--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Mon Dec 05 09:46:42 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/373/RPA2-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2809.02 -2825.15
2 -2809.21 -2825.99
--------------------------------------
TOTAL -2809.11 -2825.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.210236 0.010595 1.024679 1.420749 1.204523 1414.33 1457.67 1.000
r(A<->C){all} 0.110637 0.000407 0.072182 0.150517 0.109336 1146.84 1158.78 1.000
r(A<->G){all} 0.324980 0.001435 0.252437 0.398673 0.324466 764.44 876.09 1.000
r(A<->T){all} 0.073032 0.000427 0.034133 0.113933 0.071607 887.25 910.94 1.000
r(C<->G){all} 0.078661 0.000245 0.049255 0.109580 0.077504 1226.96 1235.74 1.000
r(C<->T){all} 0.344704 0.001333 0.277671 0.419486 0.344619 749.67 823.51 1.000
r(G<->T){all} 0.067986 0.000277 0.037146 0.100768 0.067005 1224.15 1260.00 1.001
pi(A){all} 0.234624 0.000212 0.205474 0.261198 0.233830 1009.49 1022.78 1.000
pi(C){all} 0.270069 0.000215 0.241585 0.298633 0.269992 1286.83 1291.67 1.000
pi(G){all} 0.281567 0.000219 0.254645 0.311200 0.281372 993.00 1160.08 1.000
pi(T){all} 0.213740 0.000182 0.187366 0.239303 0.213989 1044.51 1204.94 1.000
alpha{1,2} 0.129868 0.000227 0.100792 0.158588 0.128959 1425.12 1463.06 1.000
alpha{3} 3.466050 0.902013 1.786479 5.238749 3.344522 1078.06 1289.53 1.001
pinvar{all} 0.247450 0.002605 0.148051 0.350267 0.248377 1266.75 1287.19 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -2625.435695
Model 2: PositiveSelection -2625.435695
Model 0: one-ratio -2640.459092
Model 3: discrete -2616.379039
Model 7: beta -2617.179514
Model 8: beta&w>1 -2616.826104
Model 0 vs 1 30.046793999999863
Model 2 vs 1 0.0
Model 8 vs 7 0.7068199999994249
>C1
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C2
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C3
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C4
MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY
AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSEEG
ISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C5
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C6
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY
AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK
NKGGSGAVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSEEG
ISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C7
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
NKGGSGAVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSEEG
ISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C8
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ
SKGGSGAGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSEEG
ISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C9
MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
NKGGSSGVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSEEG
ISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo
>C10
MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ
NKGGSSAVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSEEG
ISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo
>C11
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY
GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ
NKGGSGAVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSEEG
ISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=248
C1 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
C2 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
C3 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
C4 MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY
C5 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
C6 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY
C7 MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
C8 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
C9 MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
C10 MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
C11 MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY
********** ***.:****.******.***:**:*********:*****
C1 AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
C2 AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
C3 AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
C4 AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN
C5 AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
C6 AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN
C7 AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
C8 AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
C9 AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN
C10 AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
C11 GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
.*.***.****:*********::******:******************:*
C1 NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
C2 NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
C3 NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
C4 NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
C5 NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
C6 NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK
C7 NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
C8 NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ
C9 NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
C10 NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ
C11 NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ
************.*.****:*****:*****:******.**********:
C1 SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
C2 SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
C3 SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
C4 SKGGAG--AGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE
C5 SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
C6 NKGGSG--AVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE
C7 NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
C8 SKGGSG--AGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE
C9 NKGGSS--GVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
C10 NKGGSS--AVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
C11 NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
.***:. . *.** *.*:***:***:******:*********** ****
C1 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
C2 EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
C3 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
C4 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
C5 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
C6 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
C7 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
C8 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
C9 EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo
C10 EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo
C11 EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
******:****************:**********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 246 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 246 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [27854]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [27854]--->[27668]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/373/RPA2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.619 Mb, Max= 31.378 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
>C2
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
>C3
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
>C4
MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY
AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAG--AGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C5
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
>C6
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY
AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK
NKGGSG--AVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C7
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C8
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ
SKGGSG--AGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C9
MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
NKGGSS--GVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo
>C10
MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ
NKGGSS--AVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo
>C11
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY
GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ
NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
FORMAT of file /tmp/tmp5941705772337115304aln Not Supported[FATAL:T-COFFEE]
>C1
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
>C2
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
>C3
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
>C4
MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY
AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAG--AGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C5
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
>C6
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY
AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK
NKGGSG--AVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C7
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C8
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ
SKGGSG--AGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
>C9
MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
NKGGSS--GVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo
>C10
MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ
NKGGSS--AVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo
>C11
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY
GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ
NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:248 S:99 BS:248
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 98.78 C1 C2 98.78
TOP 1 0 98.78 C2 C1 98.78
BOT 0 2 99.19 C1 C3 99.19
TOP 2 0 99.19 C3 C1 99.19
BOT 0 3 96.72 C1 C4 96.72
TOP 3 0 96.72 C4 C1 96.72
BOT 0 4 97.97 C1 C5 97.97
TOP 4 0 97.97 C5 C1 97.97
BOT 0 5 94.67 C1 C6 94.67
TOP 5 0 94.67 C6 C1 94.67
BOT 0 6 96.31 C1 C7 96.31
TOP 6 0 96.31 C7 C1 96.31
BOT 0 7 95.49 C1 C8 95.49
TOP 7 0 95.49 C8 C1 95.49
BOT 0 8 92.21 C1 C9 92.21
TOP 8 0 92.21 C9 C1 92.21
BOT 0 9 92.21 C1 C10 92.21
TOP 9 0 92.21 C10 C1 92.21
BOT 0 10 95.08 C1 C11 95.08
TOP 10 0 95.08 C11 C1 95.08
BOT 1 2 99.59 C2 C3 99.59
TOP 2 1 99.59 C3 C2 99.59
BOT 1 3 95.90 C2 C4 95.90
TOP 3 1 95.90 C4 C2 95.90
BOT 1 4 97.56 C2 C5 97.56
TOP 4 1 97.56 C5 C2 97.56
BOT 1 5 94.26 C2 C6 94.26
TOP 5 1 94.26 C6 C2 94.26
BOT 1 6 96.72 C2 C7 96.72
TOP 6 1 96.72 C7 C2 96.72
BOT 1 7 95.08 C2 C8 95.08
TOP 7 1 95.08 C8 C2 95.08
BOT 1 8 92.62 C2 C9 92.62
TOP 8 1 92.62 C9 C2 92.62
BOT 1 9 92.62 C2 C10 92.62
TOP 9 1 92.62 C10 C2 92.62
BOT 1 10 94.67 C2 C11 94.67
TOP 10 1 94.67 C11 C2 94.67
BOT 2 3 96.31 C3 C4 96.31
TOP 3 2 96.31 C4 C3 96.31
BOT 2 4 97.97 C3 C5 97.97
TOP 4 2 97.97 C5 C3 97.97
BOT 2 5 94.67 C3 C6 94.67
TOP 5 2 94.67 C6 C3 94.67
BOT 2 6 97.13 C3 C7 97.13
TOP 6 2 97.13 C7 C3 97.13
BOT 2 7 95.49 C3 C8 95.49
TOP 7 2 95.49 C8 C3 95.49
BOT 2 8 93.03 C3 C9 93.03
TOP 8 2 93.03 C9 C3 93.03
BOT 2 9 93.03 C3 C10 93.03
TOP 9 2 93.03 C10 C3 93.03
BOT 2 10 95.08 C3 C11 95.08
TOP 10 2 95.08 C11 C3 95.08
BOT 3 4 96.31 C4 C5 96.31
TOP 4 3 96.31 C5 C4 96.31
BOT 3 5 91.46 C4 C6 91.46
TOP 5 3 91.46 C6 C4 91.46
BOT 3 6 93.50 C4 C7 93.50
TOP 6 3 93.50 C7 C4 93.50
BOT 3 7 93.09 C4 C8 93.09
TOP 7 3 93.09 C8 C4 93.09
BOT 3 8 90.65 C4 C9 90.65
TOP 8 3 90.65 C9 C4 90.65
BOT 3 9 90.65 C4 C10 90.65
TOP 9 3 90.65 C10 C4 90.65
BOT 3 10 93.90 C4 C11 93.90
TOP 10 3 93.90 C11 C4 93.90
BOT 4 5 93.03 C5 C6 93.03
TOP 5 4 93.03 C6 C5 93.03
BOT 4 6 95.49 C5 C7 95.49
TOP 6 4 95.49 C7 C5 95.49
BOT 4 7 94.67 C5 C8 94.67
TOP 7 4 94.67 C8 C5 94.67
BOT 4 8 93.03 C5 C9 93.03
TOP 8 4 93.03 C9 C5 93.03
BOT 4 9 93.03 C5 C10 93.03
TOP 9 4 93.03 C10 C5 93.03
BOT 4 10 94.26 C5 C11 94.26
TOP 10 4 94.26 C11 C5 94.26
BOT 5 6 97.56 C6 C7 97.56
TOP 6 5 97.56 C7 C6 97.56
BOT 5 7 94.31 C6 C8 94.31
TOP 7 5 94.31 C8 C6 94.31
BOT 5 8 92.68 C6 C9 92.68
TOP 8 5 92.68 C9 C6 92.68
BOT 5 9 92.68 C6 C10 92.68
TOP 9 5 92.68 C10 C6 92.68
BOT 5 10 94.72 C6 C11 94.72
TOP 10 5 94.72 C11 C6 94.72
BOT 6 7 95.93 C7 C8 95.93
TOP 7 6 95.93 C8 C7 95.93
BOT 6 8 95.12 C7 C9 95.12
TOP 8 6 95.12 C9 C7 95.12
BOT 6 9 95.12 C7 C10 95.12
TOP 9 6 95.12 C10 C7 95.12
BOT 6 10 96.34 C7 C11 96.34
TOP 10 6 96.34 C11 C7 96.34
BOT 7 8 93.09 C8 C9 93.09
TOP 8 7 93.09 C9 C8 93.09
BOT 7 9 94.31 C8 C10 94.31
TOP 9 7 94.31 C10 C8 94.31
BOT 7 10 95.53 C8 C11 95.53
TOP 10 7 95.53 C11 C8 95.53
BOT 8 9 97.56 C9 C10 97.56
TOP 9 8 97.56 C10 C9 97.56
BOT 8 10 93.90 C9 C11 93.90
TOP 10 8 93.90 C11 C9 93.90
BOT 9 10 94.72 C10 C11 94.72
TOP 10 9 94.72 C11 C10 94.72
AVG 0 C1 * 95.86
AVG 1 C2 * 95.78
AVG 2 C3 * 96.15
AVG 3 C4 * 93.85
AVG 4 C5 * 95.33
AVG 5 C6 * 94.01
AVG 6 C7 * 95.92
AVG 7 C8 * 94.70
AVG 8 C9 * 93.39
AVG 9 C10 * 93.59
AVG 10 C11 * 94.82
TOT TOT * 94.86
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCAACTGG
C2 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG
C3 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG
C4 ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCAGTGG
C5 ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG
C6 ATGAACGATTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCACTGG
C7 ATGAACGATTCATTTGGAGATTTTAATGCCACACAAACTGCGCCCGCTGG
C8 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCACTGG
C9 ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGACCGCTGG
C10 ATGAATGATTCGTTTGGAGATTTCAATGCCATACAAACTGCGACCGCTGG
C11 ATGAACGATTCATTTGGAGATTTCAACGCCACACAAACGGCGCCCACGGG
***** ** **.*********** ** **** ****** ***.*.. **
C1 AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC
C2 AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC
C3 AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC
C4 AGCCGCCAGTTCTCAAAAGGGAGAAGGAATAGCGCCCCTGGTGGTGAAAC
C5 AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC
C6 AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTTCCACTGGTGATAAAGC
C7 AGCGGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCGCTGGTGATTAAGC
C8 AGCCGCCAGCAATCAAAAGGGAGAGGGAATAGTACCATTGGTGGTAAAGC
C9 AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTCATTAAGC
C10 AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTAATAAAGC
C11 AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCACTGGTGGTGAAGC
*** ***** :.***.********.*****:* ** **** .* **.*
C1 AGATTGTGGACGCCCCAGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC
C2 AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC
C3 AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC
C4 AGATTGTGGACGCCCCGGAGGGAAACATCGAGATGTTCGGCATGCAGTAC
C5 AGATCGTGGACGCCCCGGAGGGCAACATCGAGTTGTTCGGCATGCAGTAC
C6 AAGTTGTGGATGCCCCCGAGGGCAACATCGAGCTGTTCGGCATGCAATAT
C7 AGATTGTGGATGCCCCCGAGGGCAACATCGAGTTGTTTGGCATGCAATAT
C8 AAATTGTGGATGCCCCAGAGGGAAACATTGAGCTGTTCGGCATGCAATAT
C9 AGATTGTGGATGCGCCAGAGGGAAACATCGAGTTGTTTGGCATGCAATAT
C10 AGATTGTGGATGCGCCGGAGGGAAACATCGAGTTGTTCGGCATGCAATAT
C11 AGATTGTGGATGCCCCGGAGGGCAACATCGAGATGTTCGGCATGCAATAC
*..* ***** ** ** *****.***** *** **** ********.**
C1 GCCATGGCATGTGTTGTGGCCATAGTGCGGAACGTGGAGACTTCCTCGAC
C2 GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCGAC
C3 GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCAAC
C4 GCAATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC
C5 GCGATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC
C6 GCCATGGTCTGTGTGGTGGGCATAGTGCGCAACGTCGAGACCTCCTCGAC
C7 GCGATGGCCTGTGTGGTGGGCATAGTGCGAAATGTCGAGACTTCCTCAAC
C8 GCCATGGCCTGTGTGGTGGGCATTGTGCGAAACATCGAGACTTCCTCGAC
C9 GCAATGGCCTGTGTGGTGGCCATAGTGCGAAATATCGAGACTTCCTCGAC
C10 GCCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACCTCATCGAC
C11 GGCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACTTCCTCGAC
* **** .***** **** ***:***** ** .* ***** **.**.**
C1 GAAGATCACCTACACCCTGGAGGATCATAGCGGCAGGATCGATGCGCACT
C2 GAAGATCACCTATACACTGGAGGATCATAGCGGCAGGATCGATGCGCACT
C3 GAAGATCACCTATACACTGGAGGACCATAGCGGCAGGATCGATGCGCACT
C4 AAAGATTACCTACGCCCTGGAGGATCATAGCGGCAGAATCGATGCGCACT
C5 CAAGATCACCTACACGCTGGAGGATCATAGCGGCAGAATCGATGCGCACT
C6 GAAGATTACCTACACCGTGGAGGATCACAGTGGCAGGATCGATGCGCACT
C7 GAAGATTACTTACACCCTGGAGGATCACAGTGGCAGGATCGATGCGCACT
C8 AAAGATTACCTACACCCTAGAGGATCACAGTGGTAGGATCGATGCACACT
C9 CAAGATTACTTACACCCTGGAGGATCACAGTGGCCGGATGGATGCCCATT
C10 CAAGATCACTTACACCCTGGAGGATCACAGTGGCCGAATCGATGCACATT
C11 GAAGATTACCTACACCCTGGAGGACCACAGCGGCAGGATCGATGCGCACT
***** ** ** .* *.***** ** ** ** .*.** ***** ** *
C1 ACTGGCTTGAGGAGGGCGACGCTCTCAAGGCACCCGAAGTAATGGTCAAC
C2 ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC
C3 ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC
C4 ACTGGTTGGAGGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGATCAAC
C5 ACTGGCTGGAAGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGGTCAAC
C6 ACTGGCTGGAGGAGGGCGACGCGCTGAAGGCCCCCGAGGTCATGGTCAAC
C7 ATTGGCTAGAAGAAGGCGACGCCCTGAAGGCCCCCGAAGTCATGGTCAAC
C8 ATTGGCTGGAGGAGGGCGACGCCCTGAAGGCGCCCGAAGTGATGGTCAAT
C9 ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAAGTCATGCTCAAT
C10 ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAGGTCATGCTCAAT
C11 ATTGGTTGGAGGAGGGCGACGCCCTCAAGGCCCCCGAGGTCATGCTGAAC
* *** * **.**.***** ** ** ***** *****.** *** * **
C1 AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC
C2 AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC
C3 AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC
C4 AACTACGTAAAGGTCTACGGCACCACCCGATCGCAAGGAGGTTCTAAAAC
C5 AACTACGTGAAGGTCTACGGCACCACCAGATCGCAAGGCGGCTCTAAGAC
C6 AACTATGTTAAGGTCTACGGCACCACGCGATCGCAGGGGGGTCAGAAAAC
C7 AACTATGTGAAGGTCTATGGCACCACACGATCGCAGGGGGGGCAGAAAAC
C8 AACTATGTAAAGGTCTATGGCACTACGCGTTCACAAGCGGGCCAGAAAAC
C9 AACTATGTGAAAGTGTATGGAACCACGCGATCGCAGGGAGGTCAGAAAAC
C10 AACTATGTGAAGGTCTATGGCACAACGCGATCTCAGGCAGGTCAGAAAAC
C11 AACTACGTGAAGGTCTATGGCACCACGCGATCGCAGGCGGGCCAGAAGAC
***** ** **.** ** **.** ** .* ** **.* ** . **.**
C1 CCTAATGATCTTCAAGCTACTGCCCGTTTTGGATCCCAACGAGGTGTGCA
C2 CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA
C3 CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA
C4 CCTAATGATCTTCAAGTTACTGCCTGTTTTGGATCCCAACGAGGTCTGCA
C5 CCTGATGATCTTCAAGCTGCTGCCTGTTCTCGATCCCAACGAGGTGTGCA
C6 CCTGATGGTCTTCAAGCTGCTGCCCGTGCTGGACCCCAACGAGGTGTGCA
C7 ACTGATGGTCTTCAAGCTGCTGCCCGTTTTGGACCCCAACGAGGTGTGCA
C8 CCTGATGGTCTTTAAACTCCTGCCCATTCTGGATCCCAATGAGGTGTGCA
C9 CCTGATGGTGTTCAAACTGCTGCCCGTTTTGGATCCCAACGAGGTGTGCA
C10 GCTGATGGTCTTCAAATTGCTACCCATTTTGGATCCCAACGAGGTGTGCA
C11 CCTAATGGTCTTCAAACTGCTGCCCGTTTTGGACCCAAACGAGCTGTGCA
**.***.* ** **. * **.** .* * ** **.** *** * ****
C1 CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG
C2 CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG
C3 CGCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG
C4 CCCACCTGCTGGAAGTACTCAATGCCCGTTACAGGGCCGAGGACTACCAG
C5 CCCACCTGCTGGAAGCACTCAATGCCCGCTACAGGGCCGAGGACTACCAG
C6 CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGACTACAAG
C7 CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGATTACCAG
C8 CCCATCTTCTTGAAGTTCTAAATGCCCGCTACAGGGCCGAGGATTACCAG
C9 CACATCTCCTAGAAGCTCTCAATGCCCGCTATAGGGCAGAGGATTACCAG
C10 CCCATCTCCTGGAAGCTCTCAATGCCCGCTATAGGGCAGAGGACTACCAG
C11 CCCATCTCCTAGAAGTGCTCAATGCGCGCTACAGGGCCGAGGATTACCAG
* ** ** ** **.* **.***** ** ** *****.***** ***.**
C1 AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC
C2 AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC
C3 AGCAAGGGTGGAGCTGGAGCTGGTGCAGGCGCTTCTTCCGGCTCAGGCTC
C4 AGTAAGGGTGGAGCTGGT------GCAGGCGCTTCCTCCGGCTCCGGCTC
C5 AGCAAGGGTGGAGCTGGTGGTGGTGCAGGGGCTTCTTCCGGCTCAGGCCC
C6 AACAAGGGGGGATCTGGT------GCAGTGGCTTCATCCGGCTCTGGCTC
C7 AACAAGGGGGGATCTGGT------GCAGTGGCTTCTTCAGGCTCCGGCTC
C8 AGCAAAGGTGGATCTGGC------GCTGGAGCTTCTTCTGGAGGTGGCTC
C9 AACAAGGGAGGATCTTCG------GGAGTGGCTCCTTCTGGCACCGGCTC
C10 AACAAGGGAGGATCCTCA------GCAGTTGCTCCGTCGGGCTCCGGCTC
C11 AACAAGGGCGGATCTGGC------GCAGTGGCTTCTTCCGGCTCCGGCTC
*. **.** *** * * :* *** * ** **. *** *
C1 CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTGG
C2 CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTAG
C3 CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTTAGTGGGCTAG
C4 CATAGCTGATTTCACAGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG
C5 CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG
C6 CATAGCCGACTTCACCACCTCCCAGAGCTCGGCCATTGTGAGTGGGCTGG
C7 CATAGCCGATTTTACCGCCTCCCAGAGCTCAGCCATTGTGAGTGGGCTGG
C8 CATATCCGATTTCACCGCCTCCCAGAGCACGGCTATTGTTAGTGGGCTTG
C9 CATATCCGATTTCACCGCCTCTCAGAGCTCGGCCATCGTCAGTGGGCTGG
C10 CATATCCGATTTCACAGCCTCCCAGAGCTCGGCCATCGTCAGTGGGCTGG
C11 CATAGCTGACTTCACCGCCTCCCAGAGCTCGGCCATTGTAAGTGGGCTGG
**** * ** ** **..**** ******:*.** ** ** *****.** *
C1 AGCCCAAGCAGCAGGCCGTATTCCAGGCCATCAAGAGCAATGTTTCCGAG
C2 ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA
C3 ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA
C4 AGCCCAAGCAGCAGGCCGTTTTCCAGGCTATCAAGATCAATGTTTCCGAG
C5 AGCCCAAGCAGCAGGCCGTGTTCCAGGCCATCAAGAGCAATGTTTCCGAG
C6 ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG
C7 ATCCCAAGCAGCAGGCTGTCTTCCAAGCCATTAAGAGCAATGTCTCCGAG
C8 ATCCCAAGCAGCAGGCCGTTTTCCAGGCCATTAAGAGCAATGTTTCCGAG
C9 ATCCCAAGCAGCAGGCAGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG
C10 ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG
C11 ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG
* ************** ** *****.** ** **** ****** *****.
