:18
704500 -- [-1006.915] (-1005.235) (-1009.438) (-1007.634) * [-1003.985] (-1004.279) (-1004.336) (-1006.448) -- 0:00:18
705000 -- (-1007.423) (-1004.349) (-1007.435) [-1005.139] * (-1007.182) [-1005.515] (-1005.632) (-1008.020) -- 0:00:18
Average standard deviation of split frequencies: 0.011783
705500 -- (-1004.584) (-1004.501) [-1005.678] (-1004.310) * (-1003.335) (-1003.974) (-1005.692) [-1004.812] -- 0:00:18
706000 -- (-1006.300) (-1004.950) (-1005.415) [-1004.635] * (-1004.429) [-1004.716] (-1005.678) (-1004.640) -- 0:00:18
706500 -- (-1003.732) (-1004.495) (-1005.675) [-1005.292] * (-1007.393) (-1003.732) [-1007.706] (-1004.174) -- 0:00:18
707000 -- (-1004.645) [-1005.114] (-1004.003) (-1004.253) * (-1006.030) [-1003.403] (-1005.566) (-1003.336) -- 0:00:18
707500 -- (-1006.863) (-1009.051) [-1005.075] (-1005.722) * (-1004.896) [-1007.508] (-1005.508) (-1005.494) -- 0:00:18
708000 -- (-1008.736) (-1004.200) [-1007.949] (-1006.689) * (-1004.255) [-1003.971] (-1005.588) (-1004.960) -- 0:00:18
708500 -- (-1006.022) [-1003.565] (-1006.317) (-1005.921) * (-1004.895) [-1004.364] (-1008.577) (-1004.961) -- 0:00:18
709000 -- (-1006.278) [-1005.546] (-1007.423) (-1006.496) * [-1008.179] (-1004.457) (-1004.253) (-1005.969) -- 0:00:18
709500 -- (-1005.934) (-1012.041) (-1008.929) [-1005.769] * [-1003.888] (-1003.834) (-1005.631) (-1008.051) -- 0:00:18
710000 -- (-1004.626) (-1014.465) [-1006.895] (-1006.006) * (-1004.649) (-1004.442) [-1005.729] (-1009.584) -- 0:00:18
Average standard deviation of split frequencies: 0.010925
710500 -- [-1010.431] (-1003.732) (-1010.549) (-1005.324) * (-1004.965) (-1005.228) [-1004.853] (-1006.140) -- 0:00:18
711000 -- (-1006.602) (-1005.413) [-1005.304] (-1003.884) * (-1005.090) (-1006.084) (-1004.946) [-1004.984] -- 0:00:18
711500 -- (-1007.504) [-1003.588] (-1008.445) (-1009.333) * (-1005.215) (-1006.075) [-1005.272] (-1005.090) -- 0:00:18
712000 -- (-1003.592) (-1004.591) (-1005.953) [-1008.300] * (-1005.876) (-1004.882) (-1005.499) [-1003.760] -- 0:00:18
712500 -- (-1004.704) (-1005.337) [-1005.969] (-1009.260) * (-1004.699) [-1008.817] (-1006.554) (-1004.129) -- 0:00:18
713000 -- (-1004.949) (-1005.105) [-1003.283] (-1009.927) * (-1004.316) (-1010.343) (-1006.555) [-1003.883] -- 0:00:18
713500 -- (-1004.232) [-1015.415] (-1004.725) (-1008.805) * (-1006.154) (-1003.826) [-1005.353] (-1003.668) -- 0:00:18
714000 -- (-1007.004) (-1012.309) (-1004.848) [-1003.191] * (-1004.849) (-1003.713) (-1004.835) [-1003.919] -- 0:00:18
714500 -- (-1006.983) (-1009.139) [-1004.119] (-1005.325) * (-1006.768) [-1003.262] (-1008.382) (-1003.764) -- 0:00:18
715000 -- (-1005.810) [-1004.553] (-1011.051) (-1003.637) * [-1004.256] (-1005.796) (-1006.814) (-1004.556) -- 0:00:18
Average standard deviation of split frequencies: 0.010658
715500 -- [-1004.202] (-1006.737) (-1005.957) (-1005.070) * (-1007.213) (-1005.629) [-1005.080] (-1004.077) -- 0:00:18
716000 -- (-1004.848) (-1007.592) (-1007.309) [-1003.822] * [-1004.012] (-1009.604) (-1006.418) (-1003.512) -- 0:00:18
716500 -- (-1006.154) (-1007.869) [-1007.807] (-1008.872) * (-1007.609) (-1007.020) (-1007.179) [-1004.645] -- 0:00:18
717000 -- (-1007.996) [-1004.676] (-1006.280) (-1008.545) * [-1005.614] (-1008.305) (-1005.335) (-1008.904) -- 0:00:18
717500 -- (-1006.458) (-1003.721) (-1003.864) [-1006.812] * (-1005.196) (-1005.858) [-1005.031] (-1007.230) -- 0:00:18
718000 -- [-1003.740] (-1009.708) (-1004.802) (-1009.637) * (-1005.900) (-1003.979) (-1007.631) [-1004.173] -- 0:00:18
718500 -- (-1006.726) [-1005.131] (-1004.654) (-1005.634) * (-1004.771) (-1003.469) [-1009.677] (-1004.145) -- 0:00:18
719000 -- (-1003.728) (-1003.546) [-1004.996] (-1003.861) * [-1005.517] (-1006.811) (-1005.420) (-1004.614) -- 0:00:17
719500 -- (-1008.093) (-1003.513) [-1007.822] (-1003.248) * (-1003.631) (-1006.443) (-1004.019) [-1004.904] -- 0:00:17
720000 -- (-1007.681) [-1004.625] (-1005.171) (-1006.553) * (-1007.643) (-1003.948) (-1011.687) [-1004.861] -- 0:00:17
Average standard deviation of split frequencies: 0.010711
720500 -- [-1007.245] (-1006.452) (-1006.540) (-1003.393) * (-1005.835) (-1005.005) (-1007.504) [-1004.945] -- 0:00:17
721000 -- (-1007.893) [-1004.098] (-1003.392) (-1003.211) * [-1004.550] (-1003.948) (-1004.980) (-1005.670) -- 0:00:17
721500 -- [-1005.444] (-1006.307) (-1005.424) (-1009.097) * (-1006.877) (-1003.698) (-1006.431) [-1005.011] -- 0:00:17
722000 -- (-1009.136) [-1004.035] (-1005.048) (-1007.727) * (-1008.082) (-1007.511) [-1005.356] (-1012.719) -- 0:00:17
722500 -- (-1008.779) (-1012.550) (-1003.578) [-1004.031] * (-1005.179) (-1007.559) [-1003.424] (-1008.066) -- 0:00:17
723000 -- (-1005.211) [-1007.304] (-1003.615) (-1004.774) * (-1004.644) (-1005.855) (-1007.424) [-1006.834] -- 0:00:17
723500 -- [-1005.105] (-1004.915) (-1003.264) (-1003.973) * (-1004.776) (-1005.378) [-1006.222] (-1005.696) -- 0:00:17
724000 -- (-1006.468) (-1007.371) (-1004.239) [-1006.100] * (-1006.437) (-1006.525) [-1004.981] (-1005.392) -- 0:00:17
724500 -- (-1005.914) (-1005.474) [-1005.166] (-1006.581) * (-1004.964) (-1006.349) [-1004.259] (-1010.937) -- 0:00:17
725000 -- [-1005.205] (-1007.780) (-1006.193) (-1008.646) * (-1003.616) [-1003.766] (-1004.045) (-1006.185) -- 0:00:17
Average standard deviation of split frequencies: 0.010673
725500 -- (-1007.966) (-1006.450) (-1010.427) [-1006.593] * (-1004.128) [-1004.962] (-1004.302) (-1006.713) -- 0:00:17
726000 -- (-1007.569) [-1005.293] (-1012.293) (-1005.921) * (-1004.822) [-1005.847] (-1004.421) (-1005.021) -- 0:00:17
726500 -- (-1007.231) [-1005.431] (-1011.038) (-1006.623) * (-1009.199) (-1003.865) (-1004.170) [-1005.771] -- 0:00:17
727000 -- (-1004.765) [-1007.546] (-1016.585) (-1003.633) * (-1004.188) [-1004.240] (-1004.642) (-1005.609) -- 0:00:17
727500 -- (-1006.245) (-1003.836) [-1008.321] (-1003.861) * [-1004.935] (-1009.636) (-1005.193) (-1006.800) -- 0:00:17
728000 -- (-1005.735) (-1006.235) (-1005.246) [-1011.071] * (-1006.987) [-1004.510] (-1004.899) (-1006.400) -- 0:00:17
728500 -- (-1003.909) (-1005.383) [-1005.051] (-1009.715) * [-1005.745] (-1004.281) (-1005.973) (-1006.338) -- 0:00:17
729000 -- (-1005.055) (-1006.621) [-1004.973] (-1005.014) * [-1008.981] (-1008.731) (-1004.547) (-1005.548) -- 0:00:17
729500 -- (-1003.295) [-1006.358] (-1005.366) (-1004.468) * [-1005.618] (-1005.478) (-1004.819) (-1006.668) -- 0:00:17
730000 -- [-1003.291] (-1008.583) (-1004.992) (-1008.375) * (-1003.975) [-1005.017] (-1004.832) (-1004.895) -- 0:00:17
Average standard deviation of split frequencies: 0.010081
730500 -- (-1005.570) (-1003.509) (-1004.141) [-1004.907] * (-1006.384) [-1006.688] (-1003.434) (-1005.104) -- 0:00:17
731000 -- (-1004.506) (-1007.826) (-1004.728) [-1007.322] * (-1006.651) (-1007.681) (-1005.599) [-1005.008] -- 0:00:17
731500 -- (-1004.832) (-1006.203) (-1004.247) [-1005.160] * (-1005.723) (-1005.971) [-1004.411] (-1009.017) -- 0:00:17
732000 -- [-1003.705] (-1004.081) (-1006.717) (-1004.912) * [-1005.655] (-1007.007) (-1004.404) (-1003.695) -- 0:00:17
732500 -- (-1003.804) (-1009.008) (-1005.972) [-1005.263] * (-1009.192) (-1010.813) (-1004.510) [-1004.020] -- 0:00:17
733000 -- (-1004.966) (-1004.835) [-1005.185] (-1005.001) * [-1005.787] (-1004.842) (-1005.189) (-1004.080) -- 0:00:17
733500 -- (-1005.043) [-1003.541] (-1004.399) (-1008.457) * [-1004.624] (-1006.346) (-1005.013) (-1004.473) -- 0:00:17
734000 -- (-1005.887) [-1003.781] (-1004.772) (-1005.717) * (-1005.125) (-1006.325) (-1004.941) [-1007.285] -- 0:00:17
734500 -- (-1008.089) (-1004.884) (-1006.452) [-1004.876] * (-1005.179) (-1006.170) [-1005.883] (-1004.433) -- 0:00:16
735000 -- (-1006.454) [-1003.752] (-1004.941) (-1005.076) * (-1005.636) (-1006.440) [-1004.006] (-1004.420) -- 0:00:16
Average standard deviation of split frequencies: 0.010128
735500 -- (-1010.241) (-1003.808) [-1003.460] (-1004.926) * (-1007.195) (-1007.158) [-1005.359] (-1005.367) -- 0:00:16
736000 -- [-1004.788] (-1004.422) (-1005.949) (-1006.207) * (-1010.737) [-1006.677] (-1005.032) (-1005.547) -- 0:00:16
736500 -- [-1003.659] (-1005.584) (-1007.086) (-1006.660) * (-1006.558) (-1005.407) (-1003.938) [-1004.144] -- 0:00:16
737000 -- [-1006.208] (-1007.385) (-1005.840) (-1006.628) * (-1006.229) [-1004.637] (-1008.727) (-1004.278) -- 0:00:16
737500 -- (-1007.018) (-1005.402) [-1008.916] (-1006.261) * (-1010.258) (-1005.774) [-1006.826] (-1003.956) -- 0:00:16
738000 -- [-1005.696] (-1015.580) (-1007.330) (-1005.570) * [-1003.958] (-1008.956) (-1008.502) (-1004.343) -- 0:00:16
738500 -- (-1005.567) (-1009.114) (-1006.333) [-1004.614] * (-1006.800) (-1006.015) (-1008.039) [-1005.300] -- 0:00:16
739000 -- [-1007.009] (-1007.697) (-1005.972) (-1005.753) * [-1005.441] (-1007.385) (-1011.339) (-1004.444) -- 0:00:16
739500 -- [-1004.049] (-1006.760) (-1005.336) (-1006.093) * (-1007.514) (-1007.844) [-1005.988] (-1006.898) -- 0:00:16
740000 -- (-1004.264) (-1004.122) [-1006.632] (-1005.500) * (-1005.967) (-1005.251) (-1007.161) [-1008.507] -- 0:00:16
Average standard deviation of split frequencies: 0.009786
740500 -- [-1004.990] (-1003.873) (-1006.241) (-1005.342) * (-1007.255) [-1007.739] (-1003.572) (-1008.527) -- 0:00:16
741000 -- (-1003.878) (-1006.936) [-1004.334] (-1006.742) * [-1006.496] (-1005.513) (-1008.348) (-1003.620) -- 0:00:16
741500 -- (-1004.087) [-1006.909] (-1005.890) (-1006.585) * (-1006.943) [-1004.952] (-1006.988) (-1004.592) -- 0:00:16
742000 -- (-1006.710) (-1005.744) [-1005.874] (-1004.292) * [-1005.393] (-1006.140) (-1005.520) (-1007.504) -- 0:00:16
742500 -- [-1008.011] (-1004.701) (-1004.530) (-1004.432) * (-1005.692) [-1007.345] (-1007.931) (-1005.171) -- 0:00:16
743000 -- (-1012.419) [-1009.235] (-1005.689) (-1008.448) * (-1006.650) (-1006.202) [-1008.222] (-1008.073) -- 0:00:16
743500 -- (-1009.399) [-1005.457] (-1007.031) (-1008.342) * [-1005.078] (-1004.354) (-1004.394) (-1006.901) -- 0:00:16
744000 -- [-1004.870] (-1005.575) (-1005.097) (-1006.513) * [-1006.526] (-1004.262) (-1010.926) (-1006.085) -- 0:00:16
744500 -- (-1005.267) (-1005.786) [-1005.695] (-1004.383) * [-1006.139] (-1005.438) (-1006.158) (-1009.380) -- 0:00:16
745000 -- (-1007.035) [-1007.506] (-1004.041) (-1007.567) * (-1005.676) (-1003.774) (-1004.386) [-1006.043] -- 0:00:16
Average standard deviation of split frequencies: 0.010071
745500 -- [-1005.756] (-1006.182) (-1003.771) (-1006.811) * (-1004.587) (-1008.522) (-1004.446) [-1003.969] -- 0:00:16
746000 -- [-1008.940] (-1006.429) (-1004.042) (-1010.934) * [-1004.960] (-1008.197) (-1013.681) (-1006.442) -- 0:00:16
746500 -- (-1006.429) (-1004.924) [-1005.226] (-1007.921) * (-1005.182) [-1007.749] (-1006.107) (-1004.741) -- 0:00:16
747000 -- [-1005.893] (-1005.024) (-1005.314) (-1004.728) * [-1003.051] (-1006.555) (-1006.481) (-1004.500) -- 0:00:16
747500 -- (-1007.070) (-1006.043) [-1004.067] (-1007.767) * (-1005.083) (-1006.605) (-1005.817) [-1005.058] -- 0:00:16
748000 -- [-1004.324] (-1004.372) (-1003.495) (-1004.722) * (-1006.889) (-1003.765) (-1011.293) [-1005.403] -- 0:00:16
748500 -- (-1004.788) [-1004.254] (-1003.686) (-1004.038) * (-1006.109) (-1003.743) [-1007.453] (-1003.383) -- 0:00:16
749000 -- (-1007.570) [-1004.215] (-1005.448) (-1004.993) * (-1006.364) (-1005.402) (-1006.881) [-1006.679] -- 0:00:16
749500 -- [-1004.162] (-1012.020) (-1004.190) (-1005.300) * [-1003.825] (-1010.964) (-1005.284) (-1007.350) -- 0:00:16
750000 -- (-1007.476) (-1005.894) [-1004.416] (-1004.655) * [-1005.479] (-1006.719) (-1006.324) (-1004.096) -- 0:00:16
Average standard deviation of split frequencies: 0.010283
750500 -- (-1003.992) [-1004.304] (-1006.489) (-1006.601) * (-1004.051) (-1003.526) [-1006.411] (-1004.721) -- 0:00:15
751000 -- [-1004.339] (-1005.283) (-1006.100) (-1005.946) * (-1004.776) [-1003.396] (-1005.959) (-1008.207) -- 0:00:15
751500 -- [-1004.530] (-1005.859) (-1003.543) (-1003.534) * [-1005.794] (-1003.302) (-1005.274) (-1005.570) -- 0:00:15
752000 -- (-1003.678) (-1005.602) [-1003.640] (-1004.190) * [-1005.585] (-1005.198) (-1007.290) (-1009.061) -- 0:00:15
752500 -- (-1004.408) [-1004.407] (-1005.097) (-1004.033) * [-1005.036] (-1003.298) (-1005.949) (-1007.702) -- 0:00:15
753000 -- (-1007.415) (-1003.954) [-1007.146] (-1004.272) * [-1004.709] (-1004.200) (-1003.898) (-1008.226) -- 0:00:15
753500 -- [-1006.114] (-1008.840) (-1009.271) (-1004.143) * (-1005.535) (-1006.009) [-1003.679] (-1004.471) -- 0:00:15
754000 -- [-1005.670] (-1008.649) (-1017.136) (-1004.147) * (-1007.337) (-1003.801) [-1003.582] (-1003.763) -- 0:00:15
754500 -- [-1006.994] (-1004.482) (-1009.379) (-1008.194) * (-1005.046) [-1005.161] (-1003.915) (-1006.955) -- 0:00:15
755000 -- (-1005.996) (-1004.679) [-1009.041] (-1004.741) * (-1004.922) [-1003.775] (-1004.979) (-1009.689) -- 0:00:15
Average standard deviation of split frequencies: 0.010444