C1 GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA
C2 GAGGGCATCTCCCGCAAGCAACTGAAAGCCAAATTCTCCCACATCAGCGA
C3 GAGGGCATCTCTCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA
C4 GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTTTCCCATATCAGCGA
C5 GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTCTCCCACATCAGCGA
C6 GAGGGCATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA
C7 GAGGGTATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA
C8 GAGGGTATTTCCCGTAAGGAGCTAAAAGCGAAGTTCTCTCATATTAGCGA
C9 GAGGGCATCTCTCGCAAGGAACTAAAGGCCAAGTTCTCCCACATCAGCGA
C10 GAGGGCATCTCCCGCAAGGAACTCAAAGCCAAATTCTCTCACATCAGCGA
C11 GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAGTTCTCGCACATCAGTGA
***** ** ** ** *** *.** **.** **.** ** ** ** ** **
C1 CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT
C2 CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT
C3 TTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT
C4 CTCTGAGTTGACCAACATTCTGGACTTTATGATATCTGAGGGACACATTT
C5 CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT
C6 TTCGGAACTGACCAACATTCTGGACTTCATGATTTCCGAGGGGCACATTT
C7 CTCGGAGTTGACCAACATTCTGGACTTCATGATTTCCGAGGGACACATTT
C8 TTCTGAGTTGACCAACATTTTGGACTTTATGATTTCCGAGGGACACATTT
C9 CTCGGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGTCATATAT
C10 CTCCGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGACATATTT
C11 CTCGGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT
** **. ******* *** ******* *****:** **.** ** **:*
C1 ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------
C2 ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------
C3 ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------
C4 ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------
C5 ATTCCAGCATTGACGCAGACCACTTTATTTGCACAATG------
C6 ATTCCAGCATTGATGCTGATCACTTTATCTGCACCATG------
C7 ATTCCAGCATTGATGCAGATCATTTCATATGCACCATG------
C8 ACTCCAGCATTGATGCGGATCATTTTATTTGCACAATG------
C9 ACTCCAGCATTGATGCCGATCACTTTATTTGCACTATG------
C10 ACTCCAGCATTGATGCCGATCACTTCATTTGCACTATG------
C11 ACTCCAGCATTGATGCTGATCATTTTATTTGCACAATG------
* *********** ** ** ** ** ** ***** ***
>C1
ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCAACTGG
AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC
AGATTGTGGACGCCCCAGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC
GCCATGGCATGTGTTGTGGCCATAGTGCGGAACGTGGAGACTTCCTCGAC
GAAGATCACCTACACCCTGGAGGATCATAGCGGCAGGATCGATGCGCACT
ACTGGCTTGAGGAGGGCGACGCTCTCAAGGCACCCGAAGTAATGGTCAAC
AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC
CCTAATGATCTTCAAGCTACTGCCCGTTTTGGATCCCAACGAGGTGTGCA
CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG
AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC
CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTGG
AGCCCAAGCAGCAGGCCGTATTCCAGGCCATCAAGAGCAATGTTTCCGAG
GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA
CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT
ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------
>C2
ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG
AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC
AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC
GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCGAC
GAAGATCACCTATACACTGGAGGATCATAGCGGCAGGATCGATGCGCACT
ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC
AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC
CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA
CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG
AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC
CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTAG
ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA
GAGGGCATCTCCCGCAAGCAACTGAAAGCCAAATTCTCCCACATCAGCGA
CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT
ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------
>C3
ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG
AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC
AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC
GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCAAC
GAAGATCACCTATACACTGGAGGACCATAGCGGCAGGATCGATGCGCACT
ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC
AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC
CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA
CGCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG
AGCAAGGGTGGAGCTGGAGCTGGTGCAGGCGCTTCTTCCGGCTCAGGCTC
CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTTAGTGGGCTAG
ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA
GAGGGCATCTCTCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA
TTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT
ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------
>C4
ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCAGTGG
AGCCGCCAGTTCTCAAAAGGGAGAAGGAATAGCGCCCCTGGTGGTGAAAC
AGATTGTGGACGCCCCGGAGGGAAACATCGAGATGTTCGGCATGCAGTAC
GCAATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC
AAAGATTACCTACGCCCTGGAGGATCATAGCGGCAGAATCGATGCGCACT
ACTGGTTGGAGGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGATCAAC
AACTACGTAAAGGTCTACGGCACCACCCGATCGCAAGGAGGTTCTAAAAC
CCTAATGATCTTCAAGTTACTGCCTGTTTTGGATCCCAACGAGGTCTGCA
CCCACCTGCTGGAAGTACTCAATGCCCGTTACAGGGCCGAGGACTACCAG
AGTAAGGGTGGAGCTGGT------GCAGGCGCTTCCTCCGGCTCCGGCTC
CATAGCTGATTTCACAGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG
AGCCCAAGCAGCAGGCCGTTTTCCAGGCTATCAAGATCAATGTTTCCGAG
GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTTTCCCATATCAGCGA
CTCTGAGTTGACCAACATTCTGGACTTTATGATATCTGAGGGACACATTT
ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------
>C5
ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG
AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC
AGATCGTGGACGCCCCGGAGGGCAACATCGAGTTGTTCGGCATGCAGTAC
GCGATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC
CAAGATCACCTACACGCTGGAGGATCATAGCGGCAGAATCGATGCGCACT
ACTGGCTGGAAGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGGTCAAC
AACTACGTGAAGGTCTACGGCACCACCAGATCGCAAGGCGGCTCTAAGAC
CCTGATGATCTTCAAGCTGCTGCCTGTTCTCGATCCCAACGAGGTGTGCA
CCCACCTGCTGGAAGCACTCAATGCCCGCTACAGGGCCGAGGACTACCAG
AGCAAGGGTGGAGCTGGTGGTGGTGCAGGGGCTTCTTCCGGCTCAGGCCC
CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG
AGCCCAAGCAGCAGGCCGTGTTCCAGGCCATCAAGAGCAATGTTTCCGAG
GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTCTCCCACATCAGCGA
CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT
ATTCCAGCATTGACGCAGACCACTTTATTTGCACAATG------
>C6
ATGAACGATTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCACTGG
AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTTCCACTGGTGATAAAGC
AAGTTGTGGATGCCCCCGAGGGCAACATCGAGCTGTTCGGCATGCAATAT
GCCATGGTCTGTGTGGTGGGCATAGTGCGCAACGTCGAGACCTCCTCGAC
GAAGATTACCTACACCGTGGAGGATCACAGTGGCAGGATCGATGCGCACT
ACTGGCTGGAGGAGGGCGACGCGCTGAAGGCCCCCGAGGTCATGGTCAAC
AACTATGTTAAGGTCTACGGCACCACGCGATCGCAGGGGGGTCAGAAAAC
CCTGATGGTCTTCAAGCTGCTGCCCGTGCTGGACCCCAACGAGGTGTGCA
CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGACTACAAG
AACAAGGGGGGATCTGGT------GCAGTGGCTTCATCCGGCTCTGGCTC
CATAGCCGACTTCACCACCTCCCAGAGCTCGGCCATTGTGAGTGGGCTGG
ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG
GAGGGCATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA
TTCGGAACTGACCAACATTCTGGACTTCATGATTTCCGAGGGGCACATTT
ATTCCAGCATTGATGCTGATCACTTTATCTGCACCATG------
>C7
ATGAACGATTCATTTGGAGATTTTAATGCCACACAAACTGCGCCCGCTGG
AGCGGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCGCTGGTGATTAAGC
AGATTGTGGATGCCCCCGAGGGCAACATCGAGTTGTTTGGCATGCAATAT
GCGATGGCCTGTGTGGTGGGCATAGTGCGAAATGTCGAGACTTCCTCAAC
GAAGATTACTTACACCCTGGAGGATCACAGTGGCAGGATCGATGCGCACT
ATTGGCTAGAAGAAGGCGACGCCCTGAAGGCCCCCGAAGTCATGGTCAAC
AACTATGTGAAGGTCTATGGCACCACACGATCGCAGGGGGGGCAGAAAAC
ACTGATGGTCTTCAAGCTGCTGCCCGTTTTGGACCCCAACGAGGTGTGCA
CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGATTACCAG
AACAAGGGGGGATCTGGT------GCAGTGGCTTCTTCAGGCTCCGGCTC
CATAGCCGATTTTACCGCCTCCCAGAGCTCAGCCATTGTGAGTGGGCTGG
ATCCCAAGCAGCAGGCTGTCTTCCAAGCCATTAAGAGCAATGTCTCCGAG
GAGGGTATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA
CTCGGAGTTGACCAACATTCTGGACTTCATGATTTCCGAGGGACACATTT
ATTCCAGCATTGATGCAGATCATTTCATATGCACCATG------
>C8
ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCACTGG
AGCCGCCAGCAATCAAAAGGGAGAGGGAATAGTACCATTGGTGGTAAAGC
AAATTGTGGATGCCCCAGAGGGAAACATTGAGCTGTTCGGCATGCAATAT
GCCATGGCCTGTGTGGTGGGCATTGTGCGAAACATCGAGACTTCCTCGAC
AAAGATTACCTACACCCTAGAGGATCACAGTGGTAGGATCGATGCACACT
ATTGGCTGGAGGAGGGCGACGCCCTGAAGGCGCCCGAAGTGATGGTCAAT
AACTATGTAAAGGTCTATGGCACTACGCGTTCACAAGCGGGCCAGAAAAC
CCTGATGGTCTTTAAACTCCTGCCCATTCTGGATCCCAATGAGGTGTGCA
CCCATCTTCTTGAAGTTCTAAATGCCCGCTACAGGGCCGAGGATTACCAG
AGCAAAGGTGGATCTGGC------GCTGGAGCTTCTTCTGGAGGTGGCTC
CATATCCGATTTCACCGCCTCCCAGAGCACGGCTATTGTTAGTGGGCTTG
ATCCCAAGCAGCAGGCCGTTTTCCAGGCCATTAAGAGCAATGTTTCCGAG
GAGGGTATTTCCCGTAAGGAGCTAAAAGCGAAGTTCTCTCATATTAGCGA
TTCTGAGTTGACCAACATTTTGGACTTTATGATTTCCGAGGGACACATTT
ACTCCAGCATTGATGCGGATCATTTTATTTGCACAATG------
>C9
ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGACCGCTGG
AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTCATTAAGC
AGATTGTGGATGCGCCAGAGGGAAACATCGAGTTGTTTGGCATGCAATAT
GCAATGGCCTGTGTGGTGGCCATAGTGCGAAATATCGAGACTTCCTCGAC
CAAGATTACTTACACCCTGGAGGATCACAGTGGCCGGATGGATGCCCATT
ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAAGTCATGCTCAAT
AACTATGTGAAAGTGTATGGAACCACGCGATCGCAGGGAGGTCAGAAAAC
CCTGATGGTGTTCAAACTGCTGCCCGTTTTGGATCCCAACGAGGTGTGCA
CACATCTCCTAGAAGCTCTCAATGCCCGCTATAGGGCAGAGGATTACCAG
AACAAGGGAGGATCTTCG------GGAGTGGCTCCTTCTGGCACCGGCTC
CATATCCGATTTCACCGCCTCTCAGAGCTCGGCCATCGTCAGTGGGCTGG
ATCCCAAGCAGCAGGCAGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG
GAGGGCATCTCTCGCAAGGAACTAAAGGCCAAGTTCTCCCACATCAGCGA
CTCGGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGTCATATAT
ACTCCAGCATTGATGCCGATCACTTTATTTGCACTATG------
>C10
ATGAATGATTCGTTTGGAGATTTCAATGCCATACAAACTGCGACCGCTGG
AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTAATAAAGC
AGATTGTGGATGCGCCGGAGGGAAACATCGAGTTGTTCGGCATGCAATAT
GCCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACCTCATCGAC
CAAGATCACTTACACCCTGGAGGATCACAGTGGCCGAATCGATGCACATT
ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAGGTCATGCTCAAT
AACTATGTGAAGGTCTATGGCACAACGCGATCTCAGGCAGGTCAGAAAAC
GCTGATGGTCTTCAAATTGCTACCCATTTTGGATCCCAACGAGGTGTGCA
CCCATCTCCTGGAAGCTCTCAATGCCCGCTATAGGGCAGAGGACTACCAG
AACAAGGGAGGATCCTCA------GCAGTTGCTCCGTCGGGCTCCGGCTC
CATATCCGATTTCACAGCCTCCCAGAGCTCGGCCATCGTCAGTGGGCTGG
ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG
GAGGGCATCTCCCGCAAGGAACTCAAAGCCAAATTCTCTCACATCAGCGA
CTCCGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGACATATTT
ACTCCAGCATTGATGCCGATCACTTCATTTGCACTATG------
>C11
ATGAACGATTCATTTGGAGATTTCAACGCCACACAAACGGCGCCCACGGG
AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCACTGGTGGTGAAGC
AGATTGTGGATGCCCCGGAGGGCAACATCGAGATGTTCGGCATGCAATAC
GGCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACTTCCTCGAC
GAAGATTACCTACACCCTGGAGGACCACAGCGGCAGGATCGATGCGCACT
ATTGGTTGGAGGAGGGCGACGCCCTCAAGGCCCCCGAGGTCATGCTGAAC
AACTACGTGAAGGTCTATGGCACCACGCGATCGCAGGCGGGCCAGAAGAC
CCTAATGGTCTTCAAACTGCTGCCCGTTTTGGACCCAAACGAGCTGTGCA
CCCATCTCCTAGAAGTGCTCAATGCGCGCTACAGGGCCGAGGATTACCAG
AACAAGGGCGGATCTGGC------GCAGTGGCTTCTTCCGGCTCCGGCTC
CATAGCTGACTTCACCGCCTCCCAGAGCTCGGCCATTGTAAGTGGGCTGG
ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG
GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAGTTCTCGCACATCAGTGA
CTCGGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT
ACTCCAGCATTGATGCTGATCATTTTATTTGCACAATG------
>C1
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C2
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C3
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C4
MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY
AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
SKGGAGooAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C5
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C6
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY
AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK
NKGGSGooAVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C7
MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
NKGGSGooAVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C8
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ
SKGGSGooAGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
>C9
MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
NKGGSSooGVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTM
>C10
MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ
NKGGSSooAVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTM
>C11
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY
GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ
NKGGSGooAVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 744 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480929837
Setting output file names to "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1187284641
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 3161018450
Seed = 1279542055
Swapseed = 1480929837
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 38 unique site patterns
Division 2 has 23 unique site patterns
Division 3 has 139 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -3886.167619 -- -24.640631
Chain 2 -- -3780.952214 -- -24.640631
Chain 3 -- -3981.307162 -- -24.640631
Chain 4 -- -4027.892768 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -4071.366047 -- -24.640631
Chain 2 -- -4040.140264 -- -24.640631
Chain 3 -- -4009.468969 -- -24.640631
Chain 4 -- -4107.571721 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-3886.168] (-3780.952) (-3981.307) (-4027.893) * [-4071.366] (-4040.140) (-4009.469) (-4107.572)
500 -- (-3006.759) (-2992.677) (-2991.461) [-2999.610] * (-2973.989) (-2967.073) (-2986.713) [-2933.589] -- 0:00:00
1000 -- [-2907.347] (-2932.010) (-2952.393) (-2942.557) * (-2941.652) (-2881.125) [-2893.364] (-2887.290) -- 0:00:00
1500 -- [-2842.691] (-2905.631) (-2897.282) (-2866.253) * (-2908.415) (-2839.549) [-2826.903] (-2855.687) -- 0:11:05
2000 -- [-2830.174] (-2875.899) (-2836.640) (-2848.930) * (-2836.521) (-2833.218) [-2818.983] (-2826.111) -- 0:08:19
2500 -- [-2828.094] (-2825.421) (-2842.513) (-2831.070) * (-2820.924) (-2834.966) [-2820.513] (-2820.524) -- 0:06:39
3000 -- (-2831.088) (-2823.249) (-2823.854) [-2814.830] * (-2813.310) (-2841.406) [-2809.686] (-2814.806) -- 0:05:32
3500 -- [-2820.233] (-2815.878) (-2827.215) (-2812.506) * (-2815.393) (-2832.887) (-2822.724) [-2813.256] -- 0:09:29
4000 -- (-2824.789) (-2811.898) [-2817.728] (-2813.347) * (-2821.701) (-2822.754) (-2819.659) [-2813.556] -- 0:08:18
4500 -- (-2817.887) [-2813.495] (-2828.043) (-2828.758) * (-2820.245) (-2825.135) (-2819.269) [-2809.272] -- 0:07:22
5000 -- (-2813.475) (-2814.696) [-2814.097] (-2815.056) * (-2817.558) (-2827.016) (-2823.697) [-2817.812] -- 0:06:38
Average standard deviation of split frequencies: 0.042855
5500 -- (-2815.516) (-2823.417) (-2812.251) [-2808.947] * (-2814.665) (-2822.356) (-2823.339) [-2813.537] -- 0:09:02
6000 -- (-2816.998) (-2821.062) [-2826.159] (-2811.549) * (-2818.165) (-2827.108) [-2819.247] (-2820.622) -- 0:08:17
6500 -- (-2820.010) (-2825.856) [-2813.305] (-2812.453) * (-2819.523) (-2825.183) [-2808.917] (-2820.280) -- 0:07:38
7000 -- [-2822.137] (-2815.757) (-2814.623) (-2819.569) * [-2815.271] (-2820.670) (-2815.533) (-2821.570) -- 0:09:27
7500 -- [-2817.464] (-2820.638) (-2811.876) (-2824.071) * [-2815.252] (-2819.772) (-2812.399) (-2823.831) -- 0:08:49
8000 -- [-2815.275] (-2813.378) (-2817.374) (-2820.866) * [-2814.677] (-2821.214) (-2817.569) (-2830.814) -- 0:08:16
8500 -- (-2816.505) (-2816.640) [-2814.346] (-2822.613) * (-2820.656) (-2816.529) (-2822.517) [-2817.111] -- 0:07:46
9000 -- [-2824.674] (-2819.395) (-2817.411) (-2817.426) * [-2812.713] (-2817.826) (-2818.825) (-2818.239) -- 0:09:10
9500 -- [-2811.880] (-2810.633) (-2810.636) (-2820.779) * [-2814.751] (-2814.027) (-2814.180) (-2814.446) -- 0:08:41
10000 -- (-2814.670) (-2823.534) [-2816.270] (-2818.755) * (-2816.276) (-2817.053) (-2814.338) [-2814.552] -- 0:08:15
Average standard deviation of split frequencies: 0.044194
10500 -- (-2821.133) (-2810.422) (-2812.482) [-2813.959] * (-2818.445) [-2818.714] (-2818.745) (-2812.754) -- 0:09:25
11000 -- (-2817.935) [-2812.197] (-2818.405) (-2819.304) * (-2815.951) (-2813.235) [-2809.229] (-2813.517) -- 0:08:59
11500 -- (-2822.119) (-2816.229) (-2823.590) [-2811.799] * (-2819.196) (-2815.600) (-2820.704) [-2819.659] -- 0:08:35
12000 -- (-2822.337) [-2821.454] (-2819.247) (-2813.932) * (-2814.705) (-2821.068) [-2811.198] (-2815.463) -- 0:08:14
12500 -- [-2808.408] (-2813.011) (-2816.269) (-2814.113) * (-2811.605) (-2817.355) (-2820.720) [-2817.848] -- 0:09:13
13000 -- (-2817.474) [-2810.131] (-2827.316) (-2824.164) * [-2812.957] (-2813.073) (-2815.270) (-2815.997) -- 0:08:51
13500 -- [-2818.038] (-2816.674) (-2821.618) (-2815.764) * (-2823.150) (-2818.306) (-2824.280) [-2812.015] -- 0:08:31
14000 -- [-2810.475] (-2825.334) (-2815.864) (-2821.049) * (-2819.969) (-2825.939) [-2815.332] (-2813.296) -- 0:08:13
14500 -- (-2820.021) [-2815.000] (-2821.713) (-2819.476) * (-2820.547) (-2825.119) (-2812.896) [-2812.137] -- 0:09:03
15000 -- (-2816.223) (-2814.139) [-2821.826] (-2818.915) * [-2816.669] (-2814.372) (-2809.109) (-2816.593) -- 0:08:45
Average standard deviation of split frequencies: 0.013095
15500 -- (-2811.891) [-2818.771] (-2825.205) (-2813.162) * (-2827.983) (-2821.778) (-2811.178) [-2811.609] -- 0:08:28
16000 -- (-2807.570) [-2816.676] (-2813.888) (-2813.503) * (-2815.246) (-2816.819) [-2811.793] (-2819.980) -- 0:08:12
16500 -- [-2815.001] (-2818.685) (-2818.795) (-2821.849) * (-2820.130) [-2813.186] (-2825.287) (-2810.377) -- 0:08:56
17000 -- (-2815.104) (-2820.950) (-2815.539) [-2819.634] * (-2814.423) (-2821.747) [-2815.482] (-2819.930) -- 0:08:40
17500 -- (-2813.928) (-2820.810) (-2818.245) [-2821.127] * (-2823.595) (-2828.500) (-2820.083) [-2827.095] -- 0:08:25
18000 -- (-2811.396) (-2816.216) (-2822.854) [-2815.154] * [-2820.095] (-2817.075) (-2821.748) (-2820.936) -- 0:08:11
18500 -- [-2817.750] (-2808.980) (-2819.957) (-2825.623) * [-2811.877] (-2829.355) (-2813.723) (-2812.715) -- 0:08:50
19000 -- (-2821.941) (-2814.628) [-2823.757] (-2816.641) * (-2814.655) (-2827.141) [-2818.402] (-2816.309) -- 0:08:36
19500 -- (-2817.262) (-2823.430) (-2814.797) [-2808.092] * (-2811.671) (-2814.839) [-2809.222] (-2823.292) -- 0:08:22
20000 -- (-2828.782) (-2820.811) [-2820.954] (-2813.633) * (-2817.620) (-2811.590) [-2812.290] (-2822.049) -- 0:08:10
Average standard deviation of split frequencies: 0.041473
20500 -- (-2819.135) (-2828.151) [-2816.340] (-2816.620) * [-2819.105] (-2821.685) (-2818.749) (-2815.525) -- 0:08:45
21000 -- [-2813.318] (-2822.208) (-2816.577) (-2816.767) * (-2814.740) (-2823.677) (-2811.208) [-2812.710] -- 0:08:32
21500 -- (-2812.032) (-2819.044) [-2817.784] (-2820.271) * [-2814.349] (-2826.659) (-2812.789) (-2809.138) -- 0:08:20
22000 -- (-2815.475) [-2812.765] (-2817.770) (-2818.738) * (-2821.558) (-2823.420) (-2821.387) [-2816.578] -- 0:08:09
22500 -- [-2814.131] (-2815.878) (-2818.742) (-2818.537) * (-2816.163) [-2822.234] (-2833.881) (-2830.042) -- 0:08:41
23000 -- (-2827.393) (-2819.181) (-2812.866) [-2812.306] * (-2818.655) [-2816.503] (-2817.437) (-2820.410) -- 0:08:29
23500 -- (-2824.209) (-2814.869) (-2818.023) [-2813.273] * (-2814.882) [-2815.966] (-2816.693) (-2819.660) -- 0:08:18
24000 -- (-2812.042) (-2812.471) (-2819.396) [-2820.953] * [-2812.492] (-2811.749) (-2820.541) (-2818.435) -- 0:08:08
24500 -- (-2809.280) (-2817.653) (-2813.444) [-2815.065] * (-2817.292) [-2814.712] (-2816.418) (-2826.042) -- 0:08:37
25000 -- (-2812.358) [-2809.599] (-2815.695) (-2814.523) * (-2819.540) [-2812.851] (-2821.945) (-2816.982) -- 0:08:26
Average standard deviation of split frequencies: 0.036262
25500 -- (-2815.785) (-2820.226) (-2818.814) [-2817.057] * (-2814.903) (-2812.174) [-2814.942] (-2815.697) -- 0:08:16
26000 -- (-2821.760) (-2824.754) (-2810.119) [-2828.997] * (-2830.841) (-2817.143) [-2811.697] (-2811.956) -- 0:08:07
26500 -- (-2814.377) (-2815.487) (-2812.823) [-2820.926] * (-2823.474) (-2820.231) [-2812.763] (-2815.885) -- 0:08:34
27000 -- (-2809.604) [-2816.150] (-2821.205) (-2816.263) * (-2821.143) (-2820.604) (-2818.961) [-2815.752] -- 0:08:24
27500 -- [-2810.893] (-2806.348) (-2824.480) (-2818.075) * (-2812.647) (-2817.894) (-2821.450) [-2807.117] -- 0:08:15
28000 -- (-2815.223) [-2814.413] (-2825.334) (-2808.972) * (-2826.389) [-2817.543] (-2818.032) (-2816.390) -- 0:08:40
28500 -- (-2824.716) [-2814.804] (-2816.057) (-2818.806) * [-2816.498] (-2823.301) (-2825.028) (-2819.430) -- 0:08:31
29000 -- (-2811.324) [-2812.501] (-2816.444) (-2821.125) * (-2818.783) (-2820.252) (-2824.745) [-2813.702] -- 0:08:22
29500 -- (-2815.001) (-2832.364) [-2813.305] (-2810.909) * (-2826.331) (-2810.013) (-2813.391) [-2810.467] -- 0:08:46
30000 -- (-2813.296) (-2823.114) (-2819.126) [-2815.681] * (-2816.100) (-2831.405) [-2817.662] (-2816.878) -- 0:08:37
Average standard deviation of split frequencies: 0.029207
30500 -- (-2820.520) [-2807.531] (-2821.505) (-2829.749) * [-2810.427] (-2821.629) (-2813.068) (-2825.726) -- 0:08:28
31000 -- [-2812.931] (-2813.581) (-2816.870) (-2819.425) * (-2817.303) [-2812.666] (-2812.471) (-2820.991) -- 0:08:51
31500 -- (-2819.055) (-2819.610) [-2813.737] (-2820.781) * [-2823.735] (-2814.376) (-2818.242) (-2810.311) -- 0:08:42
32000 -- (-2818.561) (-2812.273) [-2817.731] (-2820.405) * [-2816.811] (-2811.674) (-2823.289) (-2814.887) -- 0:08:34
32500 -- (-2815.353) (-2818.457) [-2813.554] (-2814.567) * (-2814.932) (-2814.990) [-2812.050] (-2814.076) -- 0:08:26
33000 -- (-2820.431) (-2816.608) [-2816.259] (-2816.456) * (-2817.995) (-2822.345) (-2808.927) [-2808.990] -- 0:08:47
33500 -- [-2811.737] (-2811.929) (-2807.712) (-2813.536) * (-2824.185) [-2816.302] (-2818.892) (-2816.066) -- 0:08:39
34000 -- [-2816.173] (-2820.471) (-2815.854) (-2820.415) * [-2820.977] (-2816.755) (-2820.445) (-2824.288) -- 0:08:31
34500 -- (-2819.123) [-2814.835] (-2820.052) (-2821.198) * (-2833.594) (-2819.962) (-2808.312) [-2821.614] -- 0:08:51
35000 -- [-2816.879] (-2823.674) (-2822.462) (-2818.803) * (-2814.089) [-2807.564] (-2809.688) (-2820.181) -- 0:08:43
Average standard deviation of split frequencies: 0.032736
35500 -- (-2816.053) (-2821.171) [-2814.307] (-2815.328) * (-2809.750) [-2808.744] (-2818.537) (-2812.713) -- 0:08:36
36000 -- (-2822.943) [-2817.333] (-2826.078) (-2818.951) * [-2813.706] (-2818.380) (-2827.775) (-2817.826) -- 0:08:55
36500 -- (-2813.530) [-2817.508] (-2817.793) (-2828.970) * (-2826.805) (-2816.918) (-2821.661) [-2814.973] -- 0:08:47
37000 -- (-2826.650) (-2808.529) (-2821.732) [-2816.440] * [-2813.213] (-2825.291) (-2817.650) (-2815.096) -- 0:08:40
37500 -- (-2817.344) (-2818.152) (-2827.377) [-2815.453] * (-2809.907) (-2812.055) (-2816.144) [-2819.376] -- 0:08:33
38000 -- (-2818.310) (-2818.414) [-2822.774] (-2824.851) * [-2817.879] (-2817.840) (-2818.194) (-2822.036) -- 0:08:51
38500 -- (-2813.078) (-2821.812) (-2824.321) [-2810.226] * (-2822.630) (-2821.244) [-2821.043] (-2828.766) -- 0:08:44
39000 -- [-2819.462] (-2819.023) (-2820.602) (-2820.891) * (-2821.500) (-2824.462) (-2831.558) [-2817.350] -- 0:08:37
39500 -- (-2821.969) [-2813.576] (-2822.319) (-2815.581) * (-2818.053) (-2816.148) [-2818.473] (-2819.025) -- 0:08:30
40000 -- (-2820.027) [-2815.735] (-2814.813) (-2814.458) * (-2815.562) [-2819.748] (-2822.177) (-2819.266) -- 0:08:48
Average standard deviation of split frequencies: 0.019320
40500 -- (-2815.690) [-2812.873] (-2822.950) (-2814.215) * (-2817.846) [-2822.939] (-2815.352) (-2821.062) -- 0:08:41
41000 -- (-2824.210) (-2814.046) [-2823.077] (-2815.672) * [-2817.323] (-2814.489) (-2814.728) (-2817.399) -- 0:08:34
41500 -- [-2815.846] (-2820.995) (-2817.599) (-2817.124) * (-2818.776) [-2812.701] (-2819.224) (-2815.885) -- 0:08:51
42000 -- (-2814.659) [-2809.256] (-2813.145) (-2823.017) * (-2815.930) (-2821.217) (-2834.365) [-2812.734] -- 0:08:44
42500 -- (-2808.029) (-2819.428) (-2813.270) [-2808.690] * (-2827.134) [-2816.147] (-2813.182) (-2814.384) -- 0:08:38
43000 -- (-2810.085) (-2827.092) (-2816.595) [-2812.468] * [-2808.689] (-2808.206) (-2828.449) (-2820.664) -- 0:08:31
43500 -- (-2811.790) [-2815.046] (-2811.474) (-2812.289) * (-2814.917) (-2812.621) [-2812.427] (-2814.026) -- 0:08:47
44000 -- (-2810.891) [-2818.250] (-2825.659) (-2815.918) * [-2815.495] (-2813.784) (-2815.312) (-2810.913) -- 0:08:41
44500 -- (-2819.295) (-2813.458) (-2818.612) [-2813.677] * [-2815.983] (-2817.449) (-2815.929) (-2818.449) -- 0:08:35
45000 -- (-2816.284) (-2809.355) (-2822.393) [-2811.918] * (-2812.182) [-2806.527] (-2814.689) (-2820.096) -- 0:08:50
Average standard deviation of split frequencies: 0.015941
45500 -- (-2834.363) (-2810.329) [-2812.892] (-2821.806) * (-2825.655) [-2813.707] (-2819.945) (-2825.940) -- 0:08:44
46000 -- (-2813.259) [-2815.160] (-2822.376) (-2815.859) * (-2830.580) [-2805.280] (-2826.468) (-2817.327) -- 0:08:38
46500 -- (-2819.572) [-2814.308] (-2817.140) (-2817.636) * (-2825.986) [-2817.298] (-2816.524) (-2814.705) -- 0:08:32
47000 -- (-2818.878) (-2817.559) [-2814.932] (-2821.610) * (-2837.086) (-2823.888) (-2811.063) [-2815.575] -- 0:08:47
47500 -- (-2821.966) (-2828.566) (-2818.517) [-2812.464] * [-2819.350] (-2816.464) (-2813.297) (-2814.698) -- 0:08:41
48000 -- (-2818.056) [-2816.786] (-2823.164) (-2826.610) * (-2829.573) (-2831.860) [-2809.136] (-2824.254) -- 0:08:35
48500 -- (-2818.113) (-2819.768) (-2824.644) [-2810.575] * [-2818.521] (-2813.775) (-2811.683) (-2816.319) -- 0:08:30
49000 -- (-2815.299) [-2812.633] (-2814.626) (-2812.393) * (-2812.177) (-2816.036) [-2817.082] (-2818.994) -- 0:08:44
49500 -- (-2820.795) (-2812.984) (-2812.431) [-2812.411] * (-2816.959) [-2823.738] (-2820.854) (-2815.463) -- 0:08:38
50000 -- (-2820.533) (-2807.843) [-2810.398] (-2816.420) * (-2816.288) (-2815.236) [-2814.771] (-2815.913) -- 0:08:33
Average standard deviation of split frequencies: 0.014473
50500 -- (-2818.819) (-2815.518) [-2810.187] (-2811.369) * [-2812.072] (-2821.699) (-2814.239) (-2820.850) -- 0:08:27
51000 -- (-2823.043) [-2816.335] (-2820.310) (-2817.315) * (-2813.618) [-2814.222] (-2807.524) (-2816.193) -- 0:08:41
51500 -- (-2815.477) (-2817.887) [-2812.204] (-2808.684) * (-2820.633) [-2815.682] (-2812.233) (-2823.909) -- 0:08:35
52000 -- (-2812.963) (-2814.095) [-2811.286] (-2814.583) * (-2817.764) [-2814.298] (-2819.124) (-2828.154) -- 0:08:30
52500 -- [-2811.842] (-2817.612) (-2818.956) (-2819.092) * (-2818.077) (-2813.528) (-2822.446) [-2811.224] -- 0:08:43
53000 -- (-2810.984) [-2812.196] (-2818.215) (-2819.364) * (-2834.394) (-2821.892) [-2814.971] (-2817.018) -- 0:08:38
53500 -- [-2811.024] (-2810.614) (-2821.114) (-2817.727) * [-2819.896] (-2821.607) (-2822.739) (-2819.689) -- 0:08:33
54000 -- (-2817.400) (-2812.187) [-2815.596] (-2821.908) * (-2815.007) [-2808.496] (-2819.002) (-2809.727) -- 0:08:28
54500 -- (-2814.930) (-2818.734) [-2819.574] (-2832.997) * (-2818.026) (-2813.355) (-2814.244) [-2817.609] -- 0:08:40
55000 -- (-2812.928) [-2825.884] (-2811.361) (-2813.829) * (-2814.656) [-2816.315] (-2813.491) (-2808.270) -- 0:08:35
Average standard deviation of split frequencies: 0.013095
55500 -- (-2815.445) [-2825.804] (-2810.108) (-2817.826) * (-2826.820) (-2818.093) [-2813.419] (-2810.929) -- 0:08:30
56000 -- (-2813.593) [-2822.761] (-2807.065) (-2820.505) * [-2821.610] (-2815.430) (-2818.010) (-2814.016) -- 0:08:42
56500 -- (-2814.080) [-2813.328] (-2821.933) (-2816.339) * (-2822.571) [-2813.062] (-2822.227) (-2822.251) -- 0:08:37
57000 -- [-2814.590] (-2820.140) (-2819.663) (-2824.421) * (-2814.610) (-2812.083) (-2815.490) [-2813.853] -- 0:08:32
57500 -- [-2815.846] (-2821.005) (-2815.000) (-2826.386) * (-2821.235) (-2821.474) [-2812.843] (-2814.589) -- 0:08:28
58000 -- [-2823.865] (-2821.165) (-2810.673) (-2826.407) * (-2822.385) (-2822.024) [-2810.752] (-2816.158) -- 0:08:39
58500 -- (-2813.864) [-2816.414] (-2814.372) (-2819.059) * [-2811.218] (-2817.584) (-2818.677) (-2823.379) -- 0:08:35
59000 -- (-2819.551) [-2827.586] (-2815.865) (-2814.969) * (-2814.540) (-2818.584) [-2812.535] (-2825.877) -- 0:08:30
59500 -- (-2821.757) (-2817.845) [-2810.002] (-2815.109) * (-2809.600) (-2817.596) (-2816.499) [-2814.022] -- 0:08:41
60000 -- (-2819.657) (-2820.869) (-2811.363) [-2808.847] * [-2818.371] (-2810.197) (-2817.508) (-2819.861) -- 0:08:37
Average standard deviation of split frequencies: 0.010361
60500 -- (-2819.331) [-2810.830] (-2806.647) (-2827.900) * (-2833.463) (-2820.496) [-2813.283] (-2813.640) -- 0:08:32
61000 -- (-2820.821) (-2808.791) [-2809.886] (-2811.490) * (-2815.498) (-2814.691) [-2815.250] (-2817.339) -- 0:08:27
61500 -- (-2819.602) (-2821.479) [-2815.996] (-2820.689) * (-2821.119) (-2812.821) (-2818.954) [-2811.708] -- 0:08:38
62000 -- [-2817.042] (-2817.339) (-2817.219) (-2830.679) * (-2818.633) (-2821.452) (-2823.636) [-2812.768] -- 0:08:34
62500 -- [-2817.414] (-2818.683) (-2820.277) (-2834.614) * (-2819.936) (-2817.921) [-2817.305] (-2818.351) -- 0:08:30
63000 -- [-2816.314] (-2814.495) (-2821.872) (-2822.084) * [-2813.936] (-2819.669) (-2824.348) (-2815.225) -- 0:08:25
63500 -- (-2817.182) [-2818.207] (-2817.460) (-2809.064) * (-2816.612) (-2820.527) (-2814.233) [-2810.852] -- 0:08:36
64000 -- (-2819.838) [-2820.082] (-2821.792) (-2817.156) * [-2812.157] (-2826.577) (-2821.488) (-2820.991) -- 0:08:31
64500 -- [-2811.172] (-2830.161) (-2819.036) (-2813.365) * (-2814.713) (-2817.419) [-2811.550] (-2821.217) -- 0:08:27
65000 -- (-2826.661) (-2819.978) (-2822.160) [-2812.524] * [-2818.586] (-2818.270) (-2826.274) (-2813.657) -- 0:08:23
Average standard deviation of split frequencies: 0.010317
65500 -- [-2814.653] (-2834.168) (-2811.891) (-2818.187) * (-2823.533) [-2810.803] (-2829.064) (-2818.232) -- 0:08:33
66000 -- (-2817.033) (-2811.863) (-2821.881) [-2808.415] * (-2822.217) (-2818.663) [-2827.693] (-2823.498) -- 0:08:29
66500 -- [-2820.584] (-2815.145) (-2812.662) (-2817.159) * (-2821.334) (-2815.600) (-2813.032) [-2814.975] -- 0:08:25
67000 -- (-2821.263) (-2826.518) [-2810.538] (-2823.174) * (-2815.277) (-2811.301) [-2814.281] (-2822.802) -- 0:08:35
67500 -- (-2819.880) (-2815.232) (-2813.854) [-2811.989] * [-2816.572] (-2824.109) (-2822.906) (-2818.225) -- 0:08:31
68000 -- [-2817.393] (-2830.430) (-2819.157) (-2819.341) * (-2815.365) [-2818.951] (-2812.883) (-2819.806) -- 0:08:27
68500 -- (-2818.270) (-2813.099) [-2815.115] (-2818.300) * (-2822.919) [-2820.671] (-2807.492) (-2825.968) -- 0:08:23
69000 -- (-2814.304) (-2818.663) (-2829.832) [-2816.499] * (-2819.775) (-2817.245) (-2819.011) [-2811.536] -- 0:08:32
69500 -- [-2815.808] (-2816.977) (-2818.491) (-2816.252) * (-2814.728) [-2820.070] (-2810.652) (-2825.646) -- 0:08:28
70000 -- (-2812.121) (-2828.595) (-2826.001) [-2810.096] * (-2814.720) (-2823.459) (-2817.960) [-2810.264] -- 0:08:24
Average standard deviation of split frequencies: 0.005188
70500 -- [-2809.003] (-2829.110) (-2820.215) (-2815.009) * (-2825.753) (-2823.712) [-2818.584] (-2822.830) -- 0:08:21
71000 -- (-2819.291) (-2812.173) [-2814.004] (-2826.982) * [-2812.054] (-2821.268) (-2818.419) (-2818.715) -- 0:08:30
71500 -- (-2818.210) (-2812.460) [-2819.122] (-2824.657) * (-2819.733) [-2819.306] (-2823.437) (-2814.475) -- 0:08:26
72000 -- [-2812.736] (-2821.640) (-2820.293) (-2822.416) * [-2814.381] (-2819.032) (-2818.201) (-2818.396) -- 0:08:22
72500 -- [-2808.027] (-2815.118) (-2816.416) (-2813.829) * (-2817.508) (-2823.303) [-2823.094] (-2814.285) -- 0:08:18
73000 -- (-2815.599) (-2817.496) [-2813.145] (-2815.622) * (-2820.123) (-2816.801) [-2811.021] (-2818.490) -- 0:08:27
73500 -- (-2812.058) (-2823.553) [-2813.359] (-2812.042) * (-2826.129) [-2808.042] (-2814.275) (-2809.875) -- 0:08:24
74000 -- (-2809.527) (-2821.174) [-2819.413] (-2815.039) * (-2823.438) (-2819.982) (-2815.518) [-2814.757] -- 0:08:20
74500 -- (-2815.938) (-2811.068) (-2827.419) [-2809.317] * (-2814.730) (-2814.490) (-2812.830) [-2815.893] -- 0:08:16
75000 -- [-2818.088] (-2817.265) (-2816.149) (-2820.592) * (-2816.712) (-2820.447) (-2815.247) [-2818.707] -- 0:08:25
Average standard deviation of split frequencies: 0.007581
75500 -- (-2823.164) [-2814.935] (-2818.101) (-2814.431) * (-2813.932) (-2814.529) [-2813.741] (-2816.315) -- 0:08:22
76000 -- (-2811.988) (-2814.005) (-2823.348) [-2810.111] * [-2812.860] (-2817.097) (-2827.341) (-2810.253) -- 0:08:18
76500 -- (-2817.420) (-2821.600) (-2819.718) [-2815.731] * (-2813.863) [-2812.589] (-2825.229) (-2815.053) -- 0:08:14