755500 -- (-1009.877) [-1006.529] (-1005.186) (-1006.361) * (-1004.031) (-1003.647) (-1003.294) [-1006.574] -- 0:00:15
756000 -- (-1004.832) [-1005.568] (-1005.029) (-1009.060) * (-1004.512) (-1003.544) (-1004.038) [-1004.387] -- 0:00:15
756500 -- (-1007.118) (-1005.863) (-1004.395) [-1007.164] * (-1004.048) (-1005.202) [-1004.778] (-1008.397) -- 0:00:15
757000 -- (-1005.734) (-1008.213) [-1004.437] (-1007.590) * [-1004.705] (-1005.859) (-1005.466) (-1006.751) -- 0:00:15
757500 -- (-1005.774) (-1005.619) [-1004.653] (-1008.197) * (-1007.507) (-1009.845) (-1003.420) [-1006.497] -- 0:00:15
758000 -- [-1006.241] (-1003.621) (-1006.924) (-1006.957) * (-1005.925) (-1007.912) [-1003.510] (-1004.201) -- 0:00:15
758500 -- (-1005.170) (-1005.529) (-1004.064) [-1006.175] * (-1004.400) (-1007.634) [-1003.764] (-1004.037) -- 0:00:15
759000 -- (-1006.835) (-1006.412) [-1005.776] (-1005.542) * (-1003.717) (-1010.121) (-1005.463) [-1004.458] -- 0:00:15
759500 -- (-1008.111) (-1005.285) (-1004.209) [-1004.742] * [-1003.959] (-1006.356) (-1005.708) (-1005.276) -- 0:00:15
760000 -- (-1008.597) (-1004.198) [-1005.417] (-1009.936) * (-1005.131) (-1004.517) [-1005.282] (-1006.187) -- 0:00:15
Average standard deviation of split frequencies: 0.010497
760500 -- (-1006.805) (-1004.295) [-1004.778] (-1005.351) * (-1006.379) (-1003.826) [-1006.711] (-1005.023) -- 0:00:15
761000 -- (-1004.323) [-1004.314] (-1007.814) (-1005.297) * (-1005.469) (-1005.213) (-1007.364) [-1005.062] -- 0:00:15
761500 -- (-1006.068) (-1004.140) (-1005.327) [-1004.989] * (-1005.720) [-1003.763] (-1007.813) (-1006.425) -- 0:00:15
762000 -- (-1005.125) [-1004.683] (-1005.592) (-1007.687) * (-1004.859) (-1006.138) [-1007.075] (-1014.117) -- 0:00:15
762500 -- (-1012.402) (-1006.233) [-1005.845] (-1004.082) * [-1004.173] (-1006.900) (-1008.373) (-1006.046) -- 0:00:15
763000 -- [-1006.763] (-1005.331) (-1004.369) (-1004.559) * (-1003.978) [-1006.844] (-1010.739) (-1006.935) -- 0:00:15
763500 -- (-1004.441) (-1009.854) (-1006.162) [-1004.886] * (-1004.492) [-1007.294] (-1006.903) (-1007.963) -- 0:00:15
764000 -- (-1004.090) [-1003.777] (-1004.464) (-1006.791) * (-1004.740) (-1006.042) [-1006.042] (-1007.760) -- 0:00:15
764500 -- (-1006.841) (-1006.368) [-1005.697] (-1007.769) * (-1007.953) (-1005.668) (-1005.192) [-1004.740] -- 0:00:15
765000 -- (-1010.621) (-1005.388) [-1004.087] (-1012.079) * [-1005.115] (-1004.502) (-1008.838) (-1004.912) -- 0:00:15
Average standard deviation of split frequencies: 0.010654
765500 -- (-1006.266) [-1005.501] (-1003.691) (-1004.998) * (-1005.945) [-1004.262] (-1006.410) (-1004.128) -- 0:00:15
766000 -- (-1005.763) [-1005.544] (-1006.845) (-1004.851) * (-1005.041) [-1004.271] (-1006.042) (-1004.024) -- 0:00:14
766500 -- [-1007.433] (-1006.280) (-1006.320) (-1004.399) * (-1005.792) (-1005.135) (-1004.822) [-1005.071] -- 0:00:14
767000 -- (-1008.435) (-1008.408) (-1004.686) [-1003.504] * (-1010.415) (-1003.528) [-1004.468] (-1004.632) -- 0:00:14
767500 -- [-1005.817] (-1005.872) (-1003.920) (-1003.830) * [-1007.653] (-1004.333) (-1004.391) (-1004.009) -- 0:00:14
768000 -- (-1003.501) (-1009.080) (-1009.064) [-1004.179] * (-1006.055) (-1009.387) [-1006.455] (-1004.017) -- 0:00:14
768500 -- (-1009.024) (-1006.115) (-1007.238) [-1007.493] * [-1004.185] (-1006.579) (-1005.054) (-1004.855) -- 0:00:14
769000 -- [-1008.080] (-1008.242) (-1006.668) (-1008.147) * (-1009.500) [-1006.015] (-1007.107) (-1004.808) -- 0:00:14
769500 -- (-1004.378) (-1005.328) [-1006.209] (-1005.034) * (-1005.022) (-1008.236) (-1004.405) [-1004.256] -- 0:00:14
770000 -- [-1004.832] (-1007.164) (-1006.298) (-1004.759) * [-1005.133] (-1008.285) (-1004.855) (-1005.945) -- 0:00:14
Average standard deviation of split frequencies: 0.010666
770500 -- (-1004.469) [-1003.355] (-1007.839) (-1004.425) * (-1003.764) (-1008.543) [-1004.888] (-1004.444) -- 0:00:14
771000 -- (-1006.215) [-1003.654] (-1005.641) (-1003.753) * (-1007.472) (-1005.078) [-1006.070] (-1004.508) -- 0:00:14
771500 -- (-1005.890) (-1004.361) (-1008.045) [-1004.615] * (-1004.545) (-1004.486) (-1005.672) [-1004.111] -- 0:00:14
772000 -- (-1005.273) (-1005.411) (-1004.012) [-1005.261] * (-1013.998) [-1005.512] (-1010.111) (-1004.069) -- 0:00:14
772500 -- [-1004.788] (-1007.405) (-1006.257) (-1011.562) * (-1015.850) (-1005.206) (-1007.252) [-1003.880] -- 0:00:14
773000 -- [-1004.723] (-1007.349) (-1005.271) (-1008.212) * (-1013.742) (-1004.571) (-1006.670) [-1007.709] -- 0:00:14
773500 -- (-1007.637) [-1004.787] (-1003.713) (-1009.871) * (-1007.037) (-1005.368) (-1008.308) [-1006.378] -- 0:00:14
774000 -- (-1008.178) [-1007.326] (-1005.910) (-1005.084) * [-1009.159] (-1005.484) (-1010.999) (-1004.274) -- 0:00:14
774500 -- (-1008.239) (-1006.558) (-1008.489) [-1003.649] * [-1004.308] (-1006.649) (-1010.844) (-1004.828) -- 0:00:14
775000 -- (-1020.009) (-1006.780) (-1006.786) [-1007.151] * (-1006.696) (-1010.620) (-1009.041) [-1004.183] -- 0:00:14
Average standard deviation of split frequencies: 0.010631
775500 -- [-1004.886] (-1008.727) (-1004.772) (-1005.572) * (-1003.410) (-1005.885) [-1005.286] (-1004.545) -- 0:00:14
776000 -- [-1005.763] (-1005.524) (-1008.111) (-1008.551) * (-1004.795) (-1004.613) [-1006.731] (-1007.864) -- 0:00:14
776500 -- (-1005.240) (-1003.728) (-1005.285) [-1007.838] * (-1006.247) (-1006.832) (-1011.417) [-1006.094] -- 0:00:14
777000 -- (-1005.129) (-1004.197) (-1004.277) [-1005.279] * (-1005.071) [-1006.973] (-1005.285) (-1004.545) -- 0:00:14
777500 -- [-1006.930] (-1005.812) (-1009.033) (-1007.326) * (-1005.405) (-1006.006) [-1004.162] (-1005.213) -- 0:00:14
778000 -- (-1006.944) (-1006.070) (-1004.777) [-1006.645] * (-1004.532) (-1004.763) [-1004.758] (-1005.651) -- 0:00:14
778500 -- (-1005.867) (-1006.497) (-1006.367) [-1006.902] * (-1004.270) (-1005.761) (-1006.968) [-1004.951] -- 0:00:14
779000 -- [-1004.014] (-1004.458) (-1004.390) (-1003.878) * (-1004.426) [-1004.391] (-1006.919) (-1003.579) -- 0:00:14
779500 -- [-1003.535] (-1004.548) (-1007.273) (-1006.138) * (-1004.812) (-1012.911) [-1006.567] (-1003.579) -- 0:00:14
780000 -- (-1004.682) (-1006.260) (-1006.524) [-1005.056] * [-1003.571] (-1008.014) (-1007.421) (-1008.881) -- 0:00:14
Average standard deviation of split frequencies: 0.011473
780500 -- (-1003.406) (-1008.197) (-1007.827) [-1008.951] * [-1004.587] (-1008.536) (-1004.719) (-1006.707) -- 0:00:14
781000 -- (-1006.542) [-1007.983] (-1003.430) (-1008.123) * [-1005.656] (-1005.353) (-1004.988) (-1007.234) -- 0:00:14
781500 -- (-1006.083) [-1004.822] (-1006.058) (-1009.416) * (-1004.971) (-1005.679) [-1003.948] (-1006.399) -- 0:00:13
782000 -- (-1008.116) (-1004.014) [-1003.293] (-1006.979) * [-1005.416] (-1010.104) (-1004.137) (-1005.114) -- 0:00:13
782500 -- (-1007.008) [-1004.941] (-1004.594) (-1007.545) * (-1009.113) (-1008.513) (-1003.484) [-1003.939] -- 0:00:13
783000 -- (-1003.954) [-1004.630] (-1004.596) (-1005.535) * (-1006.440) [-1008.352] (-1003.974) (-1004.285) -- 0:00:13
783500 -- (-1007.603) (-1006.536) (-1007.851) [-1005.048] * (-1003.877) [-1008.682] (-1003.195) (-1004.208) -- 0:00:13
784000 -- (-1005.694) (-1004.683) [-1004.054] (-1003.633) * (-1004.929) (-1004.005) (-1004.027) [-1004.374] -- 0:00:13
784500 -- (-1004.191) (-1006.449) [-1005.177] (-1004.397) * [-1004.745] (-1003.442) (-1008.229) (-1003.635) -- 0:00:13
785000 -- (-1003.430) (-1004.242) (-1006.942) [-1010.021] * [-1005.155] (-1004.287) (-1005.236) (-1007.109) -- 0:00:13
Average standard deviation of split frequencies: 0.011245
785500 -- (-1006.365) (-1004.739) (-1006.767) [-1010.131] * (-1005.868) [-1007.646] (-1004.002) (-1011.545) -- 0:00:13
786000 -- (-1007.887) (-1006.555) [-1005.988] (-1005.504) * (-1005.000) [-1003.504] (-1005.215) (-1003.921) -- 0:00:13
786500 -- (-1008.066) [-1007.003] (-1007.103) (-1005.557) * [-1005.434] (-1005.212) (-1013.604) (-1005.674) -- 0:00:13
787000 -- [-1006.341] (-1007.136) (-1005.154) (-1004.521) * (-1009.852) [-1004.153] (-1015.312) (-1003.650) -- 0:00:13
787500 -- (-1004.964) (-1005.013) [-1004.752] (-1005.478) * (-1006.184) (-1007.213) [-1007.452] (-1004.701) -- 0:00:13
788000 -- (-1008.888) [-1005.341] (-1006.557) (-1005.502) * (-1004.692) (-1006.393) (-1005.000) [-1004.976] -- 0:00:13
788500 -- (-1006.942) [-1010.311] (-1007.250) (-1005.498) * (-1004.517) (-1006.692) [-1006.734] (-1003.825) -- 0:00:13
789000 -- (-1005.984) (-1010.393) (-1009.157) [-1005.538] * (-1005.729) (-1004.946) (-1010.603) [-1004.543] -- 0:00:13
789500 -- (-1007.293) (-1004.463) [-1003.877] (-1004.817) * (-1003.949) [-1007.686] (-1010.322) (-1004.149) -- 0:00:13
790000 -- (-1006.299) [-1004.644] (-1008.929) (-1007.430) * (-1004.535) (-1005.916) (-1010.157) [-1003.868] -- 0:00:13
Average standard deviation of split frequencies: 0.011403
790500 -- [-1005.051] (-1003.905) (-1006.863) (-1006.423) * (-1004.968) (-1009.470) (-1007.901) [-1005.357] -- 0:00:13
791000 -- (-1004.947) (-1007.323) (-1008.968) [-1005.798] * (-1006.391) (-1007.956) [-1008.222] (-1008.730) -- 0:00:13
791500 -- [-1003.487] (-1004.083) (-1007.525) (-1005.821) * (-1009.085) (-1007.631) [-1005.880] (-1004.820) -- 0:00:13
792000 -- [-1004.888] (-1004.369) (-1005.535) (-1013.460) * [-1005.717] (-1005.854) (-1004.676) (-1008.834) -- 0:00:13
792500 -- [-1008.591] (-1011.902) (-1004.484) (-1013.055) * [-1006.084] (-1004.741) (-1007.851) (-1006.290) -- 0:00:13
793000 -- (-1009.262) (-1005.422) [-1008.822] (-1009.447) * (-1008.979) [-1003.807] (-1012.109) (-1005.920) -- 0:00:13
793500 -- (-1005.762) [-1006.630] (-1005.633) (-1004.552) * (-1007.673) (-1006.183) (-1009.461) [-1005.274] -- 0:00:13
794000 -- (-1006.269) (-1008.282) [-1003.523] (-1003.431) * (-1006.191) [-1005.377] (-1006.493) (-1004.845) -- 0:00:13
794500 -- (-1004.001) (-1005.486) (-1006.099) [-1004.968] * (-1007.029) (-1006.927) [-1006.837] (-1005.776) -- 0:00:13
795000 -- [-1004.131] (-1005.102) (-1003.230) (-1005.002) * (-1004.810) (-1010.227) [-1007.386] (-1005.015) -- 0:00:13
Average standard deviation of split frequencies: 0.011437
795500 -- (-1005.304) (-1006.210) [-1006.686] (-1004.948) * (-1005.767) (-1003.342) (-1010.192) [-1005.985] -- 0:00:13
796000 -- [-1004.415] (-1003.954) (-1004.247) (-1006.352) * (-1007.757) (-1003.261) (-1007.387) [-1006.630] -- 0:00:13
796500 -- (-1004.278) [-1003.983] (-1005.482) (-1004.070) * [-1006.892] (-1005.767) (-1005.384) (-1009.094) -- 0:00:13
797000 -- (-1005.125) (-1009.202) (-1006.756) [-1003.597] * [-1005.524] (-1004.957) (-1007.897) (-1011.064) -- 0:00:12
797500 -- [-1005.852] (-1005.133) (-1007.276) (-1004.024) * (-1005.956) [-1005.681] (-1003.875) (-1003.433) -- 0:00:12
798000 -- (-1004.721) [-1003.546] (-1005.408) (-1009.685) * (-1006.070) (-1003.943) (-1004.741) [-1006.530] -- 0:00:12
798500 -- [-1004.459] (-1010.192) (-1006.212) (-1004.852) * (-1006.847) (-1006.739) [-1006.338] (-1004.960) -- 0:00:12
799000 -- (-1004.132) [-1007.690] (-1006.204) (-1005.179) * (-1003.675) (-1006.782) (-1006.520) [-1003.247] -- 0:00:12
799500 -- (-1007.569) [-1007.131] (-1004.287) (-1005.590) * (-1006.874) (-1005.589) (-1005.088) [-1004.380] -- 0:00:12
800000 -- (-1004.983) (-1005.679) [-1005.766] (-1004.872) * [-1007.537] (-1004.605) (-1005.091) (-1004.283) -- 0:00:12
Average standard deviation of split frequencies: 0.010929
800500 -- (-1003.957) [-1006.861] (-1008.062) (-1007.490) * (-1006.776) [-1006.108] (-1005.103) (-1005.974) -- 0:00:12
801000 -- [-1003.325] (-1004.707) (-1005.522) (-1006.099) * (-1005.964) (-1005.994) (-1005.263) [-1003.471] -- 0:00:12
801500 -- (-1003.922) [-1005.123] (-1005.581) (-1006.978) * [-1004.623] (-1005.783) (-1003.781) (-1003.561) -- 0:00:12
802000 -- (-1005.204) [-1004.880] (-1005.384) (-1005.468) * (-1006.297) [-1006.384] (-1004.430) (-1004.667) -- 0:00:12
802500 -- (-1005.274) (-1005.633) (-1004.347) [-1004.347] * (-1004.034) [-1004.118] (-1005.242) (-1006.807) -- 0:00:12
803000 -- (-1003.688) (-1005.389) [-1005.590] (-1004.666) * (-1004.298) [-1006.816] (-1003.931) (-1005.571) -- 0:00:12
803500 -- (-1004.304) (-1006.573) (-1006.544) [-1005.990] * (-1004.975) [-1003.324] (-1006.028) (-1004.853) -- 0:00:12
804000 -- (-1004.054) (-1003.556) [-1004.481] (-1005.189) * (-1005.449) [-1003.727] (-1004.592) (-1006.232) -- 0:00:12
804500 -- [-1004.501] (-1004.145) (-1009.027) (-1009.117) * (-1006.460) [-1004.069] (-1008.408) (-1005.061) -- 0:00:12
805000 -- (-1003.625) (-1004.654) (-1007.723) [-1006.271] * (-1006.427) (-1006.878) (-1008.511) [-1005.797] -- 0:00:12
Average standard deviation of split frequencies: 0.010857
805500 -- (-1004.644) (-1004.064) (-1004.592) [-1004.626] * [-1008.824] (-1005.700) (-1003.508) (-1005.174) -- 0:00:12
806000 -- (-1004.760) (-1012.742) (-1004.884) [-1005.370] * (-1008.846) (-1006.591) (-1003.896) [-1006.474] -- 0:00:12
806500 -- (-1003.972) (-1009.228) [-1005.994] (-1003.566) * (-1006.207) (-1004.489) (-1004.243) [-1003.626] -- 0:00:12
807000 -- [-1007.093] (-1005.915) (-1006.892) (-1006.423) * (-1004.747) (-1006.856) [-1005.769] (-1005.878) -- 0:00:12
807500 -- [-1007.209] (-1004.016) (-1007.161) (-1004.076) * [-1004.923] (-1004.460) (-1008.831) (-1005.036) -- 0:00:12
808000 -- (-1004.472) (-1005.513) [-1005.276] (-1010.028) * (-1003.663) (-1006.971) [-1008.501] (-1004.906) -- 0:00:12
808500 -- (-1004.752) (-1009.360) (-1007.775) [-1003.894] * (-1004.346) (-1003.884) [-1007.517] (-1004.028) -- 0:00:12
809000 -- (-1005.985) (-1006.280) [-1006.736] (-1003.259) * (-1006.384) [-1005.402] (-1007.538) (-1005.852) -- 0:00:12
809500 -- (-1005.634) (-1003.546) (-1005.897) [-1003.270] * (-1010.021) (-1004.494) (-1004.615) [-1006.943] -- 0:00:12
810000 -- (-1005.355) (-1004.472) (-1004.915) [-1003.656] * (-1008.583) [-1007.942] (-1003.565) (-1007.056) -- 0:00:12
Average standard deviation of split frequencies: 0.010467
810500 -- (-1005.987) [-1004.325] (-1004.457) (-1004.770) * (-1006.659) [-1004.059] (-1004.297) (-1005.476) -- 0:00:12
811000 -- (-1007.922) (-1005.711) (-1006.135) [-1003.507] * (-1006.762) (-1004.180) [-1003.665] (-1005.319) -- 0:00:12
811500 -- [-1011.757] (-1003.870) (-1003.584) (-1005.878) * [-1003.368] (-1006.354) (-1006.554) (-1004.030) -- 0:00:12
812000 -- (-1008.820) (-1006.770) (-1005.764) [-1006.557] * (-1004.758) (-1009.417) [-1008.399] (-1004.616) -- 0:00:12
812500 -- (-1008.207) [-1007.210] (-1006.127) (-1006.517) * (-1005.148) (-1005.951) (-1005.114) [-1004.863] -- 0:00:12
813000 -- (-1007.984) [-1008.266] (-1005.088) (-1004.553) * (-1003.928) (-1004.700) [-1003.474] (-1004.080) -- 0:00:11
813500 -- (-1008.956) (-1009.797) [-1004.202] (-1003.425) * [-1003.404] (-1003.896) (-1006.191) (-1006.027) -- 0:00:11
814000 -- (-1005.033) (-1004.367) [-1006.330] (-1007.431) * [-1003.820] (-1006.608) (-1003.722) (-1005.714) -- 0:00:11
814500 -- (-1005.142) (-1004.790) (-1004.375) [-1004.404] * [-1005.097] (-1004.269) (-1005.742) (-1004.908) -- 0:00:11
815000 -- [-1005.307] (-1004.790) (-1006.304) (-1005.189) * (-1005.080) (-1003.832) [-1004.914] (-1010.414) -- 0:00:11
Average standard deviation of split frequencies: 0.010435
815500 -- (-1008.381) [-1003.408] (-1004.890) (-1004.836) * (-1006.389) [-1003.798] (-1007.609) (-1007.077) -- 0:00:11
816000 -- (-1005.870) [-1003.769] (-1007.618) (-1004.121) * (-1003.936) (-1009.618) (-1007.505) [-1005.263] -- 0:00:11
816500 -- (-1005.435) [-1004.211] (-1005.029) (-1004.134) * (-1004.735) (-1003.695) [-1006.333] (-1011.362) -- 0:00:11
817000 -- (-1006.055) [-1004.192] (-1004.503) (-1004.277) * (-1004.004) (-1006.719) [-1005.653] (-1006.307) -- 0:00:11
817500 -- (-1005.265) [-1003.334] (-1006.187) (-1004.980) * (-1005.009) [-1006.921] (-1006.578) (-1006.313) -- 0:00:11
818000 -- (-1009.516) [-1003.469] (-1007.360) (-1004.241) * [-1003.438] (-1005.678) (-1007.420) (-1006.084) -- 0:00:11
818500 -- (-1005.924) (-1003.518) (-1008.277) [-1004.914] * (-1003.438) (-1005.929) (-1005.130) [-1005.019] -- 0:00:11
819000 -- [-1008.304] (-1005.632) (-1004.594) (-1005.189) * [-1005.422] (-1003.306) (-1005.557) (-1004.421) -- 0:00:11
819500 -- (-1004.276) (-1005.889) (-1007.616) [-1007.516] * [-1004.651] (-1006.319) (-1004.254) (-1006.906) -- 0:00:11
820000 -- (-1009.068) [-1004.581] (-1003.900) (-1008.825) * [-1005.621] (-1006.135) (-1006.452) (-1006.535) -- 0:00:11
Average standard deviation of split frequencies: 0.010375
820500 -- (-1010.196) (-1004.641) (-1006.715) [-1006.524] * (-1005.001) (-1004.586) (-1007.137) [-1004.642] -- 0:00:11
821000 -- (-1004.637) [-1009.397] (-1003.653) (-1003.568) * (-1005.073) [-1005.200] (-1007.879) (-1003.832) -- 0:00:11
821500 -- [-1004.601] (-1007.656) (-1003.938) (-1004.547) * (-1004.718) [-1005.529] (-1004.823) (-1007.396) -- 0:00:11
822000 -- [-1007.351] (-1009.853) (-1004.841) (-1004.904) * (-1005.205) [-1004.905] (-1004.733) (-1008.465) -- 0:00:11
822500 -- (-1006.865) (-1010.347) [-1004.896] (-1006.595) * (-1004.032) (-1005.271) [-1005.578] (-1006.045) -- 0:00:11
823000 -- (-1005.234) (-1012.848) [-1004.394] (-1005.053) * [-1006.296] (-1007.382) (-1005.093) (-1005.145) -- 0:00:11
823500 -- (-1009.116) (-1008.216) [-1005.300] (-1004.520) * (-1007.331) [-1003.899] (-1007.760) (-1004.382) -- 0:00:11
824000 -- (-1005.325) [-1011.427] (-1007.518) (-1005.461) * [-1009.327] (-1003.671) (-1006.053) (-1004.643) -- 0:00:11
824500 -- (-1004.886) [-1006.200] (-1007.365) (-1004.466) * [-1004.334] (-1004.421) (-1009.972) (-1004.919) -- 0:00:11
825000 -- (-1004.552) (-1006.963) [-1004.238] (-1008.976) * [-1003.817] (-1004.068) (-1003.643) (-1005.163) -- 0:00:11
Average standard deviation of split frequencies: 0.010629
825500 -- (-1004.602) (-1006.533) (-1005.192) [-1007.584] * (-1004.013) (-1004.055) [-1005.456] (-1005.560) -- 0:00:11
826000 -- (-1006.499) (-1007.007) [-1005.524] (-1004.285) * [-1007.627] (-1004.894) (-1006.253) (-1003.756) -- 0:00:11
826500 -- [-1004.434] (-1005.828) (-1007.714) (-1007.852) * (-1008.628) (-1007.429) [-1004.936] (-1004.024) -- 0:00:11
827000 -- (-1004.601) (-1006.410) [-1004.250] (-1005.397) * (-1006.005) (-1005.995) [-1005.458] (-1006.585) -- 0:00:11
827500 -- [-1004.837] (-1005.609) (-1009.694) (-1006.949) * [-1008.063] (-1004.788) (-1006.517) (-1006.019) -- 0:00:11
828000 -- (-1005.677) (-1013.826) (-1007.510) [-1003.602] * (-1006.803) (-1005.478) [-1007.004] (-1005.915) -- 0:00:11
828500 -- [-1004.168] (-1005.979) (-1009.932) (-1007.306) * (-1005.025) (-1004.720) [-1003.868] (-1006.435) -- 0:00:10
829000 -- (-1006.019) [-1004.910] (-1006.422) (-1004.626) * (-1005.970) [-1006.935] (-1004.364) (-1005.954) -- 0:00:10
829500 -- [-1003.609] (-1004.319) (-1004.519) (-1007.481) * (-1004.932) (-1007.243) (-1004.215) [-1009.044] -- 0:00:10
830000 -- (-1005.133) (-1005.348) [-1006.701] (-1003.814) * (-1003.216) (-1008.201) (-1004.735) [-1006.166] -- 0:00:10
Average standard deviation of split frequencies: 0.010499
830500 -- [-1008.486] (-1006.939) (-1007.688) (-1006.769) * (-1004.597) [-1004.707] (-1003.757) (-1008.789) -- 0:00:10
831000 -- (-1009.680) (-1007.775) [-1006.875] (-1006.015) * [-1004.393] (-1005.855) (-1003.761) (-1008.563) -- 0:00:10
831500 -- (-1005.086) (-1005.700) [-1005.986] (-1007.006) * [-1004.587] (-1007.006) (-1003.258) (-1004.609) -- 0:00:10
832000 -- [-1009.860] (-1003.658) (-1005.163) (-1003.727) * [-1003.680] (-1006.742) (-1003.831) (-1006.030) -- 0:00:10
832500 -- (-1005.057) (-1004.281) (-1007.207) [-1003.201] * (-1005.069) (-1005.210) (-1005.573) [-1005.609] -- 0:00:10
833000 -- (-1004.974) (-1006.007) (-1013.779) [-1003.670] * [-1005.847] (-1006.757) (-1006.339) (-1005.451) -- 0:00:10
833500 -- [-1005.636] (-1004.042) (-1005.441) (-1005.212) * (-1004.203) (-1011.314) (-1006.787) [-1005.515] -- 0:00:10
834000 -- (-1006.199) (-1010.425) (-1004.682) [-1006.049] * (-1004.041) [-1004.175] (-1006.688) (-1006.000) -- 0:00:10
834500 -- [-1005.906] (-1004.600) (-1007.733) (-1005.370) * (-1005.452) (-1003.566) [-1007.290] (-1005.265) -- 0:00:10
835000 -- [-1005.627] (-1003.848) (-1007.043) (-1004.545) * (-1005.570) [-1003.800] (-1010.206) (-1006.415) -- 0:00:10
Average standard deviation of split frequencies: 0.010502
835500 -- (-1008.798) (-1005.079) [-1007.487] (-1005.302) * (-1005.200) [-1005.844] (-1008.084) (-1006.706) -- 0:00:10
836000 -- (-1009.166) (-1006.904) [-1006.957] (-1006.508) * [-1006.852] (-1007.296) (-1004.288) (-1003.965) -- 0:00:10
836500 -- [-1003.272] (-1006.051) (-1005.967) (-1004.181) * [-1008.084] (-1007.219) (-1008.360) (-1007.338) -- 0:00:10
837000 -- (-1004.102) (-1004.386) [-1007.286] (-1005.190) * (-1010.803) (-1004.540) [-1005.630] (-1004.735) -- 0:00:10
837500 -- (-1006.545) [-1005.112] (-1004.706) (-1005.025) * (-1010.453) (-1004.350) [-1006.578] (-1004.135) -- 0:00:10
838000 -- (-1005.694) (-1010.234) (-1006.990) [-1004.731] * [-1009.271] (-1005.765) (-1004.661) (-1004.144) -- 0:00:10
838500 -- (-1004.550) (-1006.038) [-1006.364] (-1006.239) * [-1004.588] (-1006.934) (-1005.521) (-1010.562) -- 0:00:10
839000 -- (-1005.307) (-1009.490) [-1005.336] (-1004.496) * [-1005.810] (-1004.355) (-1005.618) (-1005.692) -- 0:00:10
839500 -- (-1006.035) (-1006.407) [-1006.257] (-1007.720) * [-1004.954] (-1004.317) (-1004.526) (-1004.421) -- 0:00:10
840000 -- (-1006.820) (-1004.376) [-1003.900] (-1007.333) * [-1005.626] (-1005.498) (-1008.320) (-1006.444) -- 0:00:10
Average standard deviation of split frequencies: 0.010724
840500 -- (-1004.464) (-1005.172) (-1010.863) [-1006.104] * (-1003.990) (-1004.000) (-1008.089) [-1003.607] -- 0:00:10
841000 -- (-1004.575) [-1003.423] (-1008.980) (-1004.372) * (-1003.307) (-1004.674) (-1006.083) [-1004.088] -- 0:00:10
841500 -- (-1005.595) (-1003.960) [-1006.552] (-1003.584) * (-1004.005) [-1010.098] (-1007.740) (-1007.742) -- 0:00:10
842000 -- (-1006.486) [-1003.860] (-1010.494) (-1004.301) * (-1003.666) (-1011.135) [-1007.772] (-1008.385) -- 0:00:10
842500 -- (-1005.522) [-1009.610] (-1003.780) (-1006.628) * (-1008.192) [-1007.330] (-1007.644) (-1004.262) -- 0:00:10
843000 -- (-1005.681) [-1004.842] (-1004.193) (-1005.910) * [-1009.189] (-1003.565) (-1007.635) (-1004.309) -- 0:00:10
843500 -- (-1005.602) [-1006.414] (-1004.310) (-1007.338) * (-1005.470) (-1003.442) [-1003.705] (-1005.699) -- 0:00:10
844000 -- [-1005.406] (-1008.315) (-1005.517) (-1005.329) * (-1004.181) (-1007.898) (-1004.292) [-1008.492] -- 0:00:09
844500 -- (-1006.663) (-1004.867) (-1003.886) [-1003.179] * (-1006.363) (-1004.508) [-1004.248] (-1015.098) -- 0:00:09
845000 -- (-1009.947) (-1005.375) (-1004.965) [-1008.400] * [-1004.549] (-1007.092) (-1004.056) (-1007.798) -- 0:00:09
Average standard deviation of split frequencies: 0.010204
845500 -- (-1006.564) (-1003.408) [-1003.781] (-1008.111) * [-1005.025] (-1004.368) (-1003.993) (-1005.187) -- 0:00:09
846000 -- (-1006.356) [-1003.201] (-1004.136) (-1004.753) * (-1005.972) (-1005.613) [-1004.899] (-1004.383) -- 0:00:09
846500 -- (-1007.684) (-1004.209) [-1005.891] (-1004.634) * (-1004.324) [-1006.165] (-1007.075) (-1005.270) -- 0:00:09
847000 -- (-1004.861) (-1005.314) (-1004.811) [-1008.464] * (-1005.321) (-1005.141) [-1005.729] (-1010.026) -- 0:00:09
847500 -- (-1003.845) (-1008.862) (-1004.259) [-1004.197] * (-1005.979) (-1006.669) (-1004.510) [-1004.013] -- 0:00:09
848000 -- (-1005.347) (-1005.934) [-1003.607] (-1004.040) * (-1006.101) (-1005.633) (-1004.958) [-1005.390] -- 0:00:09
848500 -- (-1004.063) (-1005.291) (-1003.637) [-1003.660] * (-1005.290) [-1005.901] (-1005.784) (-1005.390) -- 0:00:09
849000 -- (-1007.915) (-1007.375) [-1003.522] (-1003.680) * [-1005.122] (-1007.410) (-1005.188) (-1005.390) -- 0:00:09
849500 -- (-1005.186) (-1005.456) [-1004.726] (-1005.410) * (-1003.712) [-1005.708] (-1006.027) (-1005.662) -- 0:00:09
850000 -- (-1005.146) (-1005.966) (-1006.502) [-1003.425] * [-1003.927] (-1007.963) (-1007.979) (-1005.278) -- 0:00:09
Average standard deviation of split frequencies: 0.010148
850500 -- [-1004.916] (-1005.222) (-1005.090) (-1003.655) * [-1004.219] (-1007.672) (-1005.230) (-1010.398) -- 0:00:09
851000 -- (-1005.459) (-1004.677) [-1007.088] (-1003.639) * (-1004.879) (-1007.026) (-1004.135) [-1006.377] -- 0:00:09
851500 -- (-1003.835) [-1008.978] (-1008.465) (-1005.380) * (-1010.421) (-1007.491) [-1004.880] (-1005.030) -- 0:00:09
852000 -- (-1004.625) (-1008.206) [-1003.952] (-1005.856) * (-1006.552) [-1007.543] (-1003.349) (-1008.474) -- 0:00:09
852500 -- [-1005.588] (-1007.632) (-1008.651) (-1006.342) * (-1009.510) [-1005.937] (-1006.038) (-1008.252) -- 0:00:09
853000 -- (-1003.803) (-1006.510) (-1004.903) [-1005.547] * (-1006.457) (-1004.880) [-1005.813] (-1008.109) -- 0:00:09
853500 -- (-1005.632) (-1008.370) [-1004.426] (-1003.587) * (-1004.518) (-1005.167) [-1005.265] (-1006.278) -- 0:00:09
854000 -- (-1005.487) (-1004.462) [-1007.603] (-1003.510) * [-1006.329] (-1007.877) (-1003.868) (-1004.709) -- 0:00:09
854500 -- (-1007.036) (-1006.363) (-1004.357) [-1004.159] * (-1008.558) (-1005.533) [-1006.248] (-1006.451) -- 0:00:09
855000 -- (-1007.476) (-1005.616) (-1008.171) [-1006.238] * (-1004.411) (-1005.164) (-1006.369) [-1009.002] -- 0:00:09
Average standard deviation of split frequencies: 0.010222
855500 -- [-1008.054] (-1007.061) (-1005.329) (-1008.409) * (-1005.717) [-1004.460] (-1006.946) (-1004.349) -- 0:00:09
856000 -- (-1005.673) (-1011.126) [-1004.201] (-1012.042) * (-1005.081) (-1005.716) [-1006.952] (-1007.153) -- 0:00:09
856500 -- (-1006.822) (-1007.531) (-1003.807) [-1006.360] * (-1004.213) [-1005.375] (-1007.242) (-1006.470) -- 0:00:09
857000 -- (-1004.089) (-1009.274) [-1004.448] (-1011.762) * (-1006.488) [-1003.149] (-1004.839) (-1004.898) -- 0:00:09
857500 -- [-1003.715] (-1004.610) (-1004.329) (-1003.990) * (-1004.628) [-1003.533] (-1004.653) (-1004.347) -- 0:00:09