77000 -- (-2809.541) (-2812.648) [-2821.316] (-2810.191) * (-2815.165) [-2814.370] (-2819.976) (-2818.570) -- 0:08:23
77500 -- [-2814.679] (-2820.211) (-2815.081) (-2813.115) * (-2817.832) [-2813.211] (-2821.219) (-2819.498) -- 0:08:19
78000 -- (-2817.005) (-2829.222) (-2816.170) [-2818.104] * (-2814.932) (-2821.203) [-2810.537] (-2822.080) -- 0:08:16
78500 -- (-2819.737) [-2829.433] (-2825.436) (-2816.267) * (-2816.809) [-2824.285] (-2814.251) (-2832.756) -- 0:08:13
79000 -- (-2817.593) [-2814.337] (-2820.353) (-2820.380) * (-2811.269) (-2825.412) (-2814.805) [-2819.398] -- 0:08:21
79500 -- (-2818.727) [-2816.666] (-2812.962) (-2827.994) * (-2810.395) [-2809.096] (-2820.328) (-2820.317) -- 0:08:17
80000 -- (-2815.024) [-2811.366] (-2826.996) (-2814.969) * [-2817.902] (-2818.772) (-2811.507) (-2811.208) -- 0:08:14
Average standard deviation of split frequencies: 0.004545
80500 -- [-2808.527] (-2816.227) (-2819.395) (-2814.118) * [-2810.404] (-2812.810) (-2813.041) (-2813.749) -- 0:08:11
81000 -- [-2811.513] (-2812.211) (-2818.166) (-2821.113) * (-2813.500) [-2815.437] (-2813.776) (-2841.193) -- 0:08:19
81500 -- [-2813.949] (-2816.867) (-2825.773) (-2812.034) * (-2818.458) (-2818.933) [-2817.824] (-2815.145) -- 0:08:15
82000 -- [-2808.158] (-2814.476) (-2832.463) (-2813.893) * (-2815.845) (-2816.296) [-2814.647] (-2817.286) -- 0:08:12
82500 -- [-2813.838] (-2812.919) (-2819.334) (-2819.612) * (-2823.492) [-2823.215] (-2816.069) (-2818.753) -- 0:08:09
83000 -- (-2815.442) (-2815.648) (-2820.022) [-2814.239] * [-2814.022] (-2813.541) (-2828.607) (-2817.531) -- 0:08:17
83500 -- (-2816.295) (-2816.337) (-2821.903) [-2812.656] * (-2817.263) (-2816.431) [-2816.713] (-2815.611) -- 0:08:13
84000 -- (-2821.697) (-2813.251) [-2816.956] (-2813.902) * (-2813.955) (-2824.311) (-2818.237) [-2822.218] -- 0:08:10
84500 -- (-2810.067) [-2809.053] (-2808.569) (-2823.159) * [-2816.569] (-2816.251) (-2817.091) (-2821.395) -- 0:08:07
85000 -- (-2816.077) (-2824.249) (-2813.680) [-2819.122] * (-2810.509) [-2813.784] (-2817.985) (-2816.934) -- 0:08:15
Average standard deviation of split frequencies: 0.005481
85500 -- [-2820.097] (-2833.239) (-2817.053) (-2812.621) * (-2823.213) (-2819.686) (-2826.104) [-2817.259] -- 0:08:12
86000 -- (-2814.289) (-2817.269) [-2812.610] (-2818.033) * (-2824.561) (-2810.576) [-2812.260] (-2826.696) -- 0:08:08
86500 -- (-2813.150) (-2811.689) (-2819.649) [-2818.238] * [-2812.484] (-2810.048) (-2815.735) (-2826.007) -- 0:08:16
87000 -- (-2814.598) (-2823.048) (-2813.116) [-2814.558] * (-2811.303) (-2816.493) (-2821.977) [-2815.068] -- 0:08:13
87500 -- [-2811.755] (-2821.354) (-2812.896) (-2815.722) * (-2813.237) [-2807.032] (-2812.873) (-2816.086) -- 0:08:10
88000 -- (-2819.900) [-2821.754] (-2811.598) (-2810.329) * [-2809.935] (-2821.278) (-2823.113) (-2817.504) -- 0:08:07
88500 -- (-2833.215) (-2814.675) (-2812.210) [-2810.377] * (-2813.230) [-2814.201] (-2833.895) (-2826.402) -- 0:08:14
89000 -- (-2825.613) [-2819.266] (-2817.097) (-2814.680) * (-2816.799) (-2815.179) [-2820.650] (-2817.081) -- 0:08:11
89500 -- (-2822.265) [-2816.772] (-2819.626) (-2818.399) * (-2811.384) (-2820.980) [-2814.117] (-2816.535) -- 0:08:08
90000 -- (-2823.065) [-2816.589] (-2835.282) (-2812.140) * (-2814.862) (-2825.346) [-2813.512] (-2821.460) -- 0:08:05
Average standard deviation of split frequencies: 0.008666
90500 -- [-2814.586] (-2816.338) (-2818.908) (-2818.070) * [-2812.548] (-2823.593) (-2808.520) (-2825.403) -- 0:08:12
91000 -- [-2813.311] (-2819.047) (-2824.117) (-2823.907) * (-2817.461) (-2814.704) (-2810.378) [-2811.004] -- 0:08:09
91500 -- (-2821.672) (-2817.056) [-2810.916] (-2823.022) * [-2812.737] (-2814.760) (-2818.774) (-2819.974) -- 0:08:06
92000 -- (-2812.022) [-2815.300] (-2812.530) (-2822.634) * (-2819.421) [-2810.503] (-2817.270) (-2821.463) -- 0:08:03
92500 -- (-2813.110) [-2814.993] (-2809.704) (-2821.915) * (-2819.305) (-2811.682) (-2812.502) [-2814.386] -- 0:08:10
93000 -- (-2815.285) [-2809.116] (-2811.452) (-2827.915) * (-2829.142) (-2815.285) [-2817.536] (-2819.365) -- 0:08:07
93500 -- (-2814.457) [-2821.361] (-2819.092) (-2827.951) * (-2823.201) [-2811.026] (-2816.547) (-2817.201) -- 0:08:04
94000 -- (-2814.060) (-2820.214) [-2815.852] (-2821.563) * [-2817.045] (-2824.814) (-2821.605) (-2815.141) -- 0:08:01
94500 -- (-2818.134) [-2818.750] (-2817.533) (-2825.378) * [-2811.279] (-2813.056) (-2818.908) (-2825.689) -- 0:08:08
95000 -- (-2819.858) (-2820.476) (-2812.347) [-2814.063] * (-2810.500) (-2812.050) (-2815.992) [-2824.359] -- 0:08:05
Average standard deviation of split frequencies: 0.012549
95500 -- (-2815.348) (-2812.019) (-2814.917) [-2811.537] * (-2812.157) (-2817.718) [-2814.128] (-2827.436) -- 0:08:03
96000 -- (-2819.221) [-2812.567] (-2817.623) (-2821.767) * [-2811.279] (-2816.147) (-2819.480) (-2819.086) -- 0:08:00
96500 -- [-2816.866] (-2821.174) (-2826.514) (-2816.203) * (-2821.170) (-2810.660) [-2819.692] (-2820.698) -- 0:08:06
97000 -- [-2808.775] (-2819.750) (-2818.637) (-2824.039) * (-2814.732) (-2822.609) (-2814.619) [-2819.089] -- 0:08:04
97500 -- (-2812.878) (-2817.465) (-2822.303) [-2815.269] * (-2813.913) [-2826.540] (-2815.568) (-2818.274) -- 0:08:01
98000 -- (-2831.953) (-2813.293) (-2825.974) [-2815.312] * (-2821.489) [-2818.891] (-2819.249) (-2816.607) -- 0:07:58
98500 -- (-2828.140) (-2820.781) (-2819.592) [-2813.560] * (-2820.052) (-2816.475) (-2822.421) [-2821.728] -- 0:08:05
99000 -- (-2818.203) [-2807.244] (-2818.788) (-2823.688) * (-2829.981) (-2810.400) (-2815.700) [-2819.829] -- 0:08:02
99500 -- (-2820.995) [-2815.268] (-2828.042) (-2815.085) * (-2817.132) (-2812.682) [-2818.880] (-2813.350) -- 0:07:59
100000 -- (-2815.866) (-2816.291) (-2817.871) [-2816.451] * (-2812.867) (-2814.161) (-2823.827) [-2813.709] -- 0:07:57
Average standard deviation of split frequencies: 0.009366
100500 -- [-2818.501] (-2810.717) (-2818.190) (-2828.901) * (-2809.964) [-2811.921] (-2817.630) (-2819.414) -- 0:08:03
101000 -- (-2816.322) (-2813.223) (-2816.618) [-2811.433] * (-2811.522) (-2830.029) (-2821.129) [-2825.251] -- 0:08:00
101500 -- (-2817.598) (-2808.743) (-2814.905) [-2826.381] * (-2820.525) [-2816.000] (-2821.947) (-2817.621) -- 0:07:58
102000 -- (-2826.800) [-2811.826] (-2815.667) (-2805.465) * (-2808.954) [-2823.723] (-2814.774) (-2825.923) -- 0:07:55
102500 -- (-2818.365) (-2810.344) (-2819.154) [-2817.789] * [-2809.901] (-2821.401) (-2810.605) (-2816.160) -- 0:08:01
103000 -- [-2810.116] (-2815.941) (-2815.449) (-2821.408) * (-2816.004) [-2811.498] (-2817.451) (-2816.198) -- 0:07:58
103500 -- [-2807.172] (-2819.555) (-2818.554) (-2814.498) * (-2824.129) (-2814.064) (-2811.450) [-2815.872] -- 0:07:56
104000 -- (-2819.865) (-2814.641) (-2821.046) [-2812.987] * (-2813.305) (-2812.412) [-2816.349] (-2809.697) -- 0:08:02
104500 -- [-2816.913] (-2830.462) (-2818.949) (-2820.081) * (-2809.003) (-2814.374) (-2819.393) [-2818.347] -- 0:07:59
105000 -- (-2816.263) (-2815.787) [-2822.351] (-2819.292) * (-2818.929) [-2810.203] (-2818.295) (-2816.214) -- 0:07:57
Average standard deviation of split frequencies: 0.010377
105500 -- [-2810.480] (-2810.535) (-2815.921) (-2816.855) * (-2814.115) (-2818.879) (-2819.416) [-2818.605] -- 0:07:54
106000 -- [-2809.076] (-2816.610) (-2818.027) (-2816.419) * (-2819.511) [-2814.317] (-2822.520) (-2813.657) -- 0:08:00
106500 -- [-2814.494] (-2812.200) (-2817.549) (-2828.351) * (-2812.986) [-2816.701] (-2821.185) (-2822.474) -- 0:07:58
107000 -- (-2816.050) (-2818.696) [-2816.848] (-2821.168) * (-2817.591) [-2813.763] (-2821.225) (-2812.897) -- 0:07:55
107500 -- (-2815.742) (-2821.097) (-2826.838) [-2811.252] * (-2815.810) [-2811.961] (-2823.443) (-2811.275) -- 0:07:53
108000 -- (-2824.493) [-2809.650] (-2832.929) (-2813.069) * [-2814.155] (-2815.173) (-2823.169) (-2817.278) -- 0:07:59
108500 -- [-2817.397] (-2812.594) (-2827.927) (-2812.775) * (-2816.568) (-2813.463) [-2809.694] (-2823.394) -- 0:07:56
109000 -- (-2821.575) (-2818.901) [-2816.323] (-2825.814) * (-2819.696) [-2815.113] (-2807.870) (-2819.393) -- 0:07:54
109500 -- (-2813.886) (-2809.330) [-2831.443] (-2815.697) * (-2815.804) (-2806.200) [-2818.258] (-2821.691) -- 0:07:51
110000 -- (-2809.463) (-2808.454) (-2817.716) [-2805.917] * (-2819.946) (-2812.808) (-2820.808) [-2819.910] -- 0:07:57
Average standard deviation of split frequencies: 0.008519
110500 -- [-2811.369] (-2807.620) (-2815.438) (-2817.326) * [-2814.677] (-2818.993) (-2824.146) (-2822.381) -- 0:07:54
111000 -- (-2809.375) (-2824.616) (-2809.474) [-2813.902] * (-2821.870) [-2817.966] (-2821.929) (-2817.412) -- 0:07:52
111500 -- (-2813.529) [-2822.956] (-2819.059) (-2826.847) * (-2824.746) (-2826.749) [-2813.907] (-2820.770) -- 0:07:50
112000 -- [-2813.232] (-2831.997) (-2818.087) (-2816.492) * (-2818.348) (-2822.197) [-2819.148] (-2814.983) -- 0:07:55
112500 -- (-2814.150) [-2814.396] (-2814.465) (-2810.000) * [-2810.999] (-2815.921) (-2818.499) (-2812.599) -- 0:07:53
113000 -- (-2811.640) (-2820.222) [-2810.531] (-2812.757) * (-2816.729) [-2812.100] (-2841.245) (-2814.349) -- 0:07:50
113500 -- (-2810.174) (-2817.005) (-2820.166) [-2812.873] * (-2826.185) [-2817.840] (-2823.949) (-2817.531) -- 0:07:56
114000 -- (-2811.081) [-2814.215] (-2821.155) (-2815.270) * (-2821.828) (-2823.019) [-2813.189] (-2810.236) -- 0:07:54
114500 -- (-2822.756) (-2823.492) (-2811.698) [-2808.890] * (-2827.365) (-2816.905) (-2830.794) [-2817.097] -- 0:07:51
115000 -- (-2824.305) [-2815.774] (-2820.860) (-2812.815) * (-2825.878) (-2810.448) [-2818.945] (-2815.739) -- 0:07:49
Average standard deviation of split frequencies: 0.007676
115500 -- (-2817.094) [-2817.843] (-2830.026) (-2815.226) * (-2814.865) [-2810.358] (-2811.410) (-2812.902) -- 0:07:54
116000 -- [-2813.215] (-2817.005) (-2819.733) (-2819.485) * (-2819.771) (-2812.781) [-2810.019] (-2813.015) -- 0:07:52
116500 -- [-2816.811] (-2826.316) (-2816.176) (-2814.783) * (-2828.640) [-2815.522] (-2812.812) (-2815.499) -- 0:07:50
117000 -- (-2815.671) [-2812.153] (-2811.463) (-2811.020) * (-2814.585) [-2806.442] (-2818.070) (-2823.756) -- 0:07:47
117500 -- (-2809.961) [-2820.969] (-2815.886) (-2814.090) * [-2816.316] (-2822.254) (-2809.479) (-2820.109) -- 0:07:53
118000 -- (-2807.782) (-2827.170) (-2816.126) [-2811.380] * (-2812.813) (-2814.960) [-2811.636] (-2826.947) -- 0:07:50
118500 -- [-2813.552] (-2826.433) (-2809.831) (-2820.640) * (-2811.364) (-2818.778) [-2811.149] (-2815.564) -- 0:07:48
119000 -- (-2826.141) (-2830.812) (-2813.490) [-2816.047] * (-2818.910) (-2822.380) (-2817.583) [-2808.451] -- 0:07:46
119500 -- [-2812.486] (-2822.280) (-2819.002) (-2819.766) * (-2812.309) [-2809.866] (-2816.153) (-2816.815) -- 0:07:51
120000 -- (-2808.243) (-2825.524) [-2812.159] (-2813.762) * (-2813.425) (-2827.667) [-2815.798] (-2823.325) -- 0:07:49
Average standard deviation of split frequencies: 0.006945
120500 -- (-2816.238) (-2821.955) (-2815.282) [-2812.130] * (-2814.624) [-2819.708] (-2816.426) (-2812.631) -- 0:07:47
121000 -- (-2818.922) (-2809.364) (-2818.745) [-2817.292] * [-2817.401] (-2814.747) (-2811.900) (-2815.170) -- 0:07:44
121500 -- (-2819.038) (-2812.590) (-2819.806) [-2817.230] * (-2815.157) (-2815.243) (-2838.090) [-2818.047] -- 0:07:49
122000 -- (-2811.713) [-2809.762] (-2812.788) (-2824.833) * (-2817.719) (-2815.751) [-2808.168] (-2813.738) -- 0:07:47
122500 -- [-2811.728] (-2811.322) (-2823.174) (-2834.640) * (-2817.928) (-2811.660) [-2820.242] (-2811.603) -- 0:07:45
123000 -- [-2813.451] (-2817.341) (-2818.253) (-2821.227) * (-2828.620) [-2812.601] (-2825.932) (-2814.747) -- 0:07:50
123500 -- [-2814.234] (-2812.832) (-2813.999) (-2826.276) * (-2823.630) (-2822.188) [-2810.619] (-2817.821) -- 0:07:48
124000 -- (-2822.025) (-2810.678) [-2810.136] (-2816.105) * (-2821.098) (-2822.598) [-2816.117] (-2826.500) -- 0:07:46
124500 -- (-2819.360) (-2814.432) (-2819.254) [-2807.987] * (-2826.657) (-2811.076) [-2808.550] (-2825.608) -- 0:07:44
125000 -- (-2819.596) [-2813.427] (-2813.032) (-2815.247) * (-2818.994) [-2816.435] (-2818.983) (-2820.160) -- 0:07:49
Average standard deviation of split frequencies: 0.004988
125500 -- (-2822.168) (-2821.214) [-2816.906] (-2817.571) * (-2812.942) (-2814.303) (-2813.757) [-2813.343] -- 0:07:46
126000 -- (-2828.371) [-2820.855] (-2818.323) (-2819.056) * (-2812.419) [-2821.465] (-2811.779) (-2814.337) -- 0:07:44
126500 -- (-2816.865) (-2822.498) [-2820.023] (-2817.392) * (-2814.595) [-2815.546] (-2817.451) (-2814.349) -- 0:07:42
127000 -- (-2816.735) (-2819.515) [-2812.850] (-2823.418) * [-2815.977] (-2820.699) (-2820.850) (-2819.844) -- 0:07:47
127500 -- (-2814.216) (-2817.735) [-2810.265] (-2822.750) * [-2813.965] (-2820.278) (-2813.560) (-2811.191) -- 0:07:45
128000 -- (-2819.854) (-2817.485) (-2819.928) [-2813.051] * (-2816.616) (-2817.416) (-2813.112) [-2811.848] -- 0:07:43
128500 -- (-2821.537) [-2809.933] (-2817.615) (-2818.327) * (-2814.506) [-2815.900] (-2812.558) (-2821.573) -- 0:07:47
129000 -- (-2815.407) (-2820.105) [-2816.176] (-2818.108) * [-2816.069] (-2807.676) (-2818.058) (-2824.511) -- 0:07:45
129500 -- (-2816.614) (-2822.693) [-2817.172] (-2814.533) * (-2818.828) (-2828.409) [-2815.822] (-2814.188) -- 0:07:43
130000 -- (-2825.902) (-2818.083) [-2816.465] (-2812.969) * [-2814.108] (-2831.989) (-2813.616) (-2819.470) -- 0:07:41
Average standard deviation of split frequencies: 0.004810
130500 -- (-2809.399) [-2816.006] (-2817.348) (-2812.566) * (-2819.525) (-2810.117) [-2821.306] (-2816.612) -- 0:07:46
131000 -- [-2809.474] (-2809.055) (-2820.268) (-2813.925) * (-2817.550) (-2810.029) (-2823.606) [-2816.285] -- 0:07:44
131500 -- (-2826.499) (-2816.149) (-2814.659) [-2812.154] * (-2810.530) (-2817.468) (-2820.552) [-2814.538] -- 0:07:42
132000 -- [-2816.905] (-2820.783) (-2813.632) (-2812.077) * (-2821.609) (-2813.881) [-2810.208] (-2818.950) -- 0:07:40
132500 -- (-2820.427) (-2818.076) (-2815.215) [-2811.534] * (-2817.795) [-2818.903] (-2811.027) (-2811.222) -- 0:07:44
133000 -- (-2827.283) [-2819.980] (-2814.939) (-2815.834) * (-2816.200) (-2820.273) (-2811.301) [-2812.906] -- 0:07:42
133500 -- (-2819.921) (-2814.890) (-2811.834) [-2813.394] * [-2810.407] (-2823.628) (-2812.780) (-2808.434) -- 0:07:40
134000 -- (-2817.840) (-2815.525) (-2820.697) [-2815.417] * [-2811.075] (-2820.415) (-2811.192) (-2808.519) -- 0:07:38
134500 -- (-2819.868) (-2814.787) [-2818.354] (-2811.680) * (-2817.728) [-2820.575] (-2816.319) (-2810.449) -- 0:07:43
135000 -- (-2826.527) (-2820.789) [-2812.617] (-2815.380) * (-2817.992) (-2820.900) (-2817.944) [-2810.598] -- 0:07:41
Average standard deviation of split frequencies: 0.005777
135500 -- (-2818.646) (-2817.260) (-2819.913) [-2812.275] * [-2818.973] (-2817.409) (-2812.281) (-2825.096) -- 0:07:39
136000 -- (-2823.317) (-2818.715) [-2810.470] (-2813.229) * (-2817.673) (-2816.547) (-2813.066) [-2819.365] -- 0:07:37
136500 -- (-2817.920) (-2816.140) [-2818.026] (-2812.953) * (-2824.745) [-2812.592] (-2819.323) (-2813.142) -- 0:07:41
137000 -- [-2811.041] (-2812.833) (-2826.531) (-2823.937) * [-2823.041] (-2816.939) (-2817.823) (-2820.038) -- 0:07:39
137500 -- (-2812.655) (-2815.431) (-2815.257) [-2812.929] * (-2814.250) [-2812.127] (-2818.140) (-2815.778) -- 0:07:37
138000 -- [-2820.027] (-2813.516) (-2821.340) (-2818.394) * [-2813.010] (-2825.426) (-2810.259) (-2816.554) -- 0:07:42
138500 -- (-2813.776) [-2807.859] (-2831.720) (-2818.052) * (-2826.123) (-2812.057) (-2812.987) [-2808.981] -- 0:07:40
139000 -- [-2814.373] (-2816.741) (-2820.836) (-2819.405) * (-2818.048) (-2815.820) [-2834.882] (-2817.232) -- 0:07:38
139500 -- (-2811.678) [-2815.122] (-2820.195) (-2820.601) * (-2821.015) [-2813.656] (-2820.809) (-2808.651) -- 0:07:36
140000 -- (-2822.543) (-2822.748) [-2809.129] (-2817.133) * (-2822.137) (-2824.237) [-2817.806] (-2818.690) -- 0:07:40
Average standard deviation of split frequencies: 0.004468
140500 -- (-2822.935) (-2811.352) (-2823.343) [-2822.503] * (-2813.336) (-2832.116) [-2815.062] (-2822.312) -- 0:07:38
141000 -- [-2817.636] (-2812.629) (-2812.627) (-2817.133) * (-2819.441) [-2813.981] (-2821.651) (-2820.575) -- 0:07:36
141500 -- (-2819.443) (-2815.734) [-2812.218] (-2823.959) * (-2814.780) (-2808.352) [-2811.643] (-2818.265) -- 0:07:35