858000 -- [-1006.033] (-1007.712) (-1004.038) (-1004.563) * (-1003.691) [-1004.947] (-1006.158) (-1006.060) -- 0:00:09
858500 -- [-1005.712] (-1011.511) (-1008.401) (-1007.971) * (-1004.951) (-1005.650) (-1004.692) [-1004.251] -- 0:00:09
859000 -- (-1004.655) (-1009.249) (-1014.847) [-1003.671] * (-1004.409) [-1005.380] (-1007.501) (-1007.355) -- 0:00:09
859500 -- (-1006.957) (-1008.169) (-1005.253) [-1004.769] * [-1003.858] (-1007.800) (-1008.165) (-1010.421) -- 0:00:08
860000 -- (-1009.306) (-1008.262) [-1004.656] (-1005.878) * [-1003.520] (-1009.334) (-1008.029) (-1006.335) -- 0:00:08
Average standard deviation of split frequencies: 0.010133
860500 -- [-1007.092] (-1007.690) (-1008.788) (-1008.291) * [-1003.615] (-1005.740) (-1007.288) (-1004.738) -- 0:00:08
861000 -- [-1005.464] (-1004.552) (-1004.025) (-1007.864) * [-1003.692] (-1006.243) (-1009.341) (-1004.818) -- 0:00:08
861500 -- (-1004.574) [-1006.276] (-1006.759) (-1004.422) * [-1005.360] (-1004.032) (-1004.066) (-1004.441) -- 0:00:08
862000 -- (-1007.294) (-1009.721) (-1005.624) [-1004.302] * [-1007.243] (-1005.885) (-1007.396) (-1006.222) -- 0:00:08
862500 -- (-1008.025) (-1006.320) (-1006.745) [-1005.165] * (-1005.701) [-1004.523] (-1005.040) (-1004.332) -- 0:00:08
863000 -- (-1004.746) (-1005.983) [-1004.978] (-1006.854) * (-1005.432) [-1003.898] (-1007.290) (-1008.911) -- 0:00:08
863500 -- (-1006.009) (-1004.720) (-1006.542) [-1004.986] * (-1006.366) (-1003.976) [-1003.400] (-1005.152) -- 0:00:08
864000 -- (-1005.083) (-1005.059) (-1003.389) [-1005.431] * (-1008.138) (-1005.554) [-1003.365] (-1005.150) -- 0:00:08
864500 -- [-1003.742] (-1003.580) (-1004.000) (-1004.255) * (-1009.332) (-1007.005) (-1005.526) [-1004.241] -- 0:00:08
865000 -- (-1004.812) (-1003.945) [-1004.749] (-1007.384) * (-1005.232) [-1008.884] (-1007.102) (-1004.443) -- 0:00:08
Average standard deviation of split frequencies: 0.010002
865500 -- (-1005.323) [-1003.566] (-1005.216) (-1005.557) * [-1005.576] (-1006.127) (-1006.443) (-1007.115) -- 0:00:08
866000 -- [-1006.885] (-1005.242) (-1008.245) (-1005.316) * (-1007.931) (-1008.419) (-1008.440) [-1005.431] -- 0:00:08
866500 -- [-1005.649] (-1004.454) (-1007.067) (-1004.917) * [-1006.861] (-1007.801) (-1006.888) (-1005.103) -- 0:00:08
867000 -- (-1005.740) (-1004.680) [-1006.442] (-1007.454) * (-1006.744) [-1011.301] (-1007.473) (-1006.896) -- 0:00:08
867500 -- (-1005.057) [-1007.328] (-1008.201) (-1005.168) * (-1004.353) (-1008.311) (-1007.009) [-1005.654] -- 0:00:08
868000 -- (-1004.417) (-1008.265) (-1004.802) [-1004.036] * [-1004.115] (-1006.746) (-1008.699) (-1007.143) -- 0:00:08
868500 -- (-1009.552) (-1005.827) [-1004.929] (-1006.499) * (-1003.784) (-1005.933) [-1006.683] (-1008.082) -- 0:00:08
869000 -- [-1011.421] (-1004.803) (-1005.889) (-1003.783) * (-1005.147) (-1006.991) [-1006.282] (-1006.460) -- 0:00:08
869500 -- (-1006.535) (-1004.253) (-1004.784) [-1005.447] * (-1007.241) (-1008.193) (-1006.112) [-1007.857] -- 0:00:08
870000 -- (-1007.486) (-1005.301) (-1004.952) [-1005.269] * (-1006.299) (-1003.450) (-1006.302) [-1005.645] -- 0:00:08
Average standard deviation of split frequencies: 0.009509
870500 -- (-1004.228) [-1004.341] (-1005.867) (-1005.689) * [-1005.247] (-1005.776) (-1006.537) (-1005.059) -- 0:00:08
871000 -- [-1004.120] (-1005.906) (-1006.005) (-1005.183) * (-1004.774) [-1005.735] (-1007.756) (-1006.376) -- 0:00:08
871500 -- [-1003.764] (-1010.417) (-1007.209) (-1006.140) * [-1004.006] (-1005.731) (-1005.306) (-1005.569) -- 0:00:08
872000 -- (-1004.933) (-1004.924) [-1004.160] (-1006.597) * (-1006.742) (-1010.667) (-1005.658) [-1005.187] -- 0:00:08
872500 -- (-1008.026) [-1006.856] (-1003.888) (-1004.356) * (-1004.995) [-1006.483] (-1004.807) (-1006.791) -- 0:00:08
873000 -- (-1004.239) [-1004.658] (-1005.023) (-1004.994) * (-1003.740) (-1003.814) (-1009.846) [-1006.758] -- 0:00:08
873500 -- (-1005.906) [-1006.482] (-1007.505) (-1003.465) * [-1003.421] (-1005.257) (-1006.591) (-1004.199) -- 0:00:08
874000 -- (-1005.530) (-1005.850) (-1009.133) [-1004.865] * [-1004.162] (-1009.046) (-1005.359) (-1003.305) -- 0:00:08
874500 -- [-1005.353] (-1007.448) (-1005.598) (-1003.888) * [-1007.151] (-1004.861) (-1004.382) (-1007.241) -- 0:00:08
875000 -- (-1006.820) [-1006.733] (-1008.099) (-1005.733) * [-1005.029] (-1004.814) (-1005.908) (-1005.073) -- 0:00:08
Average standard deviation of split frequencies: 0.009619
875500 -- (-1004.769) [-1005.079] (-1004.729) (-1005.981) * [-1005.057] (-1004.814) (-1005.081) (-1005.642) -- 0:00:07
876000 -- (-1005.444) (-1005.305) (-1006.424) [-1004.801] * (-1003.918) (-1004.363) [-1005.561] (-1005.524) -- 0:00:07
876500 -- (-1005.433) (-1005.948) (-1009.292) [-1004.781] * (-1003.988) (-1004.484) (-1005.156) [-1004.485] -- 0:00:07
877000 -- (-1003.496) [-1007.877] (-1008.831) (-1003.742) * (-1009.321) [-1003.936] (-1003.799) (-1004.764) -- 0:00:07
877500 -- (-1004.944) (-1004.667) [-1010.488] (-1005.989) * (-1004.123) [-1004.597] (-1003.657) (-1007.069) -- 0:00:07
878000 -- (-1006.879) [-1003.780] (-1004.162) (-1009.738) * [-1005.003] (-1005.522) (-1004.507) (-1006.362) -- 0:00:07
878500 -- (-1006.600) [-1004.001] (-1004.652) (-1005.189) * (-1004.165) (-1006.214) [-1009.746] (-1004.357) -- 0:00:07
879000 -- (-1007.377) (-1003.933) (-1004.238) [-1005.758] * (-1004.757) (-1005.208) (-1006.803) [-1003.748] -- 0:00:07
879500 -- (-1010.085) [-1006.565] (-1003.687) (-1004.817) * (-1006.657) [-1004.822] (-1005.463) (-1007.138) -- 0:00:07
880000 -- (-1007.885) [-1007.289] (-1006.233) (-1003.877) * (-1006.400) (-1005.683) [-1006.105] (-1005.554) -- 0:00:07
Average standard deviation of split frequencies: 0.009702
880500 -- (-1007.229) (-1008.400) [-1006.351] (-1004.892) * (-1004.195) (-1006.644) [-1007.385] (-1005.363) -- 0:00:07
881000 -- (-1007.955) (-1005.847) (-1008.158) [-1003.201] * (-1005.366) (-1007.917) (-1006.011) [-1004.709] -- 0:00:07
881500 -- (-1006.460) [-1007.390] (-1009.134) (-1006.293) * [-1006.980] (-1004.794) (-1005.812) (-1005.170) -- 0:00:07
882000 -- [-1003.939] (-1007.028) (-1006.243) (-1008.004) * (-1008.254) (-1007.396) (-1004.084) [-1005.039] -- 0:00:07
882500 -- (-1003.996) (-1011.372) (-1005.563) [-1007.089] * (-1004.117) (-1006.049) (-1004.702) [-1006.085] -- 0:00:07
883000 -- [-1004.295] (-1006.582) (-1004.710) (-1004.346) * (-1004.410) [-1003.529] (-1006.825) (-1006.573) -- 0:00:07
883500 -- (-1005.234) [-1005.764] (-1004.645) (-1003.447) * (-1007.690) [-1004.658] (-1007.387) (-1006.339) -- 0:00:07
884000 -- (-1006.667) [-1007.992] (-1004.341) (-1009.733) * [-1005.257] (-1005.992) (-1004.537) (-1009.738) -- 0:00:07
884500 -- (-1003.219) [-1006.565] (-1004.564) (-1009.782) * (-1010.859) [-1006.003] (-1004.283) (-1004.747) -- 0:00:07
885000 -- [-1003.491] (-1005.299) (-1006.199) (-1007.143) * (-1006.698) [-1003.838] (-1005.301) (-1005.902) -- 0:00:07
Average standard deviation of split frequencies: 0.009710
885500 -- (-1004.289) (-1005.344) [-1009.766] (-1006.555) * (-1006.447) [-1004.018] (-1005.204) (-1004.897) -- 0:00:07
886000 -- [-1006.052] (-1007.746) (-1007.803) (-1008.133) * [-1006.919] (-1006.538) (-1005.058) (-1006.406) -- 0:00:07
886500 -- (-1008.927) [-1008.250] (-1003.863) (-1006.061) * (-1006.316) [-1005.045] (-1005.932) (-1008.390) -- 0:00:07
887000 -- (-1005.594) [-1008.641] (-1003.913) (-1007.745) * (-1008.412) (-1003.656) (-1006.285) [-1008.359] -- 0:00:07
887500 -- (-1005.049) (-1004.884) [-1006.462] (-1005.221) * (-1005.213) [-1003.760] (-1004.989) (-1005.540) -- 0:00:07
888000 -- (-1006.050) (-1006.243) (-1006.707) [-1003.577] * [-1004.835] (-1006.304) (-1005.718) (-1004.623) -- 0:00:07
888500 -- (-1004.464) (-1010.404) [-1004.583] (-1003.614) * (-1007.567) (-1005.898) (-1005.800) [-1003.106] -- 0:00:07
889000 -- [-1004.774] (-1010.548) (-1004.430) (-1003.710) * (-1004.950) [-1007.197] (-1005.121) (-1008.134) -- 0:00:06
889500 -- [-1003.626] (-1007.327) (-1006.298) (-1007.890) * (-1003.742) (-1003.663) (-1003.553) [-1008.609] -- 0:00:06
890000 -- (-1006.229) (-1007.013) (-1004.419) [-1006.425] * (-1004.273) [-1007.706] (-1005.383) (-1012.274) -- 0:00:07
Average standard deviation of split frequencies: 0.009957
890500 -- (-1005.955) [-1005.109] (-1004.767) (-1005.459) * (-1005.333) (-1010.527) [-1006.042] (-1005.553) -- 0:00:07
891000 -- [-1004.802] (-1004.714) (-1005.965) (-1004.915) * [-1004.977] (-1007.700) (-1006.962) (-1006.891) -- 0:00:06
891500 -- (-1005.100) [-1005.860] (-1004.585) (-1005.228) * (-1005.021) (-1009.478) [-1009.618] (-1007.305) -- 0:00:06
892000 -- (-1004.144) (-1006.780) [-1005.306] (-1005.094) * [-1004.416] (-1005.215) (-1005.186) (-1005.858) -- 0:00:06
892500 -- (-1004.162) (-1005.239) [-1005.300] (-1005.020) * [-1006.451] (-1006.638) (-1004.269) (-1005.995) -- 0:00:06
893000 -- (-1006.781) [-1004.635] (-1005.488) (-1004.956) * [-1006.581] (-1003.481) (-1005.263) (-1008.667) -- 0:00:06
893500 -- (-1004.141) (-1006.495) (-1005.041) [-1004.627] * (-1005.696) (-1004.829) [-1007.041] (-1005.331) -- 0:00:06
894000 -- (-1004.947) [-1004.760] (-1003.974) (-1007.815) * [-1004.600] (-1008.714) (-1003.551) (-1013.281) -- 0:00:06
894500 -- [-1006.134] (-1011.007) (-1005.861) (-1004.583) * (-1003.544) (-1003.567) [-1003.671] (-1008.436) -- 0:00:06
895000 -- (-1004.465) [-1007.176] (-1009.828) (-1004.309) * (-1003.299) [-1006.153] (-1003.762) (-1006.435) -- 0:00:06
Average standard deviation of split frequencies: 0.009832
895500 -- (-1003.946) (-1005.277) [-1005.748] (-1003.817) * [-1004.315] (-1004.591) (-1004.420) (-1005.845) -- 0:00:06
896000 -- [-1005.011] (-1004.102) (-1008.471) (-1004.994) * [-1004.614] (-1003.931) (-1006.677) (-1006.600) -- 0:00:06
896500 -- (-1010.226) (-1005.502) (-1007.662) [-1006.389] * [-1004.618] (-1004.811) (-1004.499) (-1004.908) -- 0:00:06
897000 -- (-1003.716) (-1004.940) [-1006.665] (-1006.738) * (-1005.433) (-1005.220) (-1006.143) [-1004.203] -- 0:00:06
897500 -- (-1004.842) (-1004.655) (-1005.716) [-1006.642] * (-1006.117) (-1004.331) (-1006.236) [-1007.202] -- 0:00:06
898000 -- (-1006.658) (-1004.333) (-1004.147) [-1005.244] * (-1004.484) (-1005.087) (-1007.125) [-1005.375] -- 0:00:06
898500 -- [-1007.743] (-1005.216) (-1007.529) (-1007.658) * (-1008.718) [-1004.407] (-1003.276) (-1005.518) -- 0:00:06
899000 -- (-1007.362) [-1005.508] (-1011.543) (-1011.318) * [-1005.613] (-1006.516) (-1006.519) (-1011.584) -- 0:00:06
899500 -- [-1004.705] (-1004.479) (-1004.262) (-1008.638) * (-1004.599) (-1005.870) [-1009.979] (-1008.111) -- 0:00:06
900000 -- (-1007.013) (-1006.439) [-1004.410] (-1005.600) * (-1004.418) (-1004.800) (-1006.974) [-1006.983] -- 0:00:06
Average standard deviation of split frequencies: 0.009912
900500 -- (-1005.655) (-1007.374) [-1003.725] (-1005.750) * [-1004.604] (-1003.250) (-1007.842) (-1008.048) -- 0:00:06
901000 -- [-1004.538] (-1007.893) (-1006.191) (-1006.735) * (-1004.390) (-1003.250) (-1004.089) [-1004.475] -- 0:00:06
901500 -- [-1004.712] (-1004.553) (-1006.028) (-1004.224) * (-1003.949) (-1003.250) [-1004.675] (-1004.080) -- 0:00:06
902000 -- (-1004.333) (-1004.500) (-1004.387) [-1004.140] * (-1003.993) (-1005.352) (-1006.108) [-1004.853] -- 0:00:06
902500 -- (-1005.323) (-1005.103) [-1004.780] (-1004.744) * [-1006.507] (-1008.481) (-1004.773) (-1005.639) -- 0:00:06
903000 -- (-1010.207) (-1009.012) [-1004.923] (-1007.189) * (-1005.005) (-1006.356) [-1006.883] (-1003.675) -- 0:00:06
903500 -- (-1007.744) (-1003.928) [-1005.584] (-1006.741) * (-1005.981) (-1005.383) (-1005.277) [-1004.674] -- 0:00:06
904000 -- [-1005.085] (-1006.716) (-1004.359) (-1006.668) * (-1004.615) (-1007.417) [-1004.407] (-1004.563) -- 0:00:06
904500 -- [-1004.726] (-1006.391) (-1004.207) (-1005.027) * (-1007.788) (-1004.655) (-1004.557) [-1004.027] -- 0:00:06
905000 -- (-1005.866) (-1004.371) [-1003.277] (-1005.692) * (-1005.797) [-1005.733] (-1004.739) (-1010.498) -- 0:00:05
Average standard deviation of split frequencies: 0.010049
905500 -- (-1004.775) (-1005.271) [-1003.308] (-1007.613) * [-1004.938] (-1005.547) (-1005.330) (-1008.871) -- 0:00:06
906000 -- (-1005.116) (-1005.324) [-1004.153] (-1006.551) * (-1006.256) [-1006.314] (-1004.675) (-1005.180) -- 0:00:06
906500 -- [-1003.664] (-1004.014) (-1011.301) (-1007.985) * (-1007.914) (-1008.012) [-1003.511] (-1004.610) -- 0:00:05
907000 -- (-1004.381) [-1004.560] (-1005.980) (-1008.188) * (-1005.044) [-1008.248] (-1003.372) (-1005.177) -- 0:00:05
907500 -- (-1007.019) (-1004.893) (-1008.352) [-1006.741] * (-1008.995) (-1004.358) [-1007.228] (-1007.086) -- 0:00:05
908000 -- (-1009.430) [-1003.435] (-1005.201) (-1007.778) * (-1007.028) [-1007.936] (-1004.596) (-1003.562) -- 0:00:05
908500 -- (-1007.130) (-1006.891) [-1004.976] (-1012.378) * [-1007.856] (-1006.952) (-1004.369) (-1007.659) -- 0:00:05
909000 -- (-1006.795) [-1006.462] (-1004.677) (-1009.591) * [-1008.683] (-1005.905) (-1006.170) (-1006.720) -- 0:00:05