142000 -- [-2815.869] (-2820.610) (-2816.362) (-2818.157) * (-2827.794) (-2821.252) (-2817.185) [-2811.663] -- 0:07:39
142500 -- (-2831.633) (-2819.414) [-2814.828] (-2813.497) * (-2817.450) [-2812.763] (-2823.542) (-2816.109) -- 0:07:37
143000 -- (-2821.862) (-2811.235) (-2816.131) [-2817.608] * (-2811.648) [-2813.824] (-2818.211) (-2820.829) -- 0:07:35
143500 -- (-2812.113) (-2816.037) [-2817.620] (-2820.619) * (-2824.395) (-2818.394) [-2820.741] (-2813.303) -- 0:07:33
144000 -- (-2820.629) [-2812.363] (-2823.213) (-2810.613) * (-2821.629) (-2819.419) (-2814.111) [-2811.299] -- 0:07:37
144500 -- (-2819.643) (-2818.136) (-2827.109) [-2811.216] * [-2811.932] (-2826.782) (-2827.918) (-2814.122) -- 0:07:35
145000 -- (-2817.631) (-2810.485) (-2824.990) [-2816.822] * (-2828.785) [-2816.562] (-2819.618) (-2814.591) -- 0:07:34
Average standard deviation of split frequencies: 0.005381
145500 -- [-2812.534] (-2822.329) (-2816.178) (-2817.776) * (-2823.716) (-2809.697) [-2818.436] (-2818.312) -- 0:07:32
146000 -- (-2819.203) (-2825.492) (-2817.211) [-2812.151] * [-2811.902] (-2826.537) (-2822.743) (-2817.124) -- 0:07:36
146500 -- [-2815.705] (-2825.565) (-2812.578) (-2818.428) * (-2811.632) [-2818.943] (-2812.240) (-2818.735) -- 0:07:34
147000 -- [-2813.562] (-2819.555) (-2818.908) (-2821.687) * (-2826.500) [-2811.141] (-2818.337) (-2814.235) -- 0:07:32
147500 -- [-2813.037] (-2814.000) (-2821.949) (-2815.265) * (-2830.684) [-2812.404] (-2821.843) (-2810.473) -- 0:07:30
148000 -- [-2812.649] (-2815.282) (-2813.986) (-2816.097) * (-2822.223) [-2813.309] (-2812.756) (-2817.124) -- 0:07:34
148500 -- (-2815.320) (-2818.802) [-2824.244] (-2816.752) * (-2815.851) (-2820.833) [-2814.730] (-2823.302) -- 0:07:32
149000 -- (-2811.493) (-2817.295) [-2817.771] (-2817.058) * (-2819.898) (-2814.877) (-2820.662) [-2812.003] -- 0:07:31
149500 -- (-2813.167) (-2824.328) (-2814.479) [-2819.155] * [-2813.863] (-2815.124) (-2810.729) (-2821.452) -- 0:07:29
150000 -- (-2830.019) (-2816.001) (-2820.480) [-2814.787] * (-2816.019) [-2815.031] (-2815.798) (-2814.620) -- 0:07:33
Average standard deviation of split frequencies: 0.006605
150500 -- (-2818.989) [-2819.426] (-2810.600) (-2825.620) * (-2815.717) (-2815.482) [-2817.305] (-2817.250) -- 0:07:31
151000 -- [-2817.401] (-2813.363) (-2817.996) (-2819.211) * (-2818.630) (-2818.860) [-2814.540] (-2817.263) -- 0:07:29
151500 -- [-2811.562] (-2813.949) (-2815.655) (-2822.123) * [-2815.641] (-2818.565) (-2816.536) (-2820.091) -- 0:07:28
152000 -- [-2819.653] (-2819.996) (-2825.144) (-2818.943) * [-2818.385] (-2815.467) (-2813.034) (-2816.462) -- 0:07:31
152500 -- (-2812.120) (-2822.569) [-2816.318] (-2819.237) * (-2812.616) (-2823.336) [-2813.990] (-2821.823) -- 0:07:30
153000 -- (-2817.696) [-2813.877] (-2812.375) (-2818.641) * (-2808.397) [-2810.956] (-2831.145) (-2820.266) -- 0:07:28
153500 -- (-2816.180) (-2833.701) (-2813.145) [-2811.639] * (-2820.872) [-2816.412] (-2821.944) (-2812.894) -- 0:07:26
154000 -- (-2815.499) [-2820.734] (-2815.601) (-2812.227) * (-2818.755) (-2823.238) [-2823.371] (-2815.890) -- 0:07:30
154500 -- (-2813.929) [-2808.391] (-2817.428) (-2823.427) * [-2820.554] (-2824.037) (-2827.527) (-2816.674) -- 0:07:28
155000 -- [-2811.447] (-2814.032) (-2817.195) (-2817.535) * [-2810.144] (-2816.308) (-2824.685) (-2817.294) -- 0:07:27
Average standard deviation of split frequencies: 0.007387
155500 -- (-2818.932) (-2818.923) (-2815.831) [-2813.696] * (-2816.733) (-2822.843) (-2821.869) [-2816.940] -- 0:07:30
156000 -- [-2810.196] (-2813.482) (-2815.522) (-2810.326) * (-2825.575) (-2821.320) [-2815.230] (-2813.662) -- 0:07:29
156500 -- (-2828.814) [-2817.410] (-2816.402) (-2823.098) * [-2816.915] (-2821.937) (-2819.606) (-2820.666) -- 0:07:27
157000 -- [-2817.955] (-2824.294) (-2815.628) (-2817.961) * (-2815.880) (-2814.480) (-2821.621) [-2817.448] -- 0:07:25
157500 -- (-2827.794) (-2824.967) (-2820.442) [-2805.065] * (-2816.358) [-2812.650] (-2818.085) (-2818.420) -- 0:07:29
158000 -- (-2816.118) (-2823.776) (-2815.996) [-2809.054] * (-2823.909) [-2813.664] (-2809.667) (-2811.499) -- 0:07:27
158500 -- (-2816.631) (-2814.382) [-2816.380] (-2810.719) * (-2818.605) (-2824.238) (-2813.244) [-2823.379] -- 0:07:25
159000 -- [-2820.477] (-2819.087) (-2815.278) (-2814.635) * (-2822.188) (-2825.261) [-2807.676] (-2821.515) -- 0:07:24
159500 -- (-2811.731) (-2813.614) [-2816.244] (-2809.571) * (-2816.099) (-2819.108) [-2813.752] (-2822.981) -- 0:07:27
160000 -- (-2823.310) (-2817.783) [-2814.829] (-2815.909) * [-2816.419] (-2813.478) (-2820.595) (-2824.785) -- 0:07:26
Average standard deviation of split frequencies: 0.005542
160500 -- (-2821.190) (-2816.867) [-2817.317] (-2816.663) * (-2817.661) [-2815.662] (-2822.306) (-2834.246) -- 0:07:24
161000 -- (-2821.989) (-2812.306) (-2823.610) [-2810.927] * (-2817.317) (-2813.341) [-2815.296] (-2823.516) -- 0:07:22
161500 -- (-2819.818) [-2812.426] (-2819.591) (-2817.538) * (-2810.619) [-2812.351] (-2809.274) (-2821.686) -- 0:07:26
162000 -- (-2822.459) (-2815.796) (-2810.656) [-2816.403] * (-2816.642) (-2824.370) (-2809.403) [-2814.222] -- 0:07:24
162500 -- [-2818.919] (-2825.229) (-2813.430) (-2832.310) * [-2810.487] (-2813.203) (-2810.944) (-2826.597) -- 0:07:23
163000 -- (-2819.251) [-2820.626] (-2827.518) (-2813.274) * (-2819.337) (-2822.475) [-2813.163] (-2815.463) -- 0:07:21
163500 -- (-2818.747) (-2831.026) [-2811.504] (-2816.082) * (-2825.963) [-2815.927] (-2823.117) (-2819.628) -- 0:07:25
164000 -- [-2818.187] (-2814.098) (-2814.248) (-2814.830) * (-2817.738) [-2809.786] (-2817.625) (-2817.459) -- 0:07:23
164500 -- (-2823.240) (-2813.588) [-2814.738] (-2822.427) * (-2823.362) (-2810.737) (-2809.506) [-2815.242] -- 0:07:21
165000 -- (-2825.170) (-2813.313) (-2821.369) [-2814.215] * (-2822.753) (-2827.790) [-2815.223] (-2816.754) -- 0:07:20
Average standard deviation of split frequencies: 0.004733
165500 -- (-2818.494) [-2818.729] (-2818.673) (-2818.102) * [-2817.114] (-2829.672) (-2821.143) (-2814.146) -- 0:07:23
166000 -- (-2816.297) (-2820.019) [-2818.515] (-2812.708) * [-2817.275] (-2815.859) (-2815.390) (-2818.837) -- 0:07:22
166500 -- (-2817.455) (-2820.714) [-2808.697] (-2822.610) * (-2820.916) [-2824.147] (-2828.964) (-2819.442) -- 0:07:20
167000 -- [-2817.720] (-2818.909) (-2815.001) (-2819.190) * (-2814.696) (-2823.677) [-2810.195] (-2821.280) -- 0:07:18
167500 -- (-2818.246) (-2820.491) (-2814.437) [-2819.380] * (-2818.893) (-2817.163) [-2816.593] (-2817.494) -- 0:07:22
168000 -- (-2815.654) [-2811.703] (-2822.801) (-2826.432) * (-2811.716) [-2810.216] (-2823.013) (-2819.444) -- 0:07:20
168500 -- [-2813.422] (-2812.344) (-2816.005) (-2813.925) * [-2816.973] (-2819.846) (-2817.305) (-2816.352) -- 0:07:19
169000 -- (-2823.251) [-2816.916] (-2817.259) (-2814.376) * [-2821.303] (-2824.591) (-2811.872) (-2821.732) -- 0:07:17
169500 -- (-2820.523) (-2815.804) (-2814.270) [-2806.424] * (-2818.806) [-2818.077] (-2815.641) (-2815.765) -- 0:07:20
170000 -- (-2823.639) (-2822.576) [-2814.643] (-2809.899) * (-2816.814) (-2813.543) [-2808.904] (-2823.879) -- 0:07:19
Average standard deviation of split frequencies: 0.004604
170500 -- [-2815.186] (-2817.210) (-2805.789) (-2818.930) * [-2814.457] (-2810.536) (-2821.323) (-2823.014) -- 0:07:17
171000 -- (-2820.508) (-2812.219) [-2813.487] (-2810.409) * (-2815.360) [-2817.955] (-2816.453) (-2824.904) -- 0:07:21
171500 -- [-2810.941] (-2807.872) (-2815.043) (-2815.397) * (-2820.924) (-2814.030) (-2818.189) [-2823.130] -- 0:07:19
172000 -- (-2815.606) (-2813.848) (-2819.751) [-2817.370] * (-2820.862) (-2825.335) [-2812.446] (-2824.548) -- 0:07:18
172500 -- [-2811.985] (-2814.721) (-2815.644) (-2807.570) * [-2812.817] (-2814.989) (-2813.339) (-2827.430) -- 0:07:16
173000 -- [-2814.016] (-2818.366) (-2819.064) (-2813.233) * (-2813.819) (-2818.724) [-2810.442] (-2823.543) -- 0:07:19
173500 -- (-2821.836) (-2810.858) (-2820.487) [-2816.839] * (-2821.023) (-2812.113) [-2806.131] (-2814.257) -- 0:07:18
174000 -- (-2814.968) [-2809.779] (-2820.609) (-2813.788) * (-2822.701) (-2822.827) [-2811.818] (-2821.917) -- 0:07:16
174500 -- [-2819.636] (-2814.685) (-2823.333) (-2813.315) * (-2822.362) (-2814.630) (-2813.787) [-2814.369] -- 0:07:15
175000 -- (-2824.544) (-2810.336) [-2818.929] (-2820.104) * (-2821.901) (-2813.276) [-2813.214] (-2816.933) -- 0:07:18
Average standard deviation of split frequencies: 0.006250
175500 -- (-2810.488) [-2817.163] (-2817.085) (-2815.753) * (-2814.536) (-2818.048) (-2820.112) [-2812.027] -- 0:07:16
176000 -- (-2812.687) (-2813.195) (-2820.160) [-2818.462] * (-2833.170) (-2824.352) [-2817.847] (-2814.163) -- 0:07:15
176500 -- (-2813.228) (-2818.621) (-2821.748) [-2808.542] * [-2817.971] (-2817.343) (-2816.556) (-2819.107) -- 0:07:13
177000 -- (-2814.337) [-2819.950] (-2817.346) (-2823.164) * [-2815.787] (-2812.356) (-2827.894) (-2816.858) -- 0:07:17
177500 -- (-2826.151) (-2817.138) [-2823.459] (-2816.578) * (-2833.446) [-2815.049] (-2822.173) (-2813.110) -- 0:07:15
178000 -- [-2815.142] (-2819.442) (-2827.427) (-2813.541) * (-2817.032) (-2810.679) [-2815.225] (-2808.025) -- 0:07:14
178500 -- (-2815.929) (-2815.165) (-2825.621) [-2808.778] * (-2828.039) [-2809.611] (-2814.541) (-2823.427) -- 0:07:12
179000 -- (-2815.730) (-2821.551) (-2822.409) [-2811.714] * (-2815.360) [-2814.613] (-2817.336) (-2823.731) -- 0:07:15
179500 -- (-2822.344) [-2813.926] (-2819.044) (-2819.287) * (-2822.968) (-2831.342) [-2821.545] (-2824.708) -- 0:07:14
180000 -- (-2825.777) (-2817.269) [-2816.466] (-2816.479) * [-2816.317] (-2827.944) (-2812.664) (-2817.736) -- 0:07:12
Average standard deviation of split frequencies: 0.004639
180500 -- (-2820.836) (-2816.699) [-2811.482] (-2811.588) * (-2813.520) (-2820.187) [-2816.872] (-2813.383) -- 0:07:11
181000 -- (-2824.842) (-2815.472) (-2819.033) [-2808.882] * (-2817.263) (-2816.262) [-2815.899] (-2827.678) -- 0:07:14
181500 -- (-2833.894) (-2815.340) (-2812.568) [-2814.026] * (-2817.330) [-2812.305] (-2810.611) (-2817.462) -- 0:07:12
182000 -- (-2817.863) (-2816.413) (-2820.070) [-2812.241] * (-2812.988) (-2821.153) (-2817.982) [-2819.909] -- 0:07:11
182500 -- (-2818.550) [-2811.534] (-2809.933) (-2810.518) * (-2829.380) (-2808.229) (-2812.029) [-2813.203] -- 0:07:10
183000 -- (-2819.824) [-2810.507] (-2821.306) (-2814.823) * [-2821.402] (-2816.234) (-2818.633) (-2823.053) -- 0:07:13
183500 -- (-2812.577) [-2819.797] (-2812.571) (-2810.998) * (-2813.253) (-2813.792) [-2818.672] (-2813.648) -- 0:07:11
184000 -- [-2814.098] (-2819.379) (-2805.530) (-2818.326) * [-2812.056] (-2815.613) (-2822.564) (-2818.994) -- 0:07:10
184500 -- (-2813.601) (-2818.964) [-2809.556] (-2818.470) * [-2807.062] (-2817.103) (-2821.672) (-2816.881) -- 0:07:08
185000 -- (-2819.227) (-2810.305) [-2817.518] (-2820.921) * [-2815.497] (-2816.285) (-2823.464) (-2821.965) -- 0:07:11
Average standard deviation of split frequencies: 0.003942
185500 -- (-2821.038) [-2814.208] (-2819.134) (-2814.301) * [-2813.963] (-2817.750) (-2820.126) (-2821.640) -- 0:07:10
186000 -- [-2822.732] (-2816.140) (-2816.028) (-2820.755) * (-2814.909) [-2815.362] (-2821.143) (-2815.307) -- 0:07:08
186500 -- (-2830.551) [-2815.583] (-2818.661) (-2828.944) * (-2817.369) (-2818.332) [-2822.049] (-2817.110) -- 0:07:07
187000 -- (-2816.784) (-2813.182) [-2808.134] (-2818.013) * (-2821.498) [-2811.134] (-2814.242) (-2818.433) -- 0:07:10
187500 -- (-2811.349) [-2811.414] (-2821.348) (-2818.772) * (-2814.786) (-2821.501) [-2812.374] (-2808.011) -- 0:07:09
188000 -- (-2818.101) [-2815.591] (-2815.108) (-2814.376) * (-2818.220) (-2824.092) [-2821.715] (-2814.088) -- 0:07:07
188500 -- (-2821.607) (-2816.082) [-2812.993] (-2824.777) * (-2813.536) (-2811.625) [-2818.363] (-2809.025) -- 0:07:06
189000 -- [-2819.092] (-2815.298) (-2820.977) (-2827.651) * (-2816.977) [-2812.921] (-2821.058) (-2815.637) -- 0:07:09
189500 -- [-2814.755] (-2817.003) (-2818.579) (-2822.221) * [-2818.397] (-2814.505) (-2830.027) (-2813.846) -- 0:07:07
190000 -- (-2810.359) (-2824.683) (-2815.803) [-2816.157] * [-2814.971] (-2816.782) (-2817.042) (-2814.901) -- 0:07:06
Average standard deviation of split frequencies: 0.003571
190500 -- (-2815.503) (-2820.252) [-2823.552] (-2814.672) * (-2813.438) [-2809.200] (-2817.940) (-2816.754) -- 0:07:04
191000 -- (-2813.246) (-2819.864) [-2822.086] (-2818.032) * (-2813.296) (-2815.487) [-2816.151] (-2819.904) -- 0:07:07
191500 -- [-2810.492] (-2822.536) (-2823.335) (-2818.835) * (-2814.127) (-2817.015) [-2819.578] (-2812.648) -- 0:07:06
192000 -- [-2812.772] (-2812.427) (-2815.774) (-2825.734) * (-2813.252) (-2820.004) [-2820.092] (-2826.278) -- 0:07:05
192500 -- (-2805.310) [-2814.992] (-2816.248) (-2829.153) * (-2823.105) (-2814.097) (-2814.269) [-2817.440] -- 0:07:07
193000 -- (-2813.512) (-2822.676) [-2816.271] (-2825.649) * [-2823.213] (-2816.575) (-2816.843) (-2812.008) -- 0:07:06
193500 -- (-2822.702) (-2810.587) (-2821.071) [-2816.004] * (-2828.586) (-2821.581) (-2818.120) [-2809.473] -- 0:07:05
194000 -- (-2819.717) [-2824.603] (-2818.119) (-2812.682) * (-2829.476) (-2818.942) (-2811.832) [-2817.441] -- 0:07:03
194500 -- (-2816.665) (-2810.813) [-2815.770] (-2814.290) * [-2814.892] (-2813.611) (-2811.318) (-2815.893) -- 0:07:06
195000 -- (-2820.736) (-2824.162) (-2822.171) [-2810.222] * (-2818.518) [-2813.715] (-2817.316) (-2816.017) -- 0:07:05
Average standard deviation of split frequencies: 0.004276
195500 -- [-2817.714] (-2816.731) (-2814.888) (-2817.962) * (-2825.663) (-2824.673) [-2824.025] (-2819.159) -- 0:07:03
196000 -- [-2822.696] (-2826.001) (-2814.569) (-2819.028) * (-2820.176) (-2821.349) [-2813.851] (-2816.423) -- 0:07:02
196500 -- (-2818.713) [-2811.512] (-2817.399) (-2824.837) * (-2819.060) (-2818.285) (-2814.860) [-2814.000] -- 0:07:05
197000 -- (-2822.631) (-2808.312) [-2815.837] (-2821.824) * (-2828.360) (-2813.234) (-2818.909) [-2815.354] -- 0:07:03
197500 -- (-2825.780) (-2810.830) (-2817.273) [-2816.945] * (-2828.164) (-2812.904) [-2818.015] (-2826.051) -- 0:07:02
198000 -- [-2811.916] (-2814.666) (-2810.128) (-2830.892) * (-2822.861) [-2810.731] (-2838.024) (-2813.953) -- 0:07:01
198500 -- (-2827.847) [-2818.197] (-2825.127) (-2829.110) * (-2833.435) [-2814.358] (-2820.044) (-2813.330) -- 0:07:03
199000 -- [-2812.752] (-2814.896) (-2813.820) (-2816.643) * (-2814.459) (-2815.957) (-2815.666) [-2823.381] -- 0:07:02
199500 -- (-2807.023) (-2816.226) [-2815.882] (-2828.570) * (-2823.529) [-2814.950] (-2816.058) (-2821.876) -- 0:07:01
200000 -- (-2816.853) (-2814.950) [-2812.946] (-2814.286) * (-2820.802) (-2815.453) (-2809.536) [-2817.132] -- 0:07:00
Average standard deviation of split frequencies: 0.003915
200500 -- (-2818.583) (-2817.233) [-2826.881] (-2823.134) * (-2816.197) (-2822.213) [-2812.929] (-2822.191) -- 0:07:02
201000 -- [-2810.311] (-2816.591) (-2816.773) (-2813.008) * (-2823.445) (-2818.832) (-2815.624) [-2812.874] -- 0:07:01
201500 -- (-2818.449) [-2811.052] (-2817.824) (-2819.858) * (-2830.767) [-2817.150] (-2817.546) (-2813.470) -- 0:07:00
202000 -- [-2820.162] (-2828.025) (-2819.175) (-2816.752) * (-2826.061) [-2817.669] (-2818.966) (-2812.967) -- 0:06:58
202500 -- (-2815.448) (-2817.744) [-2813.985] (-2816.841) * (-2834.073) (-2810.004) [-2812.772] (-2815.994) -- 0:07:01
203000 -- (-2822.167) (-2819.164) (-2821.269) [-2814.249] * (-2823.666) (-2819.443) (-2818.247) [-2815.020] -- 0:07:00
203500 -- (-2806.592) [-2818.974] (-2817.963) (-2817.991) * (-2809.941) (-2814.892) [-2816.784] (-2823.938) -- 0:06:58
204000 -- [-2811.991] (-2817.856) (-2810.260) (-2823.590) * (-2815.499) (-2814.621) (-2824.329) [-2818.664] -- 0:06:57
204500 -- (-2815.616) (-2816.921) [-2811.412] (-2818.107) * (-2819.104) (-2817.824) (-2819.476) [-2821.999] -- 0:07:00
205000 -- (-2812.988) (-2822.432) (-2817.718) [-2816.467] * (-2818.623) (-2816.928) (-2811.931) [-2806.512] -- 0:06:58
Average standard deviation of split frequencies: 0.002288
205500 -- (-2810.970) (-2817.583) (-2816.236) [-2815.451] * [-2814.369] (-2809.159) (-2815.058) (-2818.835) -- 0:06:57
206000 -- [-2807.273] (-2817.173) (-2828.320) (-2811.731) * (-2824.973) (-2816.186) [-2811.998] (-2816.607) -- 0:06:56