909500 -- [-1004.229] (-1004.011) (-1004.552) (-1008.853) * (-1010.373) [-1004.292] (-1004.475) (-1006.763) -- 0:00:05
910000 -- (-1004.753) [-1005.904] (-1005.030) (-1006.016) * (-1003.561) [-1006.150] (-1004.893) (-1010.553) -- 0:00:05
Average standard deviation of split frequencies: 0.010159
910500 -- (-1008.267) (-1004.895) (-1004.233) [-1006.829] * (-1004.072) (-1005.795) [-1003.966] (-1008.624) -- 0:00:05
911000 -- (-1005.198) [-1004.744] (-1005.862) (-1003.877) * (-1007.227) [-1005.382] (-1005.634) (-1006.864) -- 0:00:05
911500 -- (-1005.273) (-1003.800) (-1004.471) [-1008.132] * (-1004.451) [-1004.019] (-1006.320) (-1005.367) -- 0:00:05
912000 -- (-1008.950) (-1006.095) [-1007.309] (-1007.668) * (-1008.081) [-1005.829] (-1007.717) (-1008.615) -- 0:00:05
912500 -- (-1010.126) (-1009.974) (-1006.843) [-1004.403] * [-1005.228] (-1006.665) (-1007.041) (-1005.544) -- 0:00:05
913000 -- [-1004.870] (-1003.570) (-1004.757) (-1005.836) * (-1006.426) [-1011.849] (-1005.745) (-1004.070) -- 0:00:05
913500 -- (-1005.515) (-1004.341) [-1004.629] (-1004.956) * (-1008.359) (-1004.518) [-1005.107] (-1004.878) -- 0:00:05
914000 -- (-1006.236) (-1005.215) (-1008.571) [-1006.482] * (-1004.715) (-1006.695) (-1004.757) [-1005.835] -- 0:00:05
914500 -- (-1009.234) (-1007.650) [-1005.794] (-1004.408) * (-1005.021) [-1004.601] (-1004.704) (-1006.984) -- 0:00:05
915000 -- (-1006.981) [-1007.324] (-1005.132) (-1005.049) * (-1003.817) [-1007.687] (-1004.249) (-1005.611) -- 0:00:05
Average standard deviation of split frequencies: 0.010293
915500 -- [-1006.711] (-1004.262) (-1007.821) (-1005.867) * (-1006.063) [-1010.306] (-1006.711) (-1004.098) -- 0:00:05
916000 -- [-1006.996] (-1003.629) (-1004.732) (-1009.586) * (-1007.165) (-1004.638) (-1004.212) [-1003.686] -- 0:00:05
916500 -- [-1007.594] (-1009.206) (-1005.896) (-1007.204) * (-1007.569) [-1005.246] (-1006.279) (-1004.454) -- 0:00:05
917000 -- (-1004.294) (-1010.971) (-1007.066) [-1004.034] * (-1006.120) [-1004.978] (-1008.115) (-1004.009) -- 0:00:05
917500 -- (-1007.944) [-1005.455] (-1005.013) (-1003.893) * (-1007.132) (-1005.282) (-1007.241) [-1003.420] -- 0:00:05
918000 -- (-1006.417) (-1003.597) [-1004.718] (-1006.605) * (-1004.235) (-1005.586) [-1006.465] (-1004.977) -- 0:00:05
918500 -- (-1004.475) (-1004.113) (-1006.115) [-1004.265] * (-1005.344) (-1004.437) (-1006.144) [-1004.395] -- 0:00:05
919000 -- (-1004.155) (-1008.694) (-1005.305) [-1006.607] * (-1004.235) [-1005.849] (-1004.663) (-1006.253) -- 0:00:05
919500 -- [-1004.754] (-1011.678) (-1005.465) (-1007.656) * (-1005.036) (-1004.880) [-1007.990] (-1005.812) -- 0:00:05
920000 -- (-1006.439) (-1004.532) (-1003.119) [-1006.104] * (-1006.004) (-1005.035) (-1007.353) [-1005.904] -- 0:00:05
Average standard deviation of split frequencies: 0.010112
920500 -- (-1005.072) (-1004.962) [-1004.332] (-1004.571) * (-1006.220) [-1005.031] (-1006.397) (-1004.410) -- 0:00:05
921000 -- (-1004.504) (-1004.355) [-1005.090] (-1004.505) * (-1013.470) [-1005.472] (-1005.793) (-1003.754) -- 0:00:05
921500 -- (-1009.181) (-1004.017) [-1005.895] (-1004.448) * (-1011.662) (-1008.136) (-1005.904) [-1003.270] -- 0:00:05
922000 -- (-1008.164) (-1005.269) [-1005.058] (-1006.985) * (-1007.657) [-1008.825] (-1003.935) (-1004.884) -- 0:00:04
922500 -- (-1007.374) [-1004.066] (-1008.695) (-1003.922) * (-1004.704) (-1014.368) [-1004.418] (-1006.270) -- 0:00:04
923000 -- (-1006.903) (-1005.006) (-1003.639) [-1008.026] * (-1004.048) (-1007.267) [-1006.146] (-1006.033) -- 0:00:04
923500 -- [-1006.681] (-1009.964) (-1005.896) (-1006.275) * (-1004.207) [-1005.663] (-1004.563) (-1007.727) -- 0:00:04
924000 -- [-1005.381] (-1007.664) (-1006.019) (-1006.357) * (-1003.797) (-1004.645) [-1003.961] (-1010.322) -- 0:00:04
924500 -- (-1004.629) (-1007.650) [-1006.157] (-1010.788) * (-1010.850) (-1005.096) (-1003.946) [-1005.600] -- 0:00:04
925000 -- (-1004.572) [-1003.681] (-1007.088) (-1007.179) * (-1009.176) (-1003.536) (-1004.894) [-1003.421] -- 0:00:04
Average standard deviation of split frequencies: 0.009863
925500 -- (-1005.951) [-1003.744] (-1005.809) (-1004.766) * (-1007.620) (-1003.688) (-1003.895) [-1004.434] -- 0:00:04
926000 -- [-1004.240] (-1003.771) (-1003.415) (-1006.382) * [-1004.480] (-1004.056) (-1006.070) (-1007.971) -- 0:00:04
926500 -- (-1005.333) (-1007.096) [-1004.842] (-1004.489) * (-1004.678) [-1003.580] (-1007.254) (-1006.637) -- 0:00:04
927000 -- [-1005.239] (-1005.050) (-1003.961) (-1005.435) * (-1006.655) [-1003.750] (-1013.981) (-1005.053) -- 0:00:04
927500 -- (-1007.830) [-1003.805] (-1004.066) (-1003.063) * [-1005.735] (-1005.431) (-1007.239) (-1006.792) -- 0:00:04
928000 -- (-1006.010) (-1004.320) (-1003.536) [-1003.385] * [-1003.401] (-1005.063) (-1005.861) (-1006.471) -- 0:00:04
928500 -- [-1005.634] (-1004.885) (-1003.570) (-1003.639) * (-1010.619) (-1005.114) (-1005.181) [-1004.608] -- 0:00:04
929000 -- (-1004.994) (-1005.464) (-1006.162) [-1004.142] * [-1005.576] (-1005.412) (-1004.232) (-1004.800) -- 0:00:04
929500 -- [-1005.182] (-1004.877) (-1005.166) (-1005.206) * [-1003.642] (-1005.996) (-1005.453) (-1004.551) -- 0:00:04
930000 -- [-1005.546] (-1005.810) (-1004.216) (-1005.947) * (-1004.910) (-1004.399) [-1004.811] (-1007.599) -- 0:00:04
Average standard deviation of split frequencies: 0.010320
930500 -- (-1004.514) (-1003.856) (-1005.390) [-1004.401] * [-1004.453] (-1010.171) (-1007.896) (-1003.475) -- 0:00:04
931000 -- (-1010.153) [-1003.632] (-1007.728) (-1005.256) * (-1006.011) (-1009.227) [-1005.636] (-1007.003) -- 0:00:04
931500 -- (-1007.311) (-1004.581) (-1006.934) [-1005.343] * [-1006.027] (-1005.584) (-1007.742) (-1004.273) -- 0:00:04
932000 -- (-1005.440) [-1005.011] (-1006.769) (-1005.183) * (-1003.764) (-1005.904) [-1008.791] (-1005.063) -- 0:00:04
932500 -- (-1005.497) (-1005.799) (-1004.775) [-1003.612] * (-1006.738) (-1007.601) [-1006.494] (-1004.579) -- 0:00:04
933000 -- [-1004.120] (-1008.397) (-1004.069) (-1003.393) * (-1010.044) (-1008.296) [-1005.529] (-1005.073) -- 0:00:04
933500 -- (-1003.764) (-1007.849) [-1004.773] (-1009.215) * (-1005.334) [-1006.808] (-1006.062) (-1004.708) -- 0:00:04
934000 -- (-1004.183) [-1009.455] (-1004.723) (-1007.014) * [-1008.227] (-1005.887) (-1009.637) (-1009.134) -- 0:00:04
934500 -- (-1003.771) (-1005.746) [-1003.685] (-1008.599) * (-1004.661) (-1005.642) (-1004.790) [-1005.736] -- 0:00:04
935000 -- (-1003.640) (-1004.134) (-1004.345) [-1005.107] * (-1003.991) (-1005.057) (-1004.674) [-1005.659] -- 0:00:04
Average standard deviation of split frequencies: 0.010230
935500 -- (-1004.726) [-1004.776] (-1003.126) (-1013.280) * (-1004.127) (-1006.651) (-1004.500) [-1003.842] -- 0:00:04
936000 -- [-1005.825] (-1006.449) (-1005.543) (-1010.518) * [-1006.892] (-1005.349) (-1004.808) (-1003.767) -- 0:00:04
936500 -- (-1004.603) (-1007.598) [-1005.420] (-1008.755) * [-1008.596] (-1010.187) (-1004.520) (-1003.379) -- 0:00:04
937000 -- (-1004.000) [-1004.049] (-1005.631) (-1006.044) * (-1005.217) (-1004.277) (-1004.066) [-1003.683] -- 0:00:04
937500 -- [-1004.093] (-1003.951) (-1004.788) (-1004.579) * [-1004.682] (-1009.315) (-1004.202) (-1004.409) -- 0:00:04
938000 -- (-1005.020) (-1005.979) [-1005.048] (-1005.023) * (-1004.564) (-1008.186) (-1006.483) [-1004.376] -- 0:00:03
938500 -- (-1007.182) (-1005.240) (-1007.289) [-1003.542] * (-1004.563) (-1005.518) (-1005.331) [-1006.116] -- 0:00:03
939000 -- (-1004.618) (-1004.714) (-1005.388) [-1003.760] * (-1008.109) (-1008.998) [-1003.485] (-1005.114) -- 0:00:03
939500 -- (-1003.858) [-1004.715] (-1008.565) (-1004.011) * (-1005.577) [-1003.995] (-1003.360) (-1004.805) -- 0:00:03
940000 -- (-1004.217) (-1007.897) [-1004.518] (-1009.199) * [-1007.355] (-1004.961) (-1003.668) (-1003.871) -- 0:00:03
Average standard deviation of split frequencies: 0.009772
940500 -- (-1004.485) (-1008.603) [-1003.896] (-1010.759) * (-1004.716) (-1006.713) [-1005.130] (-1005.611) -- 0:00:03
941000 -- (-1006.381) [-1007.089] (-1005.735) (-1005.333) * (-1003.273) (-1006.165) (-1008.831) [-1003.865] -- 0:00:03
941500 -- (-1005.853) (-1008.691) [-1005.359] (-1004.111) * (-1006.768) (-1006.037) [-1004.523] (-1005.770) -- 0:00:03
942000 -- (-1007.263) [-1005.019] (-1003.602) (-1004.828) * (-1005.918) [-1006.233] (-1005.757) (-1005.835) -- 0:00:03
942500 -- (-1006.283) (-1007.796) (-1007.131) [-1004.206] * (-1007.098) (-1005.498) [-1005.452] (-1009.622) -- 0:00:03
943000 -- (-1004.605) (-1004.439) (-1005.985) [-1004.172] * (-1006.815) [-1007.347] (-1007.435) (-1008.695) -- 0:00:03
943500 -- [-1004.840] (-1006.139) (-1005.310) (-1004.067) * (-1005.871) (-1004.144) (-1004.637) [-1005.466] -- 0:00:03
944000 -- (-1005.453) (-1012.032) (-1004.146) [-1003.928] * (-1010.104) (-1008.610) (-1009.138) [-1004.137] -- 0:00:03
944500 -- [-1006.676] (-1006.915) (-1005.341) (-1005.339) * (-1008.993) (-1009.019) (-1005.808) [-1004.511] -- 0:00:03
945000 -- [-1005.179] (-1008.929) (-1007.290) (-1005.234) * (-1007.551) (-1006.663) (-1004.397) [-1003.509] -- 0:00:03
Average standard deviation of split frequencies: 0.010029
945500 -- (-1004.023) (-1005.932) (-1009.238) [-1006.207] * (-1005.513) [-1005.841] (-1007.532) (-1003.552) -- 0:00:03
946000 -- (-1003.831) (-1008.718) (-1005.280) [-1006.832] * [-1005.685] (-1003.185) (-1008.372) (-1004.933) -- 0:00:03
946500 -- [-1007.321] (-1003.683) (-1004.286) (-1006.256) * (-1007.345) (-1004.270) (-1006.403) [-1004.480] -- 0:00:03
947000 -- (-1003.922) [-1004.809] (-1003.661) (-1005.455) * (-1005.826) (-1008.575) (-1005.832) [-1007.397] -- 0:00:03
947500 -- (-1004.330) [-1005.977] (-1003.794) (-1006.825) * (-1009.136) (-1003.848) [-1004.657] (-1005.118) -- 0:00:03
948000 -- (-1004.655) (-1006.660) [-1004.223] (-1004.270) * (-1007.934) (-1004.868) (-1005.099) [-1005.090] -- 0:00:03
948500 -- (-1004.270) (-1009.558) [-1004.153] (-1005.445) * (-1005.645) (-1007.201) [-1004.078] (-1005.049) -- 0:00:03
949000 -- (-1005.596) (-1005.404) [-1004.033] (-1006.647) * (-1004.193) (-1012.169) [-1004.756] (-1003.782) -- 0:00:03
949500 -- (-1007.420) (-1010.021) [-1004.970] (-1004.830) * [-1004.532] (-1009.110) (-1004.132) (-1003.853) -- 0:00:03
950000 -- (-1007.364) (-1007.847) (-1006.770) [-1006.306] * (-1006.972) (-1003.601) (-1004.680) [-1005.119] -- 0:00:03
Average standard deviation of split frequencies: 0.009979
950500 -- (-1006.913) (-1007.279) [-1006.515] (-1004.996) * (-1006.604) [-1005.111] (-1004.725) (-1004.934) -- 0:00:03
951000 -- (-1006.858) (-1003.898) [-1004.825] (-1005.745) * (-1004.525) [-1004.721] (-1006.908) (-1006.849) -- 0:00:03
951500 -- (-1007.950) (-1004.175) (-1003.594) [-1005.229] * (-1006.992) (-1005.880) [-1007.261] (-1006.613) -- 0:00:03
952000 -- (-1008.267) (-1004.944) (-1006.152) [-1004.206] * [-1006.157] (-1004.276) (-1007.042) (-1004.685) -- 0:00:03
952500 -- (-1004.127) (-1004.421) (-1004.811) [-1006.126] * (-1010.745) [-1004.272] (-1005.859) (-1005.370) -- 0:00:03
953000 -- [-1004.855] (-1005.471) (-1005.973) (-1008.906) * (-1010.103) [-1005.408] (-1003.156) (-1005.239) -- 0:00:03
953500 -- [-1011.945] (-1005.378) (-1007.388) (-1007.239) * (-1005.215) [-1005.677] (-1003.429) (-1006.823) -- 0:00:02
954000 -- (-1012.984) (-1006.780) (-1007.005) [-1004.969] * [-1005.217] (-1004.605) (-1006.933) (-1003.623) -- 0:00:02
954500 -- [-1006.689] (-1003.889) (-1007.110) (-1004.249) * [-1009.882] (-1004.164) (-1006.925) (-1007.106) -- 0:00:02
955000 -- (-1007.883) [-1004.739] (-1003.683) (-1006.143) * (-1003.111) [-1004.721] (-1007.751) (-1005.143) -- 0:00:02
Average standard deviation of split frequencies: 0.010047
955500 -- [-1004.569] (-1004.756) (-1006.853) (-1009.815) * (-1006.461) (-1016.707) (-1006.935) [-1005.234] -- 0:00:02
956000 -- (-1004.890) (-1003.820) (-1008.839) [-1006.219] * (-1006.394) [-1004.932] (-1005.337) (-1006.855) -- 0:00:02
956500 -- (-1005.133) (-1005.853) [-1006.501] (-1004.200) * (-1011.397) (-1003.946) (-1005.303) [-1005.802] -- 0:00:02
957000 -- (-1004.952) [-1004.722] (-1008.356) (-1005.360) * (-1007.950) [-1003.663] (-1007.603) (-1005.719) -- 0:00:02
957500 -- (-1007.161) [-1004.200] (-1005.469) (-1006.419) * (-1007.107) [-1005.094] (-1006.420) (-1003.170) -- 0:00:02
958000 -- (-1004.620) (-1006.504) [-1005.376] (-1005.825) * (-1006.870) [-1004.071] (-1004.327) (-1003.558) -- 0:00:02
958500 -- (-1008.753) [-1004.048] (-1004.600) (-1003.627) * [-1005.700] (-1004.933) (-1003.934) (-1010.416) -- 0:00:02
959000 -- (-1005.022) (-1003.484) [-1007.194] (-1005.304) * [-1004.787] (-1009.653) (-1003.722) (-1009.122) -- 0:00:02
959500 -- [-1008.579] (-1004.144) (-1008.278) (-1009.077) * (-1006.080) (-1006.165) [-1005.525] (-1004.357) -- 0:00:02
960000 -- (-1009.958) (-1004.471) [-1008.041] (-1005.683) * (-1006.938) (-1004.302) [-1004.943] (-1004.576) -- 0:00:02
Average standard deviation of split frequencies: 0.009783
960500 -- [-1006.449] (-1003.898) (-1005.545) (-1005.206) * (-1008.234) (-1005.353) (-1004.800) [-1004.820] -- 0:00:02
961000 -- [-1005.293] (-1005.430) (-1005.408) (-1004.539) * (-1003.877) (-1004.093) [-1004.645] (-1009.601) -- 0:00:02
961500 -- [-1003.408] (-1004.236) (-1010.580) (-1005.738) * (-1003.545) (-1005.990) [-1004.410] (-1007.496) -- 0:00:02
962000 -- (-1007.870) (-1005.606) [-1004.812] (-1009.812) * (-1003.542) (-1005.190) (-1003.620) [-1006.430] -- 0:00:02
962500 -- (-1004.028) (-1003.543) [-1009.710] (-1005.822) * (-1003.434) (-1007.975) (-1004.203) [-1003.338] -- 0:00:02
963000 -- [-1010.292] (-1006.437) (-1008.962) (-1005.814) * [-1003.542] (-1006.033) (-1005.454) (-1003.570) -- 0:00:02
963500 -- (-1008.633) (-1004.204) [-1004.263] (-1007.349) * [-1005.247] (-1004.916) (-1007.079) (-1004.122) -- 0:00:02
964000 -- (-1012.430) [-1004.783] (-1003.119) (-1005.428) * (-1005.765) [-1005.191] (-1006.484) (-1006.187) -- 0:00:02
964500 -- (-1005.684) (-1004.909) [-1003.508] (-1006.248) * (-1006.603) [-1004.448] (-1004.649) (-1005.159) -- 0:00:02
965000 -- (-1003.633) (-1006.607) [-1003.848] (-1003.606) * (-1004.609) (-1007.406) (-1005.026) [-1003.929] -- 0:00:02
Average standard deviation of split frequencies: 0.009577
965500 -- [-1004.926] (-1007.551) (-1003.613) (-1004.896) * (-1004.995) [-1003.697] (-1003.069) (-1008.742) -- 0:00:02
966000 -- (-1006.424) (-1005.869) (-1004.504) [-1004.628] * (-1005.759) (-1005.137) [-1005.576] (-1006.343) -- 0:00:02
966500 -- [-1004.618] (-1006.749) (-1005.977) (-1004.642) * (-1008.690) (-1004.345) [-1006.324] (-1005.511) -- 0:00:02
967000 -- (-1003.609) (-1008.239) [-1004.145] (-1005.205) * [-1007.270] (-1009.108) (-1006.784) (-1008.429) -- 0:00:02
967500 -- (-1005.709) (-1007.846) (-1004.286) [-1005.746] * [-1006.633] (-1010.586) (-1005.730) (-1004.440) -- 0:00:02
968000 -- (-1007.194) (-1007.842) (-1005.973) [-1003.921] * (-1004.819) [-1007.173] (-1004.179) (-1008.523) -- 0:00:02
968500 -- (-1005.774) [-1006.493] (-1004.505) (-1004.383) * [-1004.387] (-1003.483) (-1007.025) (-1005.701) -- 0:00:01
969000 -- (-1004.896) (-1007.982) (-1006.352) [-1008.034] * (-1004.201) (-1007.002) [-1003.405] (-1011.071) -- 0:00:01
969500 -- (-1005.994) [-1003.812] (-1008.204) (-1006.145) * [-1007.098] (-1004.510) (-1006.529) (-1008.595) -- 0:00:01
970000 -- (-1004.696) (-1005.961) [-1004.934] (-1006.592) * [-1007.031] (-1005.838) (-1005.272) (-1010.938) -- 0:00:01
Average standard deviation of split frequencies: 0.009774
970500 -- (-1004.904) (-1004.755) [-1006.958] (-1009.196) * (-1003.769) (-1008.802) [-1011.412] (-1007.588) -- 0:00:01
971000 -- (-1005.486) [-1005.332] (-1006.593) (-1005.700) * (-1005.471) [-1005.235] (-1009.802) (-1006.206) -- 0:00:01
971500 -- [-1006.901] (-1009.702) (-1006.593) (-1005.252) * (-1003.991) (-1004.181) (-1008.103) [-1006.191] -- 0:00:01
972000 -- (-1005.437) [-1005.590] (-1006.292) (-1006.550) * (-1006.702) (-1006.094) [-1010.271] (-1004.411) -- 0:00:01
972500 -- [-1006.526] (-1005.094) (-1006.198) (-1004.031) * (-1007.053) (-1004.010) (-1006.507) [-1003.896] -- 0:00:01
973000 -- (-1006.304) [-1004.089] (-1005.514) (-1008.094) * (-1006.324) (-1004.422) (-1003.544) [-1004.561] -- 0:00:01
973500 -- (-1004.209) (-1004.284) [-1003.993] (-1008.653) * (-1007.168) (-1004.036) [-1005.098] (-1003.577) -- 0:00:01
974000 -- (-1004.280) [-1004.842] (-1010.973) (-1006.375) * (-1004.188) (-1004.346) (-1007.723) [-1005.025] -- 0:00:01
974500 -- (-1004.751) [-1003.502] (-1006.338) (-1005.874) * (-1005.868) (-1003.651) (-1013.123) [-1004.600] -- 0:00:01
975000 -- [-1007.498] (-1006.923) (-1005.190) (-1004.976) * (-1005.826) [-1003.488] (-1008.808) (-1004.271) -- 0:00:01
Average standard deviation of split frequencies: 0.009750
975500 -- [-1007.574] (-1007.997) (-1003.546) (-1005.500) * (-1008.310) (-1006.832) (-1009.201) [-1003.569] -- 0:00:01
976000 -- (-1007.190) (-1006.534) (-1007.630) [-1006.191] * [-1010.996] (-1007.547) (-1004.687) (-1005.446) -- 0:00:01
976500 -- (-1007.063) [-1006.958] (-1004.753) (-1004.043) * (-1008.766) [-1004.072] (-1005.221) (-1004.657) -- 0:00:01
977000 -- (-1005.735) (-1007.202) [-1004.651] (-1008.253) * (-1005.508) (-1004.175) [-1006.612] (-1005.808) -- 0:00:01
977500 -- (-1004.310) (-1006.701) [-1004.873] (-1005.979) * (-1004.979) [-1003.428] (-1004.287) (-1004.523) -- 0:00:01
978000 -- [-1006.786] (-1014.119) (-1004.183) (-1009.510) * (-1004.826) [-1009.765] (-1008.973) (-1008.443) -- 0:00:01
978500 -- (-1004.628) [-1004.941] (-1005.860) (-1006.454) * (-1004.622) (-1007.099) (-1004.559) [-1004.515] -- 0:00:01
979000 -- (-1004.188) (-1006.834) [-1004.538] (-1005.324) * (-1005.066) [-1004.126] (-1005.792) (-1005.510) -- 0:00:01
979500 -- (-1006.116) [-1005.187] (-1006.400) (-1003.595) * [-1007.426] (-1005.514) (-1007.415) (-1006.032) -- 0:00:01
980000 -- (-1007.077) (-1005.275) (-1005.879) [-1003.649] * (-1005.067) (-1008.894) [-1006.844] (-1007.983) -- 0:00:01
Average standard deviation of split frequencies: 0.009554
980500 -- (-1006.052) (-1010.680) (-1007.348) [-1010.540] * (-1008.301) (-1004.848) [-1005.943] (-1005.314) -- 0:00:01
981000 -- [-1004.602] (-1008.118) (-1009.203) (-1003.886) * [-1007.103] (-1007.046) (-1006.504) (-1009.305) -- 0:00:01
981500 -- (-1004.350) (-1005.408) [-1003.996] (-1005.456) * [-1005.727] (-1007.514) (-1004.348) (-1006.202) -- 0:00:01
982000 -- (-1008.871) (-1010.237) [-1004.102] (-1004.207) * (-1005.026) [-1004.064] (-1007.575) (-1006.530) -- 0:00:01
982500 -- [-1005.693] (-1006.293) (-1005.802) (-1004.558) * (-1009.559) [-1004.449] (-1006.121) (-1008.645) -- 0:00:01
983000 -- (-1004.554) [-1003.760] (-1006.251) (-1007.394) * (-1005.484) [-1007.019] (-1009.827) (-1005.762) -- 0:00:01
983500 -- (-1005.133) [-1003.604] (-1004.984) (-1006.446) * (-1008.297) [-1005.704] (-1007.177) (-1005.775) -- 0:00:01
984000 -- (-1004.246) (-1004.778) [-1005.348] (-1004.223) * (-1004.569) (-1006.156) (-1008.520) [-1006.052] -- 0:00:01
984500 -- (-1003.873) (-1006.118) [-1003.648] (-1004.281) * [-1004.569] (-1008.190) (-1004.929) (-1006.182) -- 0:00:00
985000 -- (-1004.676) (-1006.279) (-1003.574) [-1004.456] * [-1008.989] (-1004.985) (-1004.540) (-1004.472) -- 0:00:00
Average standard deviation of split frequencies: 0.009442
985500 -- (-1008.600) (-1005.698) [-1005.533] (-1007.578) * (-1005.960) [-1004.418] (-1006.338) (-1008.572) -- 0:00:00
986000 -- [-1004.106] (-1006.843) (-1004.794) (-1004.631) * [-1005.311] (-1005.227) (-1005.463) (-1006.163) -- 0:00:00
986500 -- (-1004.545) (-1008.105) [-1007.906] (-1003.078) * [-1009.503] (-1008.316) (-1005.923) (-1005.741) -- 0:00:00
987000 -- (-1004.338) [-1007.507] (-1004.481) (-1007.285) * [-1004.881] (-1010.542) (-1005.269) (-1003.514) -- 0:00:00
987500 -- (-1005.117) (-1008.873) [-1003.655] (-1005.752) * (-1004.792) (-1007.413) [-1004.997] (-1003.812) -- 0:00:00
988000 -- (-1004.101) (-1005.631) (-1003.596) [-1004.360] * (-1003.599) (-1006.483) (-1003.322) [-1003.666] -- 0:00:00
988500 -- (-1005.611) (-1004.916) [-1005.488] (-1004.390) * (-1007.257) (-1007.531) [-1003.308] (-1006.162) -- 0:00:00
989000 -- (-1004.530) (-1003.908) (-1006.934) [-1003.726] * (-1009.069) (-1005.247) [-1003.331] (-1005.138) -- 0:00:00
989500 -- (-1003.903) [-1005.601] (-1003.899) (-1003.636) * [-1009.384] (-1006.019) (-1009.330) (-1007.272) -- 0:00:00
990000 -- (-1006.054) [-1003.619] (-1004.907) (-1004.037) * (-1005.538) (-1004.894) (-1003.410) [-1006.360] -- 0:00:00
Average standard deviation of split frequencies: 0.009487
990500 -- (-1004.883) [-1004.429] (-1004.544) (-1004.001) * (-1006.295) [-1005.659] (-1004.156) (-1008.985) -- 0:00:00
991000 -- [-1004.860] (-1005.352) (-1003.567) (-1004.440) * (-1006.579) (-1007.460) (-1006.083) [-1004.290] -- 0:00:00
991500 -- [-1004.330] (-1003.436) (-1005.129) (-1003.685) * (-1005.934) [-1005.718] (-1004.623) (-1005.254) -- 0:00:00
992000 -- (-1005.875) (-1004.653) (-1003.658) [-1004.804] * [-1005.874] (-1005.862) (-1009.773) (-1005.553) -- 0:00:00
992500 -- [-1003.249] (-1005.286) (-1006.101) (-1007.350) * (-1003.707) [-1004.397] (-1003.407) (-1004.851) -- 0:00:00
993000 -- (-1006.086) (-1004.556) [-1008.051] (-1007.552) * (-1005.225) (-1006.544) [-1005.184] (-1004.825) -- 0:00:00
993500 -- [-1003.297] (-1005.857) (-1003.735) (-1005.151) * (-1005.396) (-1005.691) (-1014.861) [-1009.514] -- 0:00:00
994000 -- (-1005.715) (-1005.082) (-1004.332) [-1004.249] * [-1004.243] (-1004.814) (-1006.175) (-1004.040) -- 0:00:00
994500 -- (-1004.483) (-1005.831) [-1005.514] (-1006.447) * (-1007.690) (-1004.397) (-1004.635) [-1004.486] -- 0:00:00
995000 -- [-1005.080] (-1005.343) (-1005.788) (-1005.135) * (-1005.554) [-1004.814] (-1004.775) (-1012.770) -- 0:00:00
Average standard deviation of split frequencies: 0.009407
995500 -- (-1008.420) (-1009.898) (-1005.379) [-1004.362] * (-1003.355) [-1006.488] (-1005.119) (-1006.110) -- 0:00:00
996000 -- [-1006.762] (-1009.067) (-1004.565) (-1004.347) * (-1004.751) (-1004.534) [-1005.658] (-1006.543) -- 0:00:00
996500 -- (-1005.688) [-1005.725] (-1004.643) (-1004.485) * (-1005.680) (-1008.134) (-1004.396) [-1008.303] -- 0:00:00
997000 -- [-1006.986] (-1006.832) (-1004.596) (-1005.799) * [-1003.679] (-1007.894) (-1006.856) (-1006.446) -- 0:00:00
997500 -- (-1004.517) [-1005.389] (-1004.986) (-1005.161) * (-1005.078) (-1005.045) [-1007.364] (-1010.896) -- 0:00:00
998000 -- (-1004.642) (-1004.683) [-1004.057] (-1004.415) * [-1004.673] (-1005.221) (-1006.377) (-1015.214) -- 0:00:00
998500 -- [-1009.239] (-1004.692) (-1004.599) (-1009.719) * (-1005.917) (-1006.328) [-1004.494] (-1011.087) -- 0:00:00
999000 -- (-1005.544) (-1005.235) [-1005.738] (-1005.229) * (-1006.570) [-1003.763] (-1004.313) (-1008.221) -- 0:00:00
999500 -- (-1006.228) (-1004.884) (-1004.556) [-1005.252] * (-1005.917) (-1004.548) [-1004.098] (-1004.736) -- 0:00:00
1000000 -- [-1005.138] (-1004.594) (-1004.842) (-1005.066) * (-1007.642) [-1004.873] (-1003.792) (-1008.485) -- 0:00:00
Average standard deviation of split frequencies: 0.009510
Analysis completed in 1 mins 4 seconds
Analysis used 62.09 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1003.04
Likelihood of best state for "cold" chain of run 2 was -1003.04
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.7 % ( 20 %) Dirichlet(Pi{all})
29.8 % ( 26 %) Slider(Pi{all})
78.9 % ( 45 %) Multiplier(Alpha{1,2})
78.4 % ( 54 %) Multiplier(Alpha{3})
20.0 % ( 18 %) Slider(Pinvar{all})
98.7 % ( 97 %) ExtSPR(Tau{all},V{all})
70.0 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.4 % ( 32 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.6 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
27.5 % ( 22 %) Dirichlet(Pi{all})
29.5 % ( 22 %) Slider(Pi{all})
79.1 % ( 62 %) Multiplier(Alpha{1,2})
78.1 % ( 54 %) Multiplier(Alpha{3})
20.8 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 77 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.1 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166904 0.82 0.67
3 | 166753 166420 0.83
4 | 166257 167118 166548
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166040 0.82 0.67
3 | 167075 167004 0.84
4 | 166559 166426 166896
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1004.75
| 2 1 1 |
| 2 2 2 |
| 2 2 1 1 1 |
| 2 1 1 2 2 2 2 2 1|
| 1 1 2 2 2 12 |
| 1 2 1 2 1 1 2 12 2|
|2 1 12 2 1 1 2 * 12 2 21 |
| 1 1 2 2 1 11 2 12 11 1 1 1 |
| 211 2 21 2 1 1 1 2 |
| 2 1 1 1 2 1 2 1 21 2 21 |
| 1 *1 1 2 2 1 |
| 1 2 2 * 2 2 2 |
| 2 2 1 2 |
| 1 2 1 |
|1 2 1 2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1006.24
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1004.72 -1008.53
2 -1004.71 -1007.81
--------------------------------------
TOTAL -1004.71 -1008.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884583 0.091965 0.334032 1.473970 0.853656 1379.61 1440.31 1.000
r(A<->C){all} 0.164576 0.018780 0.000035 0.436443 0.132302 128.49 238.04 1.003
r(A<->G){all} 0.170134 0.020374 0.000004 0.459560 0.130876 130.89 153.69 1.003
r(A<->T){all} 0.165760 0.019866 0.000043 0.436207 0.128803 144.90 157.52 1.003
r(C<->G){all} 0.164753 0.019763 0.000181 0.448077 0.127535 161.00 248.23 1.001
r(C<->T){all} 0.159082 0.019943 0.000022 0.440576 0.120394 136.38 146.18 1.000
r(G<->T){all} 0.175695 0.020132 0.000023 0.446567 0.144119 137.66 203.38 1.001
pi(A){all} 0.188814 0.000208 0.161951 0.218373 0.188694 1253.38 1256.43 1.000
pi(C){all} 0.258835 0.000242 0.231598 0.291737 0.258570 1184.58 1243.31 1.001
pi(G){all} 0.330335 0.000302 0.294879 0.363023 0.330357 1219.63 1271.14 1.001
pi(T){all} 0.222016 0.000238 0.191233 0.251546 0.221888 1031.67 1190.30 1.000
alpha{1,2} 0.428858 0.235607 0.000109 1.412441 0.256906 976.07 1141.85 1.000
alpha{3} 0.471440 0.267140 0.000174 1.494645 0.301787 1293.12 1316.50 1.000
pinvar{all} 0.997895 0.000007 0.993423 0.999999 0.998658 1374.42 1437.71 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- .*.*..