206500 -- (-2814.380) (-2819.057) (-2821.042) [-2811.719] * (-2822.211) [-2814.582] (-2825.462) (-2814.020) -- 0:06:58
207000 -- (-2820.467) (-2818.078) (-2821.622) [-2823.162] * [-2818.694] (-2821.631) (-2825.657) (-2833.761) -- 0:06:57
207500 -- (-2819.171) [-2814.389] (-2823.351) (-2822.937) * (-2817.430) (-2813.777) [-2813.381] (-2816.110) -- 0:06:56
208000 -- (-2813.517) (-2815.042) [-2816.340] (-2815.520) * (-2819.298) [-2814.350] (-2822.055) (-2825.805) -- 0:06:55
208500 -- [-2812.655] (-2823.574) (-2815.162) (-2814.821) * (-2810.735) (-2818.990) [-2810.568] (-2819.484) -- 0:06:57
209000 -- (-2810.298) (-2818.603) (-2812.232) [-2815.855] * (-2812.535) (-2829.434) (-2814.194) [-2813.037] -- 0:06:56
209500 -- (-2808.384) (-2814.346) (-2821.154) [-2811.483] * (-2808.939) (-2824.170) [-2809.857] (-2812.784) -- 0:06:55
210000 -- [-2818.372] (-2819.714) (-2813.495) (-2818.851) * (-2818.486) [-2808.377] (-2820.745) (-2808.543) -- 0:06:53
Average standard deviation of split frequencies: 0.002486
210500 -- (-2819.246) (-2818.223) [-2830.745] (-2822.560) * (-2811.432) (-2819.026) [-2812.050] (-2810.410) -- 0:06:56
211000 -- (-2811.107) (-2817.781) [-2810.272] (-2819.803) * (-2821.357) (-2818.064) [-2812.361] (-2816.982) -- 0:06:55
211500 -- (-2823.617) (-2813.398) (-2823.680) [-2816.056] * (-2836.240) (-2814.528) [-2809.915] (-2815.093) -- 0:06:53
212000 -- (-2810.893) [-2812.521] (-2815.706) (-2813.919) * (-2817.232) (-2820.283) [-2806.566] (-2824.400) -- 0:06:56
212500 -- (-2818.711) [-2814.638] (-2813.505) (-2818.529) * (-2810.342) (-2815.810) (-2821.169) [-2819.829] -- 0:06:55
213000 -- (-2812.564) [-2822.801] (-2807.577) (-2814.883) * (-2814.845) (-2819.900) [-2812.464] (-2818.665) -- 0:06:53
213500 -- (-2820.775) (-2806.907) [-2811.191] (-2814.183) * [-2813.694] (-2818.240) (-2813.641) (-2826.042) -- 0:06:52
214000 -- [-2820.986] (-2836.486) (-2819.575) (-2814.561) * (-2827.826) [-2828.118] (-2813.068) (-2818.001) -- 0:06:55
214500 -- [-2810.600] (-2815.070) (-2818.893) (-2820.238) * (-2812.676) (-2828.607) (-2816.190) [-2813.713] -- 0:06:53
215000 -- [-2815.287] (-2812.841) (-2814.795) (-2824.314) * [-2811.077] (-2821.139) (-2830.006) (-2814.639) -- 0:06:52
Average standard deviation of split frequencies: 0.002425
215500 -- [-2815.145] (-2817.964) (-2813.982) (-2814.726) * [-2811.228] (-2819.222) (-2814.361) (-2815.557) -- 0:06:51
216000 -- [-2815.240] (-2824.889) (-2819.599) (-2806.734) * (-2815.067) (-2816.924) (-2823.847) [-2806.541] -- 0:06:53
216500 -- (-2813.916) (-2819.052) [-2815.845] (-2811.535) * [-2810.205] (-2829.313) (-2822.377) (-2821.035) -- 0:06:52
217000 -- (-2812.787) (-2820.339) [-2808.980] (-2817.594) * [-2808.975] (-2826.709) (-2820.624) (-2817.838) -- 0:06:51
217500 -- (-2812.065) (-2816.231) (-2811.945) [-2813.696] * (-2821.934) (-2821.409) (-2820.746) [-2815.756] -- 0:06:50
218000 -- (-2815.253) (-2814.862) (-2828.459) [-2810.554] * (-2814.408) (-2811.100) (-2815.279) [-2817.303] -- 0:06:52
218500 -- [-2816.664] (-2823.267) (-2814.541) (-2822.084) * (-2828.513) (-2817.339) (-2812.390) [-2815.477] -- 0:06:51
219000 -- (-2823.747) [-2811.161] (-2816.101) (-2823.902) * (-2825.486) (-2812.947) (-2818.144) [-2817.521] -- 0:06:50
219500 -- (-2817.184) (-2817.157) (-2815.155) [-2818.084] * (-2812.584) [-2810.634] (-2823.023) (-2824.576) -- 0:06:48
220000 -- (-2815.606) [-2816.927] (-2817.132) (-2812.063) * (-2823.736) [-2817.015] (-2827.188) (-2820.262) -- 0:06:51
Average standard deviation of split frequencies: 0.002374
220500 -- [-2813.363] (-2820.606) (-2820.435) (-2814.858) * (-2822.506) (-2817.469) [-2815.517] (-2827.082) -- 0:06:50
221000 -- (-2811.075) (-2816.214) [-2818.117] (-2817.728) * [-2817.211] (-2816.108) (-2810.503) (-2824.101) -- 0:06:48
221500 -- [-2814.421] (-2821.359) (-2819.689) (-2814.112) * (-2820.328) [-2823.719] (-2816.027) (-2815.507) -- 0:06:47
222000 -- [-2810.547] (-2818.868) (-2816.704) (-2821.964) * (-2821.367) (-2813.314) [-2815.935] (-2820.591) -- 0:06:50
222500 -- [-2817.162] (-2823.828) (-2818.951) (-2824.756) * [-2813.632] (-2818.454) (-2813.053) (-2822.511) -- 0:06:48
223000 -- (-2813.768) (-2827.565) [-2813.405] (-2818.132) * (-2818.421) (-2829.208) (-2822.907) [-2811.991] -- 0:06:47
223500 -- (-2813.394) [-2816.884] (-2816.725) (-2821.282) * [-2822.389] (-2814.408) (-2813.414) (-2822.355) -- 0:06:46
224000 -- (-2826.372) [-2813.513] (-2811.555) (-2813.059) * (-2815.464) (-2810.036) (-2810.535) [-2809.067] -- 0:06:48
224500 -- (-2825.639) [-2807.713] (-2818.895) (-2812.925) * (-2818.538) (-2822.443) [-2808.763] (-2817.048) -- 0:06:47
225000 -- (-2815.221) [-2813.693] (-2819.254) (-2823.296) * (-2821.047) [-2823.892] (-2816.327) (-2822.093) -- 0:06:46
Average standard deviation of split frequencies: 0.002549
225500 -- (-2811.814) [-2809.458] (-2825.706) (-2813.002) * [-2821.030] (-2818.915) (-2830.682) (-2817.445) -- 0:06:45
226000 -- (-2811.752) (-2816.125) (-2817.101) [-2819.280] * (-2811.322) (-2827.148) (-2824.220) [-2813.793] -- 0:06:47
226500 -- (-2812.950) [-2808.371] (-2816.627) (-2823.364) * [-2823.266] (-2818.540) (-2816.872) (-2814.399) -- 0:06:46
227000 -- [-2815.287] (-2815.596) (-2813.140) (-2816.123) * (-2813.112) (-2821.182) (-2818.461) [-2811.113] -- 0:06:45
227500 -- (-2817.974) [-2815.342] (-2815.929) (-2814.234) * (-2818.817) [-2818.834] (-2827.021) (-2820.807) -- 0:06:44
228000 -- (-2815.579) (-2823.662) (-2820.165) [-2810.741] * (-2818.464) [-2811.661] (-2814.995) (-2824.585) -- 0:06:46
228500 -- (-2817.556) (-2827.315) [-2809.263] (-2817.250) * (-2811.065) [-2816.476] (-2821.297) (-2827.720) -- 0:06:45
229000 -- (-2823.284) (-2814.311) [-2810.616] (-2813.088) * (-2816.072) (-2810.164) [-2813.561] (-2818.825) -- 0:06:44
229500 -- [-2811.006] (-2811.897) (-2814.002) (-2811.875) * (-2816.245) (-2822.562) [-2811.755] (-2813.708) -- 0:06:46
230000 -- [-2816.956] (-2814.840) (-2812.040) (-2813.622) * [-2808.549] (-2815.147) (-2808.223) (-2812.281) -- 0:06:45
Average standard deviation of split frequencies: 0.003179
230500 -- [-2820.016] (-2819.862) (-2816.031) (-2819.626) * (-2814.985) (-2815.330) [-2816.787] (-2812.469) -- 0:06:43
231000 -- (-2830.043) (-2819.708) (-2814.691) [-2809.504] * [-2814.186] (-2810.126) (-2818.918) (-2820.505) -- 0:06:42
231500 -- [-2809.258] (-2812.520) (-2824.827) (-2812.160) * [-2811.603] (-2823.038) (-2820.284) (-2816.885) -- 0:06:44
232000 -- (-2821.057) (-2824.358) (-2814.904) [-2819.211] * (-2819.203) (-2818.533) (-2814.608) [-2811.054] -- 0:06:43
232500 -- (-2824.190) (-2815.518) (-2812.901) [-2813.253] * (-2817.978) (-2807.194) (-2821.137) [-2814.624] -- 0:06:42
233000 -- (-2824.007) (-2817.155) [-2813.113] (-2813.118) * (-2810.816) (-2814.644) (-2818.697) [-2817.910] -- 0:06:41
233500 -- (-2821.786) (-2811.377) (-2816.004) [-2818.902] * (-2816.297) (-2814.746) [-2813.273] (-2820.399) -- 0:06:43
234000 -- (-2818.866) (-2814.977) [-2812.943] (-2807.977) * [-2812.163] (-2823.626) (-2813.302) (-2815.881) -- 0:06:42
234500 -- [-2809.393] (-2814.473) (-2827.130) (-2828.654) * [-2810.831] (-2816.217) (-2815.899) (-2819.749) -- 0:06:41
235000 -- (-2814.927) [-2813.262] (-2832.575) (-2818.392) * (-2810.384) [-2823.745] (-2818.490) (-2817.379) -- 0:06:40
Average standard deviation of split frequencies: 0.003995
235500 -- (-2821.991) [-2812.475] (-2816.485) (-2817.874) * [-2815.808] (-2827.209) (-2818.399) (-2829.046) -- 0:06:42
236000 -- (-2823.712) (-2825.042) (-2823.946) [-2812.533] * (-2808.946) [-2818.190] (-2812.392) (-2817.348) -- 0:06:41
236500 -- (-2820.067) (-2825.402) (-2826.567) [-2823.039] * [-2813.539] (-2808.634) (-2815.796) (-2820.127) -- 0:06:40
237000 -- (-2817.346) (-2824.815) [-2818.168] (-2813.882) * (-2832.724) (-2815.829) (-2811.843) [-2823.279] -- 0:06:39
237500 -- (-2815.931) (-2823.529) (-2817.725) [-2822.839] * (-2826.448) (-2829.696) (-2812.219) [-2822.208] -- 0:06:41
238000 -- (-2817.651) [-2819.799] (-2829.847) (-2816.516) * (-2818.133) (-2816.188) [-2811.166] (-2815.247) -- 0:06:40
238500 -- (-2819.840) (-2821.046) [-2818.050] (-2813.162) * [-2809.178] (-2825.554) (-2827.886) (-2817.078) -- 0:06:39
239000 -- (-2821.187) (-2810.648) (-2815.002) [-2814.751] * (-2817.950) (-2813.369) [-2817.287] (-2821.687) -- 0:06:38
239500 -- (-2817.011) (-2813.706) (-2819.228) [-2823.286] * [-2812.429] (-2818.683) (-2817.339) (-2817.205) -- 0:06:40
240000 -- (-2816.098) [-2812.019] (-2811.423) (-2817.542) * (-2820.993) (-2814.534) (-2818.564) [-2804.174] -- 0:06:39
Average standard deviation of split frequencies: 0.004135
240500 -- (-2811.376) [-2809.597] (-2809.885) (-2814.477) * (-2812.639) (-2821.345) (-2823.033) [-2816.215] -- 0:06:37
241000 -- (-2820.764) (-2810.575) (-2820.773) [-2816.149] * (-2814.870) (-2819.736) (-2831.601) [-2820.431] -- 0:06:36
241500 -- [-2820.566] (-2818.374) (-2816.354) (-2813.968) * [-2810.610] (-2818.885) (-2819.339) (-2818.301) -- 0:06:38
242000 -- (-2826.859) [-2818.381] (-2815.941) (-2813.771) * [-2816.083] (-2813.646) (-2821.870) (-2817.165) -- 0:06:37
242500 -- (-2815.792) (-2813.316) [-2812.969] (-2812.309) * (-2818.690) (-2820.769) (-2815.079) [-2821.880] -- 0:06:36
243000 -- (-2815.469) (-2813.311) [-2822.574] (-2819.199) * (-2815.828) (-2821.922) [-2814.189] (-2827.291) -- 0:06:35
243500 -- (-2827.214) (-2808.939) [-2811.881] (-2830.176) * (-2813.544) (-2816.623) [-2812.854] (-2821.441) -- 0:06:37
244000 -- [-2813.181] (-2810.019) (-2818.967) (-2817.440) * (-2826.543) [-2823.862] (-2815.668) (-2813.354) -- 0:06:36
244500 -- (-2813.266) [-2812.313] (-2808.562) (-2820.671) * [-2812.181] (-2832.375) (-2825.545) (-2822.156) -- 0:06:35
245000 -- (-2816.725) [-2812.968] (-2820.715) (-2824.509) * (-2823.580) (-2820.516) (-2832.033) [-2813.869] -- 0:06:34
Average standard deviation of split frequencies: 0.004684
245500 -- (-2814.325) (-2822.888) [-2815.260] (-2822.115) * [-2813.807] (-2810.371) (-2821.080) (-2816.102) -- 0:06:36
246000 -- [-2814.173] (-2818.112) (-2827.265) (-2816.211) * (-2810.838) (-2815.497) [-2815.032] (-2814.771) -- 0:06:35
246500 -- (-2814.389) (-2820.126) (-2834.241) [-2812.892] * [-2816.267] (-2816.679) (-2811.902) (-2814.013) -- 0:06:34
247000 -- [-2813.327] (-2818.645) (-2820.220) (-2827.867) * (-2823.097) (-2815.309) [-2818.099] (-2822.016) -- 0:06:36
247500 -- (-2819.930) (-2821.454) [-2817.869] (-2817.932) * (-2824.228) [-2816.583] (-2807.596) (-2814.371) -- 0:06:35
248000 -- (-2824.498) [-2816.427] (-2820.192) (-2815.416) * [-2819.908] (-2818.789) (-2821.401) (-2817.930) -- 0:06:34
248500 -- (-2814.967) (-2817.781) (-2810.282) [-2814.190] * (-2812.080) (-2813.797) (-2836.111) [-2813.898] -- 0:06:33
249000 -- (-2823.549) [-2814.627] (-2820.006) (-2814.870) * (-2827.546) (-2808.641) (-2820.241) [-2810.151] -- 0:06:35
249500 -- [-2814.293] (-2821.458) (-2814.451) (-2817.323) * (-2824.077) (-2811.106) (-2815.432) [-2819.127] -- 0:06:34
250000 -- [-2815.111] (-2823.407) (-2826.310) (-2814.180) * (-2818.700) (-2818.037) (-2813.058) [-2810.191] -- 0:06:33
Average standard deviation of split frequencies: 0.005015
250500 -- (-2811.063) (-2816.193) (-2814.891) [-2807.964] * (-2816.953) [-2808.826] (-2818.645) (-2812.773) -- 0:06:31
251000 -- (-2819.948) [-2815.740] (-2821.759) (-2817.808) * (-2827.040) [-2809.606] (-2816.137) (-2823.087) -- 0:06:33
251500 -- (-2813.442) [-2817.284] (-2819.808) (-2813.439) * (-2820.550) [-2818.212] (-2815.480) (-2824.718) -- 0:06:32
252000 -- [-2808.206] (-2811.506) (-2813.351) (-2818.436) * (-2809.840) (-2815.620) [-2817.510] (-2818.135) -- 0:06:31
252500 -- [-2821.830] (-2819.880) (-2814.672) (-2814.032) * (-2822.637) (-2810.612) [-2808.905] (-2816.242) -- 0:06:30
253000 -- (-2824.752) (-2810.140) [-2810.452] (-2824.832) * (-2812.840) (-2812.844) [-2814.089] (-2808.054) -- 0:06:32
253500 -- (-2810.112) [-2811.708] (-2812.416) (-2819.023) * (-2816.627) [-2813.091] (-2814.357) (-2826.611) -- 0:06:31
254000 -- (-2818.169) (-2818.970) [-2822.637] (-2810.054) * (-2821.688) (-2818.462) (-2816.679) [-2814.585] -- 0:06:30
254500 -- [-2811.783] (-2813.747) (-2817.877) (-2814.682) * (-2815.804) (-2822.800) (-2821.494) [-2820.036] -- 0:06:29
255000 -- [-2819.919] (-2817.694) (-2811.231) (-2827.442) * (-2820.569) [-2816.591] (-2821.068) (-2817.532) -- 0:06:31
Average standard deviation of split frequencies: 0.003887
255500 -- (-2815.158) (-2817.012) [-2817.200] (-2812.414) * (-2812.394) [-2807.668] (-2819.024) (-2831.349) -- 0:06:30
256000 -- (-2817.226) (-2820.025) (-2812.241) [-2812.781] * (-2812.246) [-2813.657] (-2817.312) (-2814.746) -- 0:06:29
256500 -- (-2810.718) (-2813.982) (-2813.984) [-2818.979] * [-2809.250] (-2819.647) (-2830.866) (-2813.705) -- 0:06:28
257000 -- (-2813.209) (-2820.315) (-2821.252) [-2817.104] * [-2815.334] (-2822.574) (-2824.064) (-2812.565) -- 0:06:30
257500 -- [-2808.745] (-2816.663) (-2815.868) (-2814.946) * [-2811.467] (-2817.719) (-2828.915) (-2822.321) -- 0:06:29
258000 -- (-2823.083) (-2818.207) (-2822.295) [-2814.673] * (-2819.325) (-2827.683) (-2813.893) [-2811.199] -- 0:06:28
258500 -- [-2811.453] (-2822.099) (-2813.517) (-2809.490) * [-2816.436] (-2814.244) (-2817.722) (-2824.035) -- 0:06:27
259000 -- (-2817.608) [-2828.178] (-2830.534) (-2813.758) * (-2811.919) (-2818.095) (-2812.425) [-2815.717] -- 0:06:29
259500 -- (-2817.218) (-2824.149) [-2821.321] (-2814.113) * (-2815.201) (-2812.698) (-2823.708) [-2816.406] -- 0:06:28
260000 -- (-2820.322) (-2822.843) [-2816.195] (-2819.844) * (-2813.642) (-2813.723) (-2817.333) [-2817.905] -- 0:06:27
Average standard deviation of split frequencies: 0.003617
260500 -- [-2820.366] (-2816.776) (-2823.843) (-2817.030) * (-2818.550) (-2817.656) [-2821.244] (-2819.726) -- 0:06:26
261000 -- (-2817.278) (-2814.355) (-2813.190) [-2815.009] * [-2809.705] (-2820.909) (-2826.173) (-2810.886) -- 0:06:27
261500 -- (-2821.854) (-2814.214) (-2815.180) [-2815.527] * (-2813.236) [-2804.295] (-2835.767) (-2814.070) -- 0:06:26
262000 -- (-2826.916) (-2816.328) (-2817.736) [-2809.104] * (-2825.314) (-2807.522) (-2840.086) [-2815.167] -- 0:06:25
262500 -- [-2816.376] (-2806.650) (-2824.934) (-2816.078) * [-2823.355] (-2822.820) (-2821.517) (-2811.107) -- 0:06:24
263000 -- (-2813.308) [-2812.388] (-2817.947) (-2824.054) * (-2814.309) (-2820.877) (-2814.556) [-2815.272] -- 0:06:26
263500 -- (-2825.310) [-2813.022] (-2828.685) (-2816.144) * [-2814.249] (-2810.541) (-2817.091) (-2813.310) -- 0:06:25
264000 -- (-2810.244) [-2818.855] (-2821.760) (-2811.874) * [-2816.988] (-2810.076) (-2819.283) (-2817.860) -- 0:06:24
264500 -- (-2823.140) (-2821.185) (-2820.930) [-2822.446] * [-2819.699] (-2819.021) (-2805.737) (-2815.381) -- 0:06:23
265000 -- [-2813.536] (-2826.409) (-2819.169) (-2813.246) * [-2815.306] (-2815.159) (-2813.749) (-2814.290) -- 0:06:25
Average standard deviation of split frequencies: 0.003938
265500 -- (-2826.204) (-2820.974) (-2821.018) [-2813.478] * (-2816.024) (-2813.698) [-2816.875] (-2824.454) -- 0:06:24
266000 -- (-2819.272) (-2816.057) [-2816.889] (-2808.021) * (-2813.674) (-2824.350) (-2821.945) [-2816.386] -- 0:06:23
266500 -- (-2822.685) (-2817.793) (-2818.676) [-2814.023] * [-2812.708] (-2818.428) (-2822.697) (-2817.367) -- 0:06:25
267000 -- (-2814.813) (-2810.518) (-2824.069) [-2816.468] * (-2813.629) (-2808.832) (-2824.980) [-2822.479] -- 0:06:24
267500 -- (-2821.543) (-2811.464) (-2812.484) [-2818.197] * (-2821.485) (-2814.571) [-2808.558] (-2814.699) -- 0:06:23
268000 -- (-2825.715) [-2817.468] (-2819.717) (-2830.251) * (-2818.305) (-2825.305) [-2812.330] (-2819.076) -- 0:06:22
268500 -- (-2818.288) (-2817.139) [-2814.396] (-2825.347) * [-2815.207] (-2816.931) (-2813.500) (-2813.332) -- 0:06:24
269000 -- [-2810.830] (-2816.827) (-2810.581) (-2823.007) * (-2820.765) (-2809.471) (-2815.435) [-2818.843] -- 0:06:23
269500 -- (-2819.379) (-2816.442) (-2816.380) [-2808.580] * (-2813.167) (-2821.158) [-2814.248] (-2819.036) -- 0:06:22
270000 -- [-2815.206] (-2818.110) (-2814.536) (-2816.743) * (-2820.554) [-2814.373] (-2820.322) (-2824.778) -- 0:06:21
Average standard deviation of split frequencies: 0.004257
270500 -- (-2831.301) (-2815.822) (-2811.797) [-2820.327] * [-2812.210] (-2814.990) (-2816.640) (-2813.091) -- 0:06:22
271000 -- [-2821.223] (-2818.477) (-2819.781) (-2821.533) * (-2819.300) (-2822.847) (-2816.033) [-2818.438] -- 0:06:21
271500 -- (-2825.352) (-2822.495) [-2810.589] (-2817.589) * (-2822.309) [-2809.453] (-2814.247) (-2821.497) -- 0:06:21
272000 -- (-2816.658) (-2836.857) [-2812.524] (-2812.235) * (-2836.098) [-2811.289] (-2819.308) (-2817.695) -- 0:06:20
272500 -- [-2823.139] (-2820.124) (-2819.206) (-2815.294) * (-2817.906) (-2819.556) [-2813.890] (-2816.155) -- 0:06:21
273000 -- (-2825.190) (-2820.799) (-2816.049) [-2807.216] * (-2823.319) (-2813.641) [-2815.984] (-2820.435) -- 0:06:20
273500 -- (-2809.369) (-2824.822) (-2823.810) [-2812.620] * (-2823.519) (-2823.103) [-2811.164] (-2817.161) -- 0:06:19
274000 -- (-2815.511) (-2829.285) [-2820.465] (-2824.949) * (-2826.580) [-2819.596] (-2818.193) (-2825.476) -- 0:06:18
274500 -- (-2817.015) (-2820.764) [-2817.401] (-2821.405) * (-2821.134) (-2819.686) (-2814.649) [-2819.514] -- 0:06:20
275000 -- (-2831.213) [-2803.666] (-2811.815) (-2815.663) * (-2828.372) (-2835.685) [-2810.885] (-2816.575) -- 0:06:19
Average standard deviation of split frequencies: 0.003416
275500 -- (-2826.091) [-2808.766] (-2809.841) (-2814.769) * [-2816.805] (-2819.482) (-2813.421) (-2826.103) -- 0:06:18
276000 -- [-2806.959] (-2812.982) (-2822.801) (-2817.771) * (-2819.029) [-2819.029] (-2815.050) (-2830.647) -- 0:06:17
276500 -- (-2815.391) (-2812.606) [-2811.045] (-2828.017) * (-2819.918) (-2815.094) [-2813.851] (-2815.922) -- 0:06:19
277000 -- (-2818.441) (-2815.090) [-2814.558] (-2822.477) * [-2817.765] (-2818.500) (-2816.097) (-2817.075) -- 0:06:18
277500 -- (-2809.369) [-2808.758] (-2816.604) (-2819.323) * (-2824.377) (-2825.918) (-2830.754) [-2808.268] -- 0:06:17
278000 -- (-2818.604) (-2818.660) (-2817.271) [-2813.980] * (-2817.665) (-2814.225) [-2810.611] (-2822.582) -- 0:06:16
278500 -- (-2822.398) (-2817.666) [-2813.625] (-2821.449) * (-2827.124) [-2812.703] (-2821.696) (-2818.687) -- 0:06:18
279000 -- (-2818.995) (-2818.035) (-2823.439) [-2811.374] * (-2820.144) (-2815.754) [-2816.657] (-2819.220) -- 0:06:17
279500 -- (-2815.357) [-2820.610] (-2820.446) (-2815.922) * (-2814.559) (-2815.947) [-2813.489] (-2816.245) -- 0:06:16
280000 -- (-2808.204) (-2810.836) (-2822.573) [-2815.147] * (-2815.658) [-2810.699] (-2817.310) (-2815.552) -- 0:06:15
Average standard deviation of split frequencies: 0.003546
280500 -- (-2814.881) [-2812.564] (-2832.919) (-2823.737) * (-2813.602) (-2816.781) [-2810.091] (-2816.945) -- 0:06:17
281000 -- (-2820.094) (-2815.891) [-2821.712] (-2822.409) * (-2829.044) (-2815.054) [-2815.900] (-2826.419) -- 0:06:16
281500 -- (-2823.211) (-2818.299) [-2816.262] (-2819.679) * (-2817.574) [-2814.540] (-2814.575) (-2824.252) -- 0:06:15
282000 -- (-2816.498) (-2816.118) [-2812.081] (-2817.336) * [-2818.414] (-2815.188) (-2831.005) (-2812.306) -- 0:06:14
282500 -- (-2821.247) (-2812.150) [-2813.909] (-2814.935) * (-2820.177) (-2813.514) [-2811.848] (-2810.768) -- 0:06:15
283000 -- (-2819.288) (-2817.806) [-2807.136] (-2809.826) * (-2817.202) (-2812.426) [-2819.895] (-2816.541) -- 0:06:14
283500 -- (-2828.479) (-2823.516) [-2812.151] (-2812.995) * (-2808.680) (-2817.826) (-2825.454) [-2811.080] -- 0:06:14
284000 -- (-2819.294) (-2818.848) [-2812.589] (-2817.226) * (-2811.932) [-2826.726] (-2818.728) (-2826.074) -- 0:06:13
284500 -- (-2819.421) (-2843.129) (-2816.029) [-2814.039] * [-2817.882] (-2820.062) (-2817.404) (-2824.088) -- 0:06:14
285000 -- (-2818.099) [-2811.491] (-2822.701) (-2813.129) * [-2811.526] (-2813.470) (-2819.119) (-2812.895) -- 0:06:13
Average standard deviation of split frequencies: 0.004395
285500 -- (-2815.055) [-2818.960] (-2831.495) (-2824.145) * (-2814.049) (-2814.329) (-2814.568) [-2817.073] -- 0:06:12
286000 -- (-2816.410) [-2818.229] (-2817.811) (-2820.655) * (-2816.919) (-2813.897) [-2814.690] (-2825.663) -- 0:06:14
286500 -- (-2817.078) (-2818.612) (-2822.725) [-2814.177] * [-2813.583] (-2820.468) (-2814.698) (-2829.101) -- 0:06:13
287000 -- [-2806.580] (-2823.420) (-2817.138) (-2819.930) * (-2817.426) [-2817.526] (-2816.817) (-2824.939) -- 0:06:12
287500 -- (-2821.797) [-2811.719] (-2816.673) (-2821.604) * [-2818.273] (-2817.833) (-2814.045) (-2819.603) -- 0:06:11
288000 -- (-2818.666) (-2822.430) [-2817.000] (-2810.759) * (-2820.228) (-2813.557) (-2815.349) [-2822.420] -- 0:06:13
288500 -- (-2815.099) (-2817.193) [-2820.940] (-2819.244) * (-2821.746) (-2816.162) (-2816.808) [-2806.691] -- 0:06:12
289000 -- (-2816.881) (-2825.794) (-2808.878) [-2817.552] * [-2809.986] (-2811.691) (-2823.876) (-2811.033) -- 0:06:11
289500 -- [-2813.579] (-2809.784) (-2821.096) (-2813.951) * [-2812.576] (-2814.812) (-2816.654) (-2811.564) -- 0:06:10
290000 -- [-2822.322] (-2808.279) (-2821.300) (-2824.408) * (-2808.837) (-2824.295) (-2810.890) [-2812.845] -- 0:06:12
Average standard deviation of split frequencies: 0.005046
290500 -- [-2812.390] (-2825.387) (-2826.009) (-2824.567) * (-2823.301) (-2810.524) [-2813.024] (-2817.978) -- 0:06:11
291000 -- [-2814.453] (-2818.755) (-2826.770) (-2818.174) * (-2817.617) (-2812.704) [-2811.032] (-2822.675) -- 0:06:10
291500 -- (-2813.128) (-2815.842) (-2829.761) [-2818.878] * (-2814.279) (-2824.207) (-2813.340) [-2820.481] -- 0:06:09
292000 -- (-2818.413) (-2812.960) [-2815.731] (-2817.382) * (-2812.423) [-2813.109] (-2820.863) (-2816.935) -- 0:06:10
292500 -- (-2812.840) [-2810.770] (-2819.410) (-2819.573) * (-2809.512) (-2811.842) (-2823.576) [-2817.265] -- 0:06:10
293000 -- (-2816.259) (-2817.034) [-2822.104] (-2814.052) * [-2814.978] (-2808.987) (-2815.995) (-2811.251) -- 0:06:09
293500 -- (-2818.260) (-2826.546) (-2819.073) [-2819.476] * (-2818.853) (-2823.613) [-2814.530] (-2815.786) -- 0:06:08
294000 -- (-2811.339) (-2825.286) [-2811.522] (-2815.472) * (-2825.899) (-2818.365) [-2817.887] (-2817.963) -- 0:06:09
294500 -- (-2816.594) (-2812.516) [-2815.937] (-2821.320) * [-2809.096] (-2824.779) (-2818.182) (-2822.707) -- 0:06:08
295000 -- (-2815.714) [-2815.644] (-2812.495) (-2824.354) * (-2818.883) [-2816.129] (-2821.603) (-2818.609) -- 0:06:08
Average standard deviation of split frequencies: 0.006016
295500 -- (-2832.212) [-2820.245] (-2817.257) (-2822.636) * (-2825.530) (-2826.580) (-2819.787) [-2809.328] -- 0:06:07
296000 -- (-2816.047) (-2816.120) [-2808.244] (-2824.140) * [-2817.973] (-2814.977) (-2817.052) (-2813.303) -- 0:06:08
296500 -- (-2823.335) (-2817.758) [-2805.511] (-2816.180) * (-2821.134) [-2815.229] (-2821.787) (-2828.994) -- 0:06:07
297000 -- (-2821.526) (-2817.746) (-2810.536) [-2816.409] * (-2812.460) (-2816.431) [-2817.256] (-2818.496) -- 0:06:06
297500 -- [-2814.788] (-2811.805) (-2823.375) (-2818.632) * (-2819.496) (-2824.501) (-2816.433) [-2814.512] -- 0:06:06
298000 -- (-2806.155) [-2812.685] (-2829.341) (-2816.397) * (-2816.236) (-2816.668) (-2820.549) [-2816.369] -- 0:06:07
298500 -- (-2811.109) [-2810.893] (-2818.893) (-2832.283) * [-2816.789] (-2814.720) (-2813.650) (-2826.874) -- 0:06:06
299000 -- (-2828.700) (-2809.377) (-2819.911) [-2823.459] * (-2821.497) [-2817.223] (-2818.445) (-2815.288) -- 0:06:05
299500 -- [-2814.542] (-2821.723) (-2824.032) (-2818.172) * [-2815.956] (-2819.424) (-2813.408) (-2822.738) -- 0:06:04
300000 -- (-2814.194) [-2815.007] (-2824.330) (-2818.683) * (-2816.649) (-2826.766) [-2816.477] (-2816.049) -- 0:06:06
Average standard deviation of split frequencies: 0.007491
300500 -- [-2819.810] (-2815.777) (-2813.216) (-2821.468) * (-2817.991) (-2813.901) (-2819.861) [-2813.780] -- 0:06:05
301000 -- (-2815.550) (-2817.757) (-2815.915) [-2808.535] * (-2818.300) (-2814.503) [-2820.599] (-2812.340) -- 0:06:04
301500 -- (-2819.203) (-2809.999) (-2818.421) [-2817.501] * (-2815.376) (-2817.249) (-2821.396) [-2818.259] -- 0:06:03
302000 -- (-2818.336) (-2825.041) (-2821.917) [-2813.851] * [-2809.345] (-2813.506) (-2809.009) (-2817.517) -- 0:06:05
302500 -- (-2811.838) (-2828.192) [-2814.284] (-2816.262) * [-2806.554] (-2822.406) (-2822.244) (-2817.101) -- 0:06:04
303000 -- (-2827.677) (-2823.764) [-2811.458] (-2820.040) * [-2816.034] (-2813.658) (-2814.093) (-2829.591) -- 0:06:03
303500 -- (-2816.395) (-2828.159) [-2816.132] (-2819.466) * [-2817.803] (-2817.851) (-2819.901) (-2828.318) -- 0:06:04
304000 -- (-2811.325) (-2817.640) (-2813.440) [-2814.257] * [-2819.762] (-2818.645) (-2826.634) (-2818.907) -- 0:06:04
304500 -- (-2827.323) (-2822.912) (-2812.531) [-2806.521] * (-2822.342) (-2818.262) [-2812.557] (-2815.589) -- 0:06:03
305000 -- (-2829.296) (-2819.323) [-2809.385] (-2808.070) * (-2814.571) [-2816.044] (-2819.922) (-2824.252) -- 0:06:02
Average standard deviation of split frequencies: 0.007360
305500 -- (-2825.447) (-2818.796) [-2821.388] (-2810.130) * (-2817.660) (-2831.967) [-2807.719] (-2816.952) -- 0:06:03
306000 -- (-2809.561) (-2811.044) [-2823.947] (-2815.052) * [-2816.728] (-2824.638) (-2819.946) (-2823.170) -- 0:06:02
306500 -- (-2815.580) (-2823.926) [-2814.625] (-2821.069) * [-2815.127] (-2815.632) (-2815.332) (-2818.020) -- 0:06:02
307000 -- (-2819.757) (-2817.096) [-2813.129] (-2816.707) * (-2816.262) (-2817.939) [-2816.996] (-2822.948) -- 0:06:01
307500 -- [-2817.168] (-2810.353) (-2820.803) (-2813.971) * (-2821.251) (-2823.361) [-2813.444] (-2812.307) -- 0:06:02
308000 -- (-2826.484) (-2810.084) [-2812.858] (-2815.326) * (-2816.362) (-2828.436) (-2821.321) [-2810.285] -- 0:06:01
308500 -- [-2814.111] (-2817.377) (-2817.373) (-2817.353) * (-2815.790) [-2820.177] (-2811.984) (-2813.459) -- 0:06:00
309000 -- (-2811.735) (-2808.968) (-2822.721) [-2817.204] * [-2816.175] (-2824.122) (-2812.371) (-2821.613) -- 0:06:00
309500 -- (-2815.022) [-2810.226] (-2811.215) (-2824.632) * [-2808.337] (-2812.468) (-2822.597) (-2817.737) -- 0:06:01
310000 -- [-2809.372] (-2819.246) (-2817.058) (-2824.229) * (-2820.045) [-2819.384] (-2812.142) (-2811.471) -- 0:06:00
Average standard deviation of split frequencies: 0.006407
310500 -- (-2814.884) (-2809.492) (-2808.109) [-2811.731] * (-2810.689) (-2818.642) [-2815.613] (-2814.219) -- 0:05:59
311000 -- (-2824.242) (-2811.216) [-2815.064] (-2813.268) * [-2813.458] (-2815.097) (-2813.445) (-2816.980) -- 0:05:58
311500 -- (-2822.357) [-2806.314] (-2808.707) (-2813.550) * (-2818.734) [-2812.026] (-2813.532) (-2816.224) -- 0:06:00
312000 -- [-2812.821] (-2821.498) (-2811.285) (-2818.283) * (-2814.691) [-2814.487] (-2832.404) (-2814.732) -- 0:05:59
312500 -- (-2822.801) (-2825.741) (-2818.522) [-2820.593] * (-2811.271) (-2816.049) [-2813.227] (-2818.192) -- 0:05:58
313000 -- (-2832.326) (-2817.900) (-2821.351) [-2822.128] * (-2817.576) (-2817.036) (-2820.585) [-2812.078] -- 0:05:57
313500 -- (-2810.406) [-2821.780] (-2832.367) (-2825.919) * (-2826.831) (-2818.410) [-2812.893] (-2810.676) -- 0:05:59
314000 -- (-2815.502) [-2815.674] (-2824.439) (-2818.525) * (-2821.543) (-2813.874) [-2818.657] (-2810.867) -- 0:05:58
314500 -- [-2810.132] (-2815.696) (-2816.028) (-2817.069) * [-2819.041] (-2830.337) (-2816.613) (-2819.519) -- 0:05:57
315000 -- (-2816.872) (-2812.618) [-2816.819] (-2811.450) * (-2814.332) (-2819.216) [-2815.887] (-2827.604) -- 0:05:56
Average standard deviation of split frequencies: 0.007293
315500 -- (-2827.704) (-2823.961) [-2816.006] (-2822.513) * (-2809.515) [-2810.293] (-2816.788) (-2814.642) -- 0:05:57
316000 -- (-2824.808) (-2824.193) [-2818.753] (-2816.949) * [-2822.485] (-2820.033) (-2822.035) (-2816.875) -- 0:05:57
316500 -- (-2819.068) (-2829.283) (-2809.853) [-2818.151] * (-2811.750) (-2814.010) [-2819.489] (-2815.289) -- 0:05:56
317000 -- (-2819.961) (-2816.340) [-2815.134] (-2813.334) * (-2815.711) [-2816.949] (-2821.004) (-2819.363) -- 0:05:55
317500 -- [-2808.772] (-2816.770) (-2821.064) (-2815.195) * (-2815.256) (-2817.337) [-2816.097] (-2814.794) -- 0:05:56
318000 -- (-2824.168) [-2807.340] (-2815.078) (-2813.959) * (-2815.570) (-2815.287) [-2811.669] (-2816.182) -- 0:05:56
318500 -- [-2808.005] (-2808.114) (-2827.825) (-2819.390) * (-2811.001) [-2819.101] (-2818.058) (-2816.978) -- 0:05:55
319000 -- (-2814.497) (-2820.456) (-2820.845) [-2813.881] * (-2815.093) (-2815.991) [-2819.408] (-2812.274) -- 0:05:54
319500 -- (-2813.660) [-2812.847] (-2822.607) (-2823.653) * (-2819.949) (-2815.921) (-2822.232) [-2817.981] -- 0:05:55
320000 -- (-2813.223) (-2824.247) [-2813.839] (-2817.203) * [-2810.185] (-2811.826) (-2811.864) (-2816.095) -- 0:05:54
Average standard deviation of split frequencies: 0.005880
320500 -- (-2811.352) (-2816.369) [-2816.147] (-2815.432) * (-2812.168) (-2822.448) (-2815.332) [-2822.481] -- 0:05:54
321000 -- (-2816.370) (-2818.775) [-2811.624] (-2813.644) * (-2817.750) (-2810.858) [-2809.485] (-2813.371) -- 0:05:55
321500 -- (-2819.765) (-2812.591) [-2819.191] (-2816.261) * [-2812.604] (-2815.972) (-2812.488) (-2810.361) -- 0:05:54
322000 -- (-2820.981) [-2819.903] (-2809.397) (-2810.685) * (-2821.093) (-2826.642) (-2814.394) [-2814.544] -- 0:05:53
322500 -- (-2819.568) [-2817.858] (-2817.657) (-2827.978) * [-2811.554] (-2818.640) (-2816.245) (-2816.994) -- 0:05:52
323000 -- [-2811.251] (-2814.703) (-2821.109) (-2822.203) * (-2824.829) [-2814.379] (-2817.121) (-2817.421) -- 0:05:54
323500 -- (-2809.161) [-2816.364] (-2814.050) (-2822.391) * [-2820.451] (-2820.164) (-2817.464) (-2818.582) -- 0:05:53
324000 -- [-2823.895] (-2820.026) (-2815.689) (-2812.581) * (-2817.926) (-2809.398) [-2813.826] (-2814.343) -- 0:05:52
324500 -- (-2831.810) (-2817.783) (-2822.922) [-2818.935] * [-2816.182] (-2811.380) (-2830.372) (-2821.064) -- 0:05:51
325000 -- (-2825.954) [-2809.205] (-2818.079) (-2818.151) * [-2816.423] (-2810.525) (-2818.658) (-2814.563) -- 0:05:53
Average standard deviation of split frequencies: 0.006427
325500 -- (-2829.319) [-2814.160] (-2824.016) (-2810.295) * [-2814.762] (-2812.766) (-2810.980) (-2813.474) -- 0:05:52
326000 -- (-2809.908) [-2812.817] (-2809.406) (-2816.899) * (-2813.144) (-2816.194) (-2810.288) [-2820.587] -- 0:05:51
326500 -- (-2814.582) (-2813.340) (-2813.357) [-2816.893] * (-2830.387) [-2811.278] (-2816.505) (-2818.349) -- 0:05:50
327000 -- (-2816.529) (-2811.711) [-2811.729] (-2822.913) * [-2815.695] (-2827.534) (-2819.046) (-2815.976) -- 0:05:51
327500 -- (-2819.582) [-2812.210] (-2818.852) (-2817.199) * (-2819.312) (-2822.807) [-2818.381] (-2812.778) -- 0:05:51
328000 -- (-2817.856) [-2813.438] (-2813.295) (-2807.567) * (-2818.170) (-2818.451) [-2818.658] (-2817.918) -- 0:05:50
328500 -- (-2822.279) (-2816.841) (-2813.359) [-2818.237] * (-2818.801) (-2811.652) [-2817.561] (-2819.826) -- 0:05:49
329000 -- (-2830.780) [-2817.743] (-2823.451) (-2816.500) * (-2815.840) (-2808.060) [-2816.798] (-2815.547) -- 0:05:50
329500 -- (-2817.847) [-2816.861] (-2821.906) (-2814.071) * [-2811.190] (-2812.416) (-2811.703) (-2815.401) -- 0:05:50
330000 -- (-2819.792) (-2817.798) (-2817.655) [-2808.756] * (-2808.783) (-2819.787) [-2816.533] (-2815.744) -- 0:05:49
Average standard deviation of split frequencies: 0.006811
330500 -- (-2822.997) (-2811.672) [-2821.366] (-2821.595) * (-2823.131) (-2814.801) [-2815.136] (-2813.443) -- 0:05:48
331000 -- (-2818.314) (-2813.773) [-2817.845] (-2815.879) * (-2816.966) (-2817.375) (-2808.808) [-2818.241] -- 0:05:49
331500 -- (-2814.682) (-2821.528) (-2813.851) [-2813.877] * [-2811.933] (-2820.799) (-2819.488) (-2816.686) -- 0:05:48
332000 -- (-2812.200) (-2821.503) (-2812.949) [-2822.820] * (-2815.736) (-2815.664) (-2824.144) [-2816.889] -- 0:05:48
332500 -- (-2819.200) (-2813.074) [-2812.639] (-2827.176) * [-2809.376] (-2818.976) (-2820.432) (-2818.382) -- 0:05:47
333000 -- (-2824.410) (-2814.169) (-2815.855) [-2825.109] * (-2815.390) (-2813.379) (-2814.917) [-2813.816] -- 0:05:48
333500 -- (-2828.249) (-2826.670) [-2810.662] (-2820.794) * (-2814.846) (-2812.904) [-2817.940] (-2817.181) -- 0:05:47
334000 -- [-2813.579] (-2829.465) (-2812.290) (-2823.739) * [-2814.662] (-2811.646) (-2821.015) (-2817.834) -- 0:05:46
334500 -- [-2815.311] (-2815.736) (-2818.920) (-2823.169) * (-2818.911) [-2812.032] (-2815.831) (-2826.755) -- 0:05:46
335000 -- [-2812.397] (-2827.034) (-2816.146) (-2820.028) * [-2813.514] (-2809.587) (-2809.205) (-2839.261) -- 0:05:47
Average standard deviation of split frequencies: 0.006391
335500 -- [-2818.420] (-2825.168) (-2823.633) (-2820.783) * (-2821.682) (-2821.479) (-2825.510) [-2817.553] -- 0:05:46