9 -- ....**
10 -- ..*..*
11 -- .***.*
12 -- .*..*.
13 -- .*...*
14 -- ..****
15 -- .**.**
16 -- .****.
17 -- ...**.
18 -- ..*.*.
19 -- ...*.*
20 -- .**...
21 -- ..**..
22 -- .*.*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 463 0.154231 0.018373 0.141239 0.167222 2
8 454 0.151233 0.007537 0.145903 0.156562 2
9 445 0.148235 0.002355 0.146569 0.149900 2
10 441 0.146902 0.000471 0.146569 0.147235 2
11 440 0.146569 0.002827 0.144570 0.148568 2
12 437 0.145570 0.009893 0.138574 0.152565 2
13 429 0.142905 0.018373 0.129913 0.155896 2
14 428 0.142572 0.019786 0.128581 0.156562 2
15 424 0.141239 0.004711 0.137908 0.144570 2
16 423 0.140906 0.001413 0.139907 0.141905 2
17 422 0.140573 0.009422 0.133911 0.147235 2
18 418 0.139241 0.016959 0.127249 0.151233 2
19 403 0.134244 0.007066 0.129247 0.139241 2
20 401 0.133578 0.001413 0.132578 0.134577 2
21 400 0.133245 0.010364 0.125916 0.140573 2
22 267 0.088941 0.021199 0.073951 0.103931 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097695 0.009621 0.000020 0.293420 0.067717 1.000 2
length{all}[2] 0.096630 0.009050 0.000002 0.291548 0.066245 1.000 2
length{all}[3] 0.100063 0.010225 0.000003 0.303954 0.068798 1.000 2
length{all}[4] 0.097320 0.009620 0.000023 0.292482 0.066858 1.000 2
length{all}[5] 0.098870 0.010338 0.000004 0.297196 0.067856 1.000 2
length{all}[6] 0.096313 0.009439 0.000024 0.290931 0.067217 1.000 2
length{all}[7] 0.099247 0.010666 0.000044 0.311140 0.066439 0.998 2
length{all}[8] 0.101618 0.009413 0.000119 0.297867 0.073415 1.002 2
length{all}[9] 0.101084 0.010047 0.000143 0.313080 0.075740 0.999 2
length{all}[10] 0.095844 0.008590 0.000168 0.272610 0.064510 1.005 2
length{all}[11] 0.103255 0.012765 0.000126 0.326875 0.072658 0.998 2
length{all}[12] 0.105377 0.010847 0.000490 0.305996 0.073502 0.998 2
length{all}[13] 0.094124 0.009634 0.000866 0.280294 0.061916 0.998 2
length{all}[14] 0.091396 0.007223 0.000455 0.258094 0.064199 1.001 2
length{all}[15] 0.103127 0.012239 0.000062 0.328170 0.064427 0.998 2
length{all}[16] 0.103930 0.010416 0.000026 0.313549 0.074675 0.998 2
length{all}[17] 0.105663 0.012255 0.000565 0.340923 0.071527 1.010 2
length{all}[18] 0.097691 0.008266 0.000114 0.297285 0.075290 0.998 2
length{all}[19] 0.101135 0.009172 0.000441 0.310710 0.072898 1.002 2
length{all}[20] 0.095517 0.009669 0.000218 0.294146 0.063358 0.998 2
length{all}[21] 0.099265 0.011250 0.000168 0.333130 0.065783 0.999 2
length{all}[22] 0.090007 0.006670 0.000341 0.234180 0.069358 0.996 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009510
Maximum standard deviation of split frequencies = 0.021199
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 735
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 245 / 245 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 245 / 245 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.101504 0.032096 0.024209 0.089516 0.028933 0.080811 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1055.090433
Iterating by ming2
Initial: fx= 1055.090433
x= 0.10150 0.03210 0.02421 0.08952 0.02893 0.08081 0.30000 1.30000
1 h-m-p 0.0000 0.0001 587.6500 ++ 1020.399908 m 0.0001 13 | 1/8
2 h-m-p 0.0008 0.0124 64.0152 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 538.1531 ++ 1014.726995 m 0.0000 44 | 2/8
4 h-m-p 0.0002 0.0194 52.5733 ----------.. | 2/8
5 h-m-p 0.0000 0.0000 480.9126 ++ 1011.692736 m 0.0000 74 | 3/8
6 h-m-p 0.0001 0.0196 42.5539 ----------.. | 3/8
7 h-m-p 0.0000 0.0002 415.5824 +++ 976.321153 m 0.0002 105 | 4/8
8 h-m-p 0.0022 0.0423 31.5499 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 342.1075 ++ 972.046312 m 0.0000 137 | 5/8
10 h-m-p 0.0004 0.0610 21.6694 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 242.0284 ++ 969.092390 m 0.0001 167 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ---------C 969.092390 0 0.0000 187 | 6/8
13 h-m-p 0.0160 8.0000 0.0000 -C 969.092390 0 0.0010 201
Out..
lnL = -969.092390
202 lfun, 202 eigenQcodon, 1212 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038796 0.096930 0.056558 0.094800 0.076371 0.099705 0.299967 0.571052 0.451393
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.745783
np = 9
lnL0 = -1077.511857
Iterating by ming2
Initial: fx= 1077.511857
x= 0.03880 0.09693 0.05656 0.09480 0.07637 0.09970 0.29997 0.57105 0.45139
1 h-m-p 0.0000 0.0002 558.9614 +++ 1024.116877 m 0.0002 15 | 1/9
2 h-m-p 0.0000 0.0002 398.8986 ++ 1002.963766 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0000 9268.6271 ++ 984.318721 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0001 746.8410 ++ 970.739938 m 0.0001 51 | 4/9
5 h-m-p 0.0000 0.0000 2591.9386 ++ 969.734987 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 411761.2389 ++ 969.092312 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 969.092312 m 8.0000 87 | 6/9
8 h-m-p 0.0018 0.9025 0.9426 ------------.. | 6/9
9 h-m-p 0.0160 8.0000 0.0002 +++++ 969.092312 m 8.0000 130 | 6/9
10 h-m-p 0.0058 2.8467 0.2852 ---------C 969.092312 0 0.0000 154 | 6/9
11 h-m-p 0.0160 8.0000 0.0035 +++++ 969.092306 m 8.0000 172 | 6/9
12 h-m-p 0.0930 2.5410 0.2996 ------------C 969.092306 0 0.0000 199 | 6/9
13 h-m-p 0.0160 8.0000 0.0002 +++++ 969.092306 m 8.0000 217 | 6/9
14 h-m-p 0.0001 0.0403 10.4456 +++++ 969.092267 m 0.0403 235 | 7/9
15 h-m-p 0.2452 1.2262 0.3441 ++ 969.092101 m 1.2262 247 | 8/9
16 h-m-p 0.2122 1.0608 0.3502 ++ 969.091957 m 1.0608 261 | 9/9
17 h-m-p 0.0160 8.0000 0.0000 Y 969.091957 0 0.0160 274 | 9/9
18 h-m-p 0.0160 8.0000 0.0000 Y 969.091957 0 0.0160 286
Out..
lnL = -969.091957
287 lfun, 861 eigenQcodon, 3444 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.079373 0.048506 0.062305 0.038559 0.048224 0.028387 0.000100 1.243748 0.201768 0.120517 1.496746
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 13.035637
np = 11
lnL0 = -1036.043864
Iterating by ming2
Initial: fx= 1036.043864
x= 0.07937 0.04851 0.06230 0.03856 0.04822 0.02839 0.00011 1.24375 0.20177 0.12052 1.49675
1 h-m-p 0.0000 0.0000 494.4283 ++ 1035.650468 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 261.7995 +++ 1007.681277 m 0.0005 31 | 2/11
3 h-m-p 0.0003 0.0017 117.4920 ++ 989.868504 m 0.0017 45 | 3/11
4 h-m-p 0.0000 0.0002 663.3398 ++ 987.520572 m 0.0002 59 | 4/11
5 h-m-p 0.0000 0.0001 3579.7989 ++ 980.576697 m 0.0001 73 | 5/11
6 h-m-p 0.0000 0.0000 121734.0183 ++ 980.469516 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0001 2326.2428 ++ 974.848118 m 0.0001 101 | 7/11
8 h-m-p 0.0000 0.0000 1168933.9356 ++ 969.092286 m 0.0000 115 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 969.092286 m 8.0000 129 | 8/11
10 h-m-p 0.0160 8.0000 0.3776 -------------.. | 8/11
11 h-m-p 0.0160 8.0000 0.0001 +++++ 969.092286 m 8.0000 177 | 8/11
12 h-m-p 0.0160 8.0000 2.6119 ------------N 969.092286 0 0.0000 206 | 8/11
13 h-m-p 0.0160 8.0000 0.0012 +++++ 969.092285 m 8.0000 223 | 8/11
14 h-m-p 0.0160 8.0000 2.5846 ------------C 969.092285 0 0.0000 252 | 8/11
15 h-m-p 0.0160 8.0000 0.0002 +++++ 969.092285 m 8.0000 269 | 8/11
16 h-m-p 0.0160 8.0000 4.3332 -----------Y 969.092285 0 0.0000 297 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 969.092285 m 8.0000 314 | 8/11
18 h-m-p 0.0160 8.0000 0.0065 +++++ 969.092281 m 8.0000 334 | 8/11
19 h-m-p 0.0160 8.0000 3.9737 ------------N 969.092281 0 0.0000 363 | 8/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 969.092281 m 8.0000 380 | 8/11
21 h-m-p 0.0160 8.0000 0.0052 +++++ 969.092277 m 8.0000 400 | 8/11
22 h-m-p 0.0160 8.0000 3.6013 -----------Y 969.092277 0 0.0000 428 | 8/11
23 h-m-p 0.0160 8.0000 0.0000 +++++ 969.092277 m 8.0000 445 | 8/11
24 h-m-p 0.0050 2.5136 0.9748 +++++ 969.092049 m 2.5136 465 | 9/11
25 h-m-p 0.4374 8.0000 2.9201 +++ 969.091957 m 8.0000 483 | 9/11
26 h-m-p 1.6000 8.0000 0.0059 Y 969.091957 0 1.6000 497 | 9/11
27 h-m-p 1.6000 8.0000 0.0000 N 969.091957 0 0.4000 513 | 9/11
28 h-m-p 0.4851 8.0000 0.0000 +C 969.091957 0 1.9404 530 | 9/11
29 h-m-p 0.2947 8.0000 0.0002 ----N 969.091957 0 0.0003 550
Out..
lnL = -969.091957
551 lfun, 2204 eigenQcodon, 9918 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -969.141007 S = -969.092949 -0.018558
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:04
did 20 / 55 patterns 0:04
did 30 / 55 patterns 0:04
did 40 / 55 patterns 0:04
did 50 / 55 patterns 0:04
did 55 / 55 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.076429 0.096227 0.104103 0.107482 0.068463 0.069137 0.000100 0.544165 1.159443
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.962079
np = 9
lnL0 = -1082.974187
Iterating by ming2
Initial: fx= 1082.974187
x= 0.07643 0.09623 0.10410 0.10748 0.06846 0.06914 0.00011 0.54417 1.15944
1 h-m-p 0.0000 0.0000 495.5774 ++ 1082.819220 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0046 119.8646 +++++ 1025.047008 m 0.0046 29 | 2/9
3 h-m-p 0.0002 0.0012 90.8636 ++ 1015.221783 m 0.0012 41 | 3/9
4 h-m-p 0.0000 0.0002 72.0675 ++ 1009.780235 m 0.0002 53 | 4/9
5 h-m-p 0.0008 0.0138 12.4209 -----------.. | 4/9
6 h-m-p 0.0000 0.0001 428.0341 ++ 998.393232 m 0.0001 86 | 5/9
7 h-m-p 0.0160 8.0000 1.7350 -------------.. | 5/9
8 h-m-p 0.0000 0.0002 371.4142 +++ 975.460453 m 0.0002 122 | 6/9
9 h-m-p 0.0357 8.0000 1.3814 --------------.. | 6/9
10 h-m-p 0.0000 0.0001 312.9446 ++ 969.375116 m 0.0001 158 | 7/9
11 h-m-p 0.0160 8.0000 0.9861 -------------.. | 7/9
12 h-m-p 0.0000 0.0000 224.2468 ++ 969.091957 m 0.0000 195 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 Y 969.091957 0 1.6000 207 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 +Y 969.091957 0 0.0640 221
Out..
lnL = -969.091957
222 lfun, 2442 eigenQcodon, 13320 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.067423 0.090008 0.079649 0.097858 0.106449 0.012263 0.000100 0.900000 0.995316 1.709172 1.299850
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.605041
np = 11
lnL0 = -1069.583372
Iterating by ming2
Initial: fx= 1069.583372
x= 0.06742 0.09001 0.07965 0.09786 0.10645 0.01226 0.00011 0.90000 0.99532 1.70917 1.29985
1 h-m-p 0.0000 0.0000 508.6433 ++ 1069.328689 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0004 230.4668 +++ 1053.037106 m 0.0004 31 | 2/11
3 h-m-p 0.0002 0.0010 189.0003 ++ 991.898839 m 0.0010 45 | 3/11
4 h-m-p 0.0003 0.0015 123.9526 ++ 980.536815 m 0.0015 59 | 4/11
5 h-m-p 0.0000 0.0002 1703.3764 ++ 973.474616 m 0.0002 73 | 5/11
6 h-m-p 0.0000 0.0000 12898.0763 ++ 970.432902 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0000 25135.3853 ++ 969.092291 m 0.0000 101 | 7/11
8 h-m-p 1.6000 8.0000 0.0006 ++ 969.092291 m 8.0000 115 | 7/11
9 h-m-p 0.0120 4.9635 0.3836 ------------Y 969.092291 0 0.0000 145 | 7/11
10 h-m-p 0.0160 8.0000 0.0006 +++++ 969.092290 m 8.0000 166 | 7/11
11 h-m-p 0.0160 8.0000 0.3935 -------------.. | 7/11
12 h-m-p 0.0160 8.0000 0.0005 +++++ 969.092288 m 8.0000 216 | 7/11
13 h-m-p 0.0230 4.2827 0.1894 -------------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0006 +++++ 969.092285 m 8.0000 266 | 7/11
15 h-m-p 0.0238 4.3569 0.1872 ------------Y 969.092285 0 0.0000 296 | 7/11
16 h-m-p 0.0160 8.0000 0.0067 +++++ 969.092251 m 8.0000 317 | 7/11
17 h-m-p 0.2526 4.1031 0.2131 ---------------.. | 7/11
18 h-m-p 0.0160 8.0000 0.0008 +++++ 969.092246 m 8.0000 369 | 7/11
19 h-m-p 0.0384 5.4795 0.1597 --------------.. | 7/11
20 h-m-p 0.0160 8.0000 0.0008 +++++ 969.092241 m 8.0000 420 | 7/11
21 h-m-p 0.0407 5.6286 0.1566 ------------C 969.092241 0 0.0000 450 | 7/11
22 h-m-p 0.0160 8.0000 0.0005 +++++ 969.092239 m 8.0000 471 | 7/11
23 h-m-p 0.0169 6.8411 0.2600 -------------.. | 7/11
24 h-m-p 0.0160 8.0000 0.0008 +++++ 969.092233 m 8.0000 521 | 7/11
25 h-m-p 0.0444 5.8552 0.1521 -----------C 969.092233 0 0.0000 550 | 7/11
26 h-m-p 0.0012 0.6193 0.2108 +++++ 969.092025 m 0.6193 571 | 8/11
27 h-m-p 0.7225 8.0000 0.0449 ---------------N 969.092025 0 0.0000 604 | 8/11
28 h-m-p 0.0160 8.0000 0.0002 +++++ 969.092025 m 8.0000 624 | 8/11
29 h-m-p 0.0030 1.4858 0.7854 ----------Y 969.092025 0 0.0000 651 | 8/11
30 h-m-p 0.0160 8.0000 0.0001 +++++ 969.092025 m 8.0000 671 | 8/11
31 h-m-p 0.0160 8.0000 1.0258 +++++ 969.091992 m 8.0000 691 | 8/11
32 h-m-p 1.6000 8.0000 0.3582 ++ 969.091990 m 8.0000 705 | 8/11
33 h-m-p 0.7309 8.0000 3.9207 ++ 969.091986 m 8.0000 722 | 8/11
34 h-m-p 1.6000 8.0000 0.1382 ++ 969.091986 m 8.0000 736 | 8/11
35 h-m-p 0.9369 8.0000 1.1798 ----------N 969.091986 0 0.0000 763 | 8/11
36 h-m-p 0.0433 8.0000 0.0000 Y 969.091986 0 0.0433 777 | 8/11
37 h-m-p 0.0160 8.0000 0.0005 ---C 969.091986 0 0.0001 797
Out..
lnL = -969.091986
798 lfun, 9576 eigenQcodon, 52668 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -969.151741 S = -969.092602 -0.026275
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:21
did 20 / 55 patterns 0:21
did 30 / 55 patterns 0:21
did 40 / 55 patterns 0:21
did 50 / 55 patterns 0:22
did 55 / 55 patterns 0:22
Time used: 0:22
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=245
NC_011896_1_WP_010908231_1_1329_MLBR_RS06240 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
NC_002677_1_NP_301910_1_782_hisA LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
NZ_AP014567_1_WP_010908231_1_1382_priA LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH
**************************************************
NC_011896_1_WP_010908231_1_1329_MLBR_RS06240 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
NC_002677_1_NP_301910_1_782_hisA LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860 LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
NZ_AP014567_1_WP_010908231_1_1382_priA LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR
**************************************************
NC_011896_1_WP_010908231_1_1329_MLBR_RS06240 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
NC_002677_1_NP_301910_1_782_hisA VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860 VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
NZ_AP014567_1_WP_010908231_1_1382_priA VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG
**************************************************
NC_011896_1_WP_010908231_1_1329_MLBR_RS06240 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
NC_002677_1_NP_301910_1_782_hisA DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860 DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
NZ_AP014567_1_WP_010908231_1_1382_priA DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS
**************************************************
NC_011896_1_WP_010908231_1_1329_MLBR_RS06240 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
NC_002677_1_NP_301910_1_782_hisA GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860 GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
NZ_AP014567_1_WP_010908231_1_1382_priA GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
*********************************************
>NC_011896_1_WP_010908231_1_1329_MLBR_RS06240 TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG >NC_002677_1_NP_301910_1_782_hisA TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG >NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010 TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG >NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785 TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG >NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860 TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG >NZ_AP014567_1_WP_010908231_1_1382_priA TTGATGTCGCTGATACTTTTACCGGCTGTCGACGTGGTCGAGGGGCGCGC CGTGCGCCTGGTTCAAGGAAAGGCCGGTAGCGAAAACGATTACGGTTCAG CATTGGACGCCGCGTTGTGCTGGCAACGCGACGGCGCCGACTGGATTCAC CTAGTGGATCTGGACGCAGCGTTTGGTCGCGGTTCCAACCGCGAACTGCT TTCTGAGATGGTGGGCAAGCTTGATGTGCAGGTCGAGCTATCCGGAGGTA TTCGTGACGACGACTCTTTGAATGCTGCGCTAGCTACCGGCTGTGCACGG GTCAACCTAGGTACGGCCGCATGTGAGAACCCGCACTGGTGCGCACAGGT GATTGCCGAGCACGGTGACAAGATCGCCGTCGGTTTGGACGTCCAGATCG TCGACGGCCAGCATCGGCTGCGTGGACGCGGCTGGGAAACCGACGGAGGA GACCTGTGGGATGTGTTAGAAAATCTTGATAGACAAGGATGTTCACGGTT CATTGTTACCGATGTCACTAAGGACGGTACGTTGGACGGTCCCAACCTTG ACCTGCTGGCAAGTGTCTCCGATCGCACCAACGTCCCGGTGATCGCGTCC GGTGGCGTTTCCAGTCTGGATGACTTGCGTGCTATCGCTAAATTCACCGA GCGCGGGATCGAGGGTGCTATTGTGGGCAAAGCCCTCTATGCCGAACGGT TCACCTTGCCGCAGGCACTGGCCGTGGTGCGGATG
>NC_011896_1_WP_010908231_1_1329_MLBR_RS06240 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM >NC_002677_1_NP_301910_1_782_hisA LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM >NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM >NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM >NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860 LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM >NZ_AP014567_1_WP_010908231_1_1382_priA LMSLILLPAVDVVEGRAVRLVQGKAGSENDYGSALDAALCWQRDGADWIH LVDLDAAFGRGSNRELLSEMVGKLDVQVELSGGIRDDDSLNAALATGCAR VNLGTAACENPHWCAQVIAEHGDKIAVGLDVQIVDGQHRLRGRGWETDGG DLWDVLENLDRQGCSRFIVTDVTKDGTLDGPNLDLLASVSDRTNVPVIAS GGVSSLDDLRAIAKFTERGIEGAIVGKALYAERFTLPQALAVVRM
#NEXUS
[ID: 0412043612]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908231_1_1329_MLBR_RS06240
NC_002677_1_NP_301910_1_782_hisA
NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010
NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785
NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860
NZ_AP014567_1_WP_010908231_1_1382_priA
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908231_1_1329_MLBR_RS06240,
2 NC_002677_1_NP_301910_1_782_hisA,
3 NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010,
4 NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785,
5 NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860,
6 NZ_AP014567_1_WP_010908231_1_1382_priA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0677167,2:0.06624493,3:0.06879783,4:0.06685788,5:0.06785586,6:0.06721705);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0677167,2:0.06624493,3:0.06879783,4:0.06685788,5:0.06785586,6:0.06721705);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1004.72 -1008.53
2 -1004.71 -1007.81
--------------------------------------
TOTAL -1004.71 -1008.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/hisA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884583 0.091965 0.334032 1.473970 0.853656 1379.61 1440.31 1.000
r(A<->C){all} 0.164576 0.018780 0.000035 0.436443 0.132302 128.49 238.04 1.003
r(A<->G){all} 0.170134 0.020374 0.000004 0.459560 0.130876 130.89 153.69 1.003
r(A<->T){all} 0.165760 0.019866 0.000043 0.436207 0.128803 144.90 157.52 1.003
r(C<->G){all} 0.164753 0.019763 0.000181 0.448077 0.127535 161.00 248.23 1.001
r(C<->T){all} 0.159082 0.019943 0.000022 0.440576 0.120394 136.38 146.18 1.000
r(G<->T){all} 0.175695 0.020132 0.000023 0.446567 0.144119 137.66 203.38 1.001
pi(A){all} 0.188814 0.000208 0.161951 0.218373 0.188694 1253.38 1256.43 1.000
pi(C){all} 0.258835 0.000242 0.231598 0.291737 0.258570 1184.58 1243.31 1.001
pi(G){all} 0.330335 0.000302 0.294879 0.363023 0.330357 1219.63 1271.14 1.001
pi(T){all} 0.222016 0.000238 0.191233 0.251546 0.221888 1031.67 1190.30 1.000
alpha{1,2} 0.428858 0.235607 0.000109 1.412441 0.256906 976.07 1141.85 1.000
alpha{3} 0.471440 0.267140 0.000174 1.494645 0.301787 1293.12 1316.50 1.000
pinvar{all} 0.997895 0.000007 0.993423 0.999999 0.998658 1374.42 1437.71 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/hisA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 245
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 3 3 3 3 3 3
TTC 3 3 3 3 3 3 | TCC 5 5 5 5 5 5 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 8 8 8 8 8 8 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 5 5 5 5 5 5 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 3 3 3 3 3 3 | CGC 8 8 8 8 8 8
CTA 4 4 4 4 4 4 | CCA 0 0 0 0 0 0 | Gln CAA 3 3 3 3 3 3 | CGA 0 0 0 0 0 0
CTG 10 10 10 10 10 10 | CCG 4 4 4 4 4 4 | CAG 5 5 5 5 5 5 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 2 2 2 2 2 2
ATC 5 5 5 5 5 5 | ACC 6 6 6 6 6 6 | AAC 6 6 6 6 6 6 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 6 6 6 6 6 6 | Asp GAT 8 8 8 8 8 8 | Gly GGT 12 12 12 12 12 12
GTC 10 10 10 10 10 10 | GCC 10 10 10 10 10 10 | GAC 17 17 17 17 17 17 | GGC 7 7 7 7 7 7
GTA 0 0 0 0 0 0 | GCA 7 7 7 7 7 7 | Glu GAA 5 5 5 5 5 5 | GGA 6 6 6 6 6 6
GTG 11 11 11 11 11 11 | GCG 4 4 4 4 4 4 | GAG 7 7 7 7 7 7 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908231_1_1329_MLBR_RS06240
position 1: T:0.14694 C:0.21633 A:0.16735 G:0.46939
position 2: T:0.29388 C:0.20816 A:0.26531 G:0.23265
position 3: T:0.22449 C:0.35102 A:0.13469 G:0.28980
Average T:0.22177 C:0.25850 A:0.18912 G:0.33061
#2: NC_002677_1_NP_301910_1_782_hisA
position 1: T:0.14694 C:0.21633 A:0.16735 G:0.46939
position 2: T:0.29388 C:0.20816 A:0.26531 G:0.23265
position 3: T:0.22449 C:0.35102 A:0.13469 G:0.28980
Average T:0.22177 C:0.25850 A:0.18912 G:0.33061
#3: NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010
position 1: T:0.14694 C:0.21633 A:0.16735 G:0.46939
position 2: T:0.29388 C:0.20816 A:0.26531 G:0.23265
position 3: T:0.22449 C:0.35102 A:0.13469 G:0.28980
Average T:0.22177 C:0.25850 A:0.18912 G:0.33061
#4: NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785
position 1: T:0.14694 C:0.21633 A:0.16735 G:0.46939
position 2: T:0.29388 C:0.20816 A:0.26531 G:0.23265
position 3: T:0.22449 C:0.35102 A:0.13469 G:0.28980
Average T:0.22177 C:0.25850 A:0.18912 G:0.33061
#5: NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860
position 1: T:0.14694 C:0.21633 A:0.16735 G:0.46939
position 2: T:0.29388 C:0.20816 A:0.26531 G:0.23265
position 3: T:0.22449 C:0.35102 A:0.13469 G:0.28980
Average T:0.22177 C:0.25850 A:0.18912 G:0.33061
#6: NZ_AP014567_1_WP_010908231_1_1382_priA
position 1: T:0.14694 C:0.21633 A:0.16735 G:0.46939
position 2: T:0.29388 C:0.20816 A:0.26531 G:0.23265
position 3: T:0.22449 C:0.35102 A:0.13469 G:0.28980
Average T:0.22177 C:0.25850 A:0.18912 G:0.33061
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 18
TTC 18 | TCC 30 | TAC 6 | TGC 12
Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 48 | TCG 6 | TAG 0 | Trp W TGG 30
------------------------------------------------------------------------------
Leu L CTT 30 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 18
CTC 6 | CCC 6 | CAC 18 | CGC 48
CTA 24 | CCA 0 | Gln Q CAA 18 | CGA 0
CTG 60 | CCG 24 | CAG 30 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 30 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 12
ATC 30 | ACC 36 | AAC 36 | AGC 6
ATA 6 | ACA 0 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 18 | ACG 12 | AAG 24 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 36 | Asp D GAT 48 | Gly G GGT 72
GTC 60 | GCC 60 | GAC 102 | GGC 42
GTA 0 | GCA 42 | Glu E GAA 30 | GGA 36
GTG 66 | GCG 24 | GAG 42 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14694 C:0.21633 A:0.16735 G:0.46939
position 2: T:0.29388 C:0.20816 A:0.26531 G:0.23265
position 3: T:0.22449 C:0.35102 A:0.13469 G:0.28980
Average T:0.22177 C:0.25850 A:0.18912 G:0.33061
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -969.092390 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299967 1.299850
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908231_1_1329_MLBR_RS06240: 0.000004, NC_002677_1_NP_301910_1_782_hisA: 0.000004, NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010: 0.000004, NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785: 0.000004, NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860: 0.000004, NZ_AP014567_1_WP_010908231_1_1382_priA: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29997
omega (dN/dS) = 1.29985
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 554.9 180.1 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 554.9 180.1 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 554.9 180.1 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 554.9 180.1 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 554.9 180.1 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 554.9 180.1 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -969.091957 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908231_1_1329_MLBR_RS06240: 0.000004, NC_002677_1_NP_301910_1_782_hisA: 0.000004, NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010: 0.000004, NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785: 0.000004, NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860: 0.000004, NZ_AP014567_1_WP_010908231_1_1382_priA: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -969.091957 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908231_1_1329_MLBR_RS06240: 0.000004, NC_002677_1_NP_301910_1_782_hisA: 0.000004, NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010: 0.000004, NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785: 0.000004, NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860: 0.000004, NZ_AP014567_1_WP_010908231_1_1382_priA: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908231_1_1329_MLBR_RS06240)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -969.091957 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.179289
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908231_1_1329_MLBR_RS06240: 0.000004, NC_002677_1_NP_301910_1_782_hisA: 0.000004, NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010: 0.000004, NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785: 0.000004, NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860: 0.000004, NZ_AP014567_1_WP_010908231_1_1382_priA: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.17929
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 566.0 169.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -969.091986 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.798629 44.228750 12.944448
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908231_1_1329_MLBR_RS06240: 0.000004, NC_002677_1_NP_301910_1_782_hisA: 0.000004, NZ_LVXE01000031_1_WP_010908231_1_1430_A3216_RS09010: 0.000004, NZ_LYPH01000034_1_WP_010908231_1_1418_A8144_RS06785: 0.000004, NZ_CP029543_1_WP_010908231_1_1351_DIJ64_RS06860: 0.000004, NZ_AP014567_1_WP_010908231_1_1382_priA: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.79863 q = 44.22875
(p1 = 0.00001) w = 12.94445
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00049 0.00202 0.00402 0.00648 0.00950 0.01326 0.01809 0.02471 0.03491 0.05705 12.94445
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 566.0 169.0 0.0172 0.0000 0.0000 0.0 0.0
7..2 0.000 566.0 169.0 0.0172 0.0000 0.0000 0.0 0.0
7..3 0.000 566.0 169.0 0.0172 0.0000 0.0000 0.0 0.0
7..4 0.000 566.0 169.0 0.0172 0.0000 0.0000 0.0 0.0
7..5 0.000 566.0 169.0 0.0172 0.0000 0.0000 0.0 0.0
7..6 0.000 566.0 169.0 0.0172 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908231_1_1329_MLBR_RS06240)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.100 0.101 0.103 0.104 0.105
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.097 0.096
Time used: 0:22
Model 1: NearlyNeutral -969.091957 Model 2: PositiveSelection -969.091957 Model 0: one-ratio -969.09239 Model 7: beta -969.091957 Model 8: beta&w>1 -969.091986 Model 0 vs 1 8.660000000872969E-4 Model 2 vs 1 0.0 Model 8 vs 7 5.800000008093775E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