336000 -- (-2822.402) (-2820.858) [-2821.410] (-2821.561) * [-2820.146] (-2817.829) (-2817.893) (-2812.177) -- 0:05:45
336500 -- [-2818.769] (-2816.009) (-2816.517) (-2821.893) * [-2819.514] (-2814.333) (-2813.050) (-2816.718) -- 0:05:45
337000 -- (-2816.187) (-2816.325) (-2819.375) [-2820.530] * (-2811.061) (-2821.434) (-2809.504) [-2816.021] -- 0:05:46
337500 -- (-2816.402) [-2807.580] (-2813.963) (-2817.134) * [-2808.285] (-2817.711) (-2818.253) (-2821.448) -- 0:05:45
338000 -- (-2826.325) (-2818.795) [-2811.011] (-2819.610) * (-2815.212) (-2813.302) (-2820.169) [-2810.450] -- 0:05:44
338500 -- (-2816.570) [-2819.375] (-2819.011) (-2818.992) * (-2816.177) (-2811.204) (-2811.861) [-2812.843] -- 0:05:43
339000 -- [-2816.001] (-2822.216) (-2823.933) (-2829.128) * (-2813.849) (-2821.278) (-2817.082) [-2809.636] -- 0:05:45
339500 -- [-2817.705] (-2817.381) (-2812.389) (-2822.964) * (-2817.215) (-2813.100) [-2809.794] (-2816.661) -- 0:05:44
340000 -- (-2818.491) [-2817.358] (-2813.990) (-2820.211) * (-2823.206) (-2817.614) [-2814.117] (-2815.062) -- 0:05:43
Average standard deviation of split frequencies: 0.005535
340500 -- (-2816.964) [-2823.015] (-2812.676) (-2835.587) * (-2812.750) [-2818.633] (-2818.738) (-2816.062) -- 0:05:44
341000 -- (-2813.355) [-2816.155] (-2811.871) (-2831.476) * (-2817.854) [-2813.776] (-2814.528) (-2818.059) -- 0:05:43
341500 -- [-2813.893] (-2818.119) (-2818.626) (-2821.179) * (-2815.085) [-2810.949] (-2812.795) (-2821.467) -- 0:05:43
342000 -- (-2815.419) [-2814.021] (-2815.004) (-2816.644) * (-2818.898) [-2810.513] (-2822.498) (-2806.727) -- 0:05:42
342500 -- (-2817.161) (-2816.478) (-2813.391) [-2818.696] * (-2820.216) [-2809.513] (-2817.622) (-2818.165) -- 0:05:43
343000 -- (-2819.452) (-2811.592) [-2806.084] (-2824.422) * (-2816.235) (-2821.942) (-2823.520) [-2821.561] -- 0:05:42
343500 -- (-2818.686) (-2810.692) [-2820.773] (-2826.930) * (-2822.616) (-2818.532) (-2833.797) [-2822.021] -- 0:05:42
344000 -- (-2823.123) [-2815.677] (-2818.902) (-2821.383) * (-2811.378) (-2820.313) (-2821.372) [-2811.112] -- 0:05:41
344500 -- (-2814.979) (-2816.645) (-2825.455) [-2811.277] * (-2814.601) (-2809.324) (-2824.263) [-2813.020] -- 0:05:42
345000 -- (-2812.996) (-2812.464) (-2823.764) [-2811.926] * [-2812.184] (-2816.950) (-2812.957) (-2819.973) -- 0:05:41
Average standard deviation of split frequencies: 0.004996
345500 -- (-2815.235) (-2811.602) [-2817.608] (-2819.288) * [-2817.131] (-2815.034) (-2819.006) (-2811.054) -- 0:05:40
346000 -- [-2815.131] (-2816.860) (-2819.826) (-2822.787) * (-2819.497) [-2820.039] (-2826.233) (-2817.576) -- 0:05:40
346500 -- (-2810.479) (-2814.458) (-2825.527) [-2813.680] * [-2816.124] (-2815.617) (-2824.150) (-2828.386) -- 0:05:41
347000 -- (-2809.996) [-2812.409] (-2817.801) (-2818.748) * [-2810.497] (-2814.868) (-2820.737) (-2828.161) -- 0:05:40
347500 -- [-2813.653] (-2821.597) (-2808.962) (-2820.623) * (-2825.391) [-2810.105] (-2816.906) (-2815.031) -- 0:05:39
348000 -- [-2813.136] (-2815.203) (-2819.658) (-2820.008) * [-2817.596] (-2815.483) (-2820.323) (-2814.735) -- 0:05:39
348500 -- (-2811.779) (-2817.801) (-2823.310) [-2823.876] * (-2822.861) [-2821.892] (-2819.705) (-2820.770) -- 0:05:40
349000 -- (-2813.641) (-2825.170) [-2820.363] (-2829.434) * [-2816.410] (-2821.233) (-2822.178) (-2812.004) -- 0:05:39
349500 -- [-2820.230] (-2805.652) (-2814.902) (-2810.613) * (-2820.967) [-2822.661] (-2826.297) (-2813.011) -- 0:05:38
350000 -- [-2813.313] (-2823.427) (-2823.867) (-2815.906) * (-2820.477) (-2815.115) (-2821.014) [-2808.769] -- 0:05:37
Average standard deviation of split frequencies: 0.003734
350500 -- (-2817.059) (-2820.027) (-2823.927) [-2814.655] * (-2818.265) (-2814.209) [-2817.633] (-2821.345) -- 0:05:39
351000 -- (-2818.101) (-2822.265) (-2813.157) [-2818.912] * (-2813.027) (-2816.604) (-2822.081) [-2819.591] -- 0:05:38
351500 -- [-2812.996] (-2818.481) (-2826.144) (-2813.266) * (-2823.747) [-2811.647] (-2818.543) (-2815.708) -- 0:05:37
352000 -- [-2812.577] (-2812.284) (-2822.047) (-2816.945) * (-2812.120) [-2817.524] (-2814.622) (-2819.726) -- 0:05:36
352500 -- (-2817.387) [-2812.379] (-2820.887) (-2822.774) * [-2822.235] (-2813.611) (-2812.898) (-2813.098) -- 0:05:37
353000 -- (-2823.143) [-2817.561] (-2812.957) (-2825.345) * (-2812.074) [-2813.859] (-2822.194) (-2811.721) -- 0:05:37
353500 -- (-2816.895) [-2813.206] (-2819.313) (-2820.843) * [-2817.339] (-2816.979) (-2812.683) (-2813.216) -- 0:05:36
354000 -- [-2807.807] (-2826.054) (-2816.934) (-2816.599) * (-2812.179) [-2810.853] (-2823.305) (-2812.131) -- 0:05:35
354500 -- [-2812.481] (-2819.114) (-2812.314) (-2815.676) * (-2825.656) (-2817.822) (-2814.480) [-2815.551] -- 0:05:36
355000 -- (-2814.865) (-2820.690) (-2816.866) [-2813.917] * [-2810.595] (-2812.747) (-2816.395) (-2821.022) -- 0:05:36
Average standard deviation of split frequencies: 0.003090
355500 -- [-2808.362] (-2813.821) (-2818.717) (-2817.612) * (-2816.522) (-2812.010) [-2812.392] (-2814.177) -- 0:05:35
356000 -- [-2809.842] (-2819.491) (-2821.479) (-2826.623) * (-2816.077) [-2815.686] (-2813.748) (-2815.962) -- 0:05:34
356500 -- (-2809.586) (-2822.317) [-2811.403] (-2814.899) * (-2816.625) (-2821.066) (-2820.353) [-2815.071] -- 0:05:35
357000 -- [-2813.399] (-2812.731) (-2810.309) (-2812.231) * (-2822.601) (-2813.700) [-2814.895] (-2826.983) -- 0:05:35
357500 -- [-2812.959] (-2814.080) (-2807.067) (-2820.096) * [-2815.020] (-2813.551) (-2823.092) (-2817.282) -- 0:05:34
358000 -- (-2815.302) (-2817.622) (-2822.053) [-2812.975] * (-2824.763) (-2815.215) [-2811.608] (-2817.072) -- 0:05:33
358500 -- [-2820.708] (-2817.721) (-2821.941) (-2822.220) * (-2809.953) [-2814.135] (-2821.346) (-2817.094) -- 0:05:34
359000 -- [-2822.666] (-2831.123) (-2820.997) (-2810.112) * (-2830.596) (-2814.366) (-2810.774) [-2811.579] -- 0:05:33
359500 -- [-2811.520] (-2832.777) (-2817.982) (-2812.003) * (-2828.535) (-2819.454) [-2816.843] (-2814.719) -- 0:05:33
360000 -- [-2813.945] (-2821.406) (-2814.687) (-2821.369) * (-2826.773) (-2806.106) [-2808.601] (-2817.620) -- 0:05:34
Average standard deviation of split frequencies: 0.003050
360500 -- [-2810.914] (-2823.263) (-2824.108) (-2823.897) * (-2817.995) (-2822.882) (-2814.960) [-2811.940] -- 0:05:33
361000 -- (-2824.750) (-2811.718) (-2816.578) [-2813.217] * (-2815.606) [-2815.733] (-2808.673) (-2827.259) -- 0:05:32
361500 -- (-2814.863) (-2812.789) (-2813.897) [-2807.092] * (-2819.292) (-2816.434) [-2812.288] (-2830.087) -- 0:05:32
362000 -- (-2818.685) (-2813.923) [-2821.930] (-2827.680) * (-2825.007) (-2809.841) [-2814.848] (-2838.413) -- 0:05:33
362500 -- (-2818.563) (-2819.537) [-2815.871] (-2819.919) * (-2822.781) (-2817.612) [-2808.852] (-2826.948) -- 0:05:32
363000 -- (-2817.267) [-2811.541] (-2815.880) (-2822.984) * (-2818.816) (-2822.206) [-2811.196] (-2813.976) -- 0:05:31
363500 -- [-2822.021] (-2812.401) (-2817.045) (-2817.838) * (-2816.105) (-2821.308) (-2817.009) [-2811.307] -- 0:05:30
364000 -- (-2824.109) [-2805.206] (-2818.448) (-2807.301) * (-2811.714) (-2824.381) (-2815.353) [-2811.880] -- 0:05:31
364500 -- (-2814.180) [-2808.841] (-2814.612) (-2815.869) * (-2811.195) (-2818.390) [-2812.410] (-2813.647) -- 0:05:31
365000 -- (-2820.588) [-2816.251] (-2819.531) (-2810.109) * (-2809.475) (-2830.327) (-2812.716) [-2813.127] -- 0:05:30
Average standard deviation of split frequencies: 0.003005
365500 -- (-2814.530) (-2818.409) (-2813.966) [-2809.442] * (-2810.809) (-2822.938) (-2820.174) [-2816.853] -- 0:05:29
366000 -- (-2821.707) (-2820.737) (-2818.808) [-2820.648] * (-2815.700) (-2818.877) (-2826.198) [-2808.438] -- 0:05:30
366500 -- [-2824.658] (-2831.945) (-2821.644) (-2817.298) * (-2814.625) (-2814.379) [-2822.199] (-2817.747) -- 0:05:30
367000 -- (-2810.432) [-2818.115] (-2825.021) (-2825.729) * (-2806.504) [-2825.317] (-2816.514) (-2815.084) -- 0:05:29
367500 -- [-2811.855] (-2814.470) (-2821.243) (-2814.228) * [-2815.118] (-2817.325) (-2811.920) (-2820.790) -- 0:05:28
368000 -- [-2811.815] (-2821.165) (-2834.688) (-2824.660) * (-2816.460) (-2813.295) [-2814.051] (-2825.536) -- 0:05:29
368500 -- [-2807.841] (-2812.156) (-2812.661) (-2817.377) * (-2812.339) (-2821.271) [-2812.279] (-2821.274) -- 0:05:29
369000 -- (-2813.083) [-2812.535] (-2821.407) (-2829.421) * (-2823.437) (-2824.265) [-2823.077] (-2808.098) -- 0:05:28
369500 -- (-2819.174) (-2817.491) [-2820.212] (-2818.714) * (-2812.988) [-2814.070] (-2813.571) (-2825.298) -- 0:05:27
370000 -- (-2815.284) (-2814.527) (-2822.021) [-2814.300] * [-2812.908] (-2821.064) (-2815.107) (-2818.204) -- 0:05:28
Average standard deviation of split frequencies: 0.003391
370500 -- (-2816.083) (-2817.565) (-2817.775) [-2816.317] * [-2820.154] (-2820.430) (-2816.108) (-2815.978) -- 0:05:27
371000 -- (-2816.616) [-2821.279] (-2820.341) (-2828.001) * (-2812.681) (-2822.203) (-2818.204) [-2815.456] -- 0:05:27
371500 -- (-2815.693) (-2817.543) (-2820.286) [-2818.799] * (-2813.789) (-2825.787) [-2819.214] (-2829.270) -- 0:05:26
372000 -- [-2815.022] (-2838.140) (-2821.030) (-2824.016) * [-2813.458] (-2818.428) (-2818.034) (-2818.461) -- 0:05:27
372500 -- (-2819.154) [-2820.216] (-2815.366) (-2820.136) * [-2809.968] (-2812.889) (-2821.723) (-2816.296) -- 0:05:26
373000 -- (-2821.596) (-2820.434) (-2819.081) [-2813.156] * (-2819.527) (-2817.260) (-2820.836) [-2810.830] -- 0:05:26
373500 -- (-2818.765) (-2819.993) [-2815.759] (-2814.179) * (-2818.523) [-2810.983] (-2811.928) (-2824.200) -- 0:05:25
374000 -- [-2812.322] (-2823.939) (-2820.806) (-2817.800) * (-2812.725) (-2824.861) [-2819.702] (-2828.650) -- 0:05:26
374500 -- (-2818.556) [-2825.286] (-2834.417) (-2820.049) * (-2812.311) (-2826.743) (-2821.938) [-2813.939] -- 0:05:25
375000 -- (-2816.381) (-2816.070) [-2813.203] (-2814.864) * [-2807.702] (-2810.381) (-2813.966) (-2822.742) -- 0:05:24
Average standard deviation of split frequencies: 0.003761
375500 -- [-2814.469] (-2822.928) (-2815.826) (-2817.994) * [-2818.486] (-2815.836) (-2812.360) (-2818.418) -- 0:05:25
376000 -- (-2818.654) (-2822.112) (-2816.199) [-2814.577] * (-2811.871) [-2815.736] (-2819.429) (-2820.187) -- 0:05:25
376500 -- (-2816.667) (-2822.348) (-2817.337) [-2818.962] * (-2816.321) [-2809.172] (-2821.832) (-2826.685) -- 0:05:24
377000 -- (-2819.143) [-2814.283] (-2824.277) (-2820.772) * (-2811.306) (-2813.711) (-2817.445) [-2820.623] -- 0:05:23
377500 -- (-2819.648) (-2826.319) (-2819.691) [-2809.976] * (-2808.798) (-2821.919) [-2816.884] (-2820.940) -- 0:05:24
378000 -- [-2811.215] (-2822.356) (-2818.599) (-2818.018) * (-2814.358) [-2815.369] (-2826.630) (-2805.892) -- 0:05:24
378500 -- (-2819.551) (-2822.588) [-2817.203] (-2815.439) * (-2813.169) (-2809.696) [-2818.879] (-2820.851) -- 0:05:23
379000 -- (-2824.834) (-2813.209) [-2819.787] (-2826.562) * (-2821.911) [-2819.277] (-2818.906) (-2812.817) -- 0:05:22
379500 -- [-2816.157] (-2822.080) (-2817.011) (-2819.950) * (-2823.782) (-2815.155) (-2820.289) [-2815.699] -- 0:05:23
380000 -- (-2808.871) (-2816.683) (-2822.218) [-2816.885] * (-2823.578) [-2821.531] (-2820.037) (-2813.082) -- 0:05:23
Average standard deviation of split frequencies: 0.004128
380500 -- [-2815.125] (-2816.489) (-2824.587) (-2813.517) * (-2826.687) [-2819.408] (-2811.897) (-2827.583) -- 0:05:22
381000 -- (-2824.683) [-2812.399] (-2812.195) (-2812.282) * (-2826.336) (-2817.247) (-2816.801) [-2817.936] -- 0:05:21
381500 -- [-2808.049] (-2829.717) (-2821.466) (-2824.181) * (-2813.888) (-2814.198) [-2821.570] (-2819.174) -- 0:05:22
382000 -- (-2810.242) [-2818.835] (-2811.901) (-2815.381) * (-2821.075) [-2810.711] (-2828.679) (-2814.631) -- 0:05:21
382500 -- (-2821.772) (-2812.116) (-2818.444) [-2811.001] * [-2817.011] (-2808.348) (-2816.478) (-2819.655) -- 0:05:21
383000 -- (-2828.486) (-2831.209) (-2816.963) [-2809.556] * (-2813.851) [-2811.665] (-2815.822) (-2817.324) -- 0:05:20
383500 -- (-2817.517) (-2825.800) [-2811.825] (-2818.045) * [-2819.102] (-2818.612) (-2816.327) (-2813.868) -- 0:05:21
384000 -- [-2812.136] (-2823.366) (-2816.097) (-2815.673) * (-2818.019) (-2817.331) [-2809.232] (-2812.417) -- 0:05:20
384500 -- (-2819.644) (-2815.727) [-2812.010] (-2814.969) * [-2818.695] (-2812.646) (-2810.389) (-2817.918) -- 0:05:20
385000 -- [-2818.867] (-2814.373) (-2829.633) (-2813.007) * (-2820.837) [-2813.179] (-2823.421) (-2823.564) -- 0:05:19
Average standard deviation of split frequencies: 0.003664
385500 -- [-2816.805] (-2816.240) (-2821.973) (-2813.643) * (-2816.141) (-2810.018) [-2817.852] (-2813.811) -- 0:05:20
386000 -- (-2812.565) (-2815.038) (-2820.660) [-2811.258] * (-2818.196) (-2815.656) (-2815.853) [-2813.056] -- 0:05:19
386500 -- (-2819.858) [-2814.240] (-2819.816) (-2826.953) * (-2818.892) [-2805.943] (-2821.634) (-2822.791) -- 0:05:19
387000 -- (-2819.961) [-2816.143] (-2809.308) (-2822.903) * (-2814.746) [-2812.678] (-2814.471) (-2811.854) -- 0:05:18
387500 -- (-2811.974) [-2810.365] (-2816.384) (-2818.769) * (-2821.526) [-2807.289] (-2810.024) (-2826.346) -- 0:05:19
388000 -- [-2813.017] (-2812.414) (-2818.806) (-2823.378) * [-2819.127] (-2817.363) (-2823.969) (-2819.484) -- 0:05:18
388500 -- (-2813.034) (-2819.045) [-2818.480] (-2834.357) * (-2820.617) (-2815.408) [-2819.483] (-2822.430) -- 0:05:17
389000 -- (-2820.967) [-2812.902] (-2825.461) (-2825.677) * (-2813.119) (-2819.114) [-2813.778] (-2818.439) -- 0:05:17
389500 -- [-2810.749] (-2822.608) (-2812.353) (-2829.194) * [-2812.911] (-2812.024) (-2821.200) (-2819.753) -- 0:05:18
390000 -- (-2813.215) (-2823.151) [-2812.489] (-2817.084) * (-2813.976) [-2812.275] (-2821.594) (-2822.129) -- 0:05:17
Average standard deviation of split frequencies: 0.003620
390500 -- (-2815.859) [-2813.592] (-2824.415) (-2824.556) * (-2813.376) [-2807.328] (-2817.683) (-2811.530) -- 0:05:16
391000 -- (-2813.763) (-2810.900) (-2816.922) [-2815.544] * [-2808.596] (-2824.121) (-2824.746) (-2808.527) -- 0:05:16
391500 -- (-2814.160) [-2817.994] (-2823.288) (-2826.545) * (-2814.212) [-2809.399] (-2821.416) (-2812.474) -- 0:05:17
392000 -- (-2816.514) (-2814.800) (-2820.234) [-2808.166] * (-2818.731) (-2808.774) (-2812.215) [-2810.624] -- 0:05:16
392500 -- (-2816.717) (-2817.568) (-2811.717) [-2813.427] * [-2811.817] (-2823.006) (-2815.057) (-2810.859) -- 0:05:15
393000 -- [-2815.731] (-2822.312) (-2820.968) (-2813.817) * [-2812.202] (-2818.752) (-2818.979) (-2811.973) -- 0:05:16
393500 -- (-2816.049) (-2815.581) (-2822.558) [-2816.272] * [-2810.517] (-2822.204) (-2825.103) (-2815.719) -- 0:05:15
394000 -- [-2816.481] (-2828.804) (-2821.981) (-2814.744) * (-2821.046) (-2817.745) [-2818.284] (-2818.809) -- 0:05:15
394500 -- (-2818.691) (-2816.908) [-2820.460] (-2815.053) * [-2815.621] (-2809.120) (-2813.782) (-2824.023) -- 0:05:14
395000 -- (-2812.982) (-2826.063) [-2818.627] (-2813.505) * (-2819.852) [-2813.809] (-2815.964) (-2818.468) -- 0:05:15
Average standard deviation of split frequencies: 0.002910
395500 -- (-2814.083) [-2816.539] (-2818.800) (-2818.237) * (-2822.332) [-2811.090] (-2817.627) (-2814.259) -- 0:05:14
396000 -- [-2818.930] (-2827.638) (-2826.434) (-2814.284) * [-2823.681] (-2812.266) (-2818.191) (-2820.957) -- 0:05:14
396500 -- (-2822.494) [-2814.087] (-2811.680) (-2813.801) * (-2814.130) [-2811.397] (-2808.731) (-2811.357) -- 0:05:13
397000 -- [-2811.175] (-2822.037) (-2815.686) (-2819.074) * (-2817.630) [-2828.490] (-2818.772) (-2821.915) -- 0:05:14
397500 -- (-2816.455) (-2810.501) (-2829.030) [-2821.568] * (-2823.019) (-2826.542) [-2812.174] (-2826.184) -- 0:05:13
398000 -- (-2832.658) (-2816.450) (-2812.547) [-2813.933] * (-2822.124) (-2823.070) (-2814.065) [-2816.305] -- 0:05:13
398500 -- (-2817.172) (-2822.212) (-2829.311) [-2815.969] * [-2812.912] (-2822.013) (-2818.502) (-2810.298) -- 0:05:12
399000 -- (-2831.243) (-2812.718) (-2823.706) [-2811.804] * (-2826.197) (-2826.005) [-2816.127] (-2822.012) -- 0:05:13
399500 -- (-2817.037) [-2812.365] (-2823.581) (-2820.706) * (-2818.091) (-2816.265) [-2819.156] (-2814.715) -- 0:05:12
400000 -- (-2811.736) (-2822.857) [-2809.784] (-2821.229) * (-2820.445) (-2819.993) [-2815.227] (-2819.626) -- 0:05:12
Average standard deviation of split frequencies: 0.002353
400500 -- (-2820.074) (-2821.769) [-2814.203] (-2814.763) * (-2813.835) [-2817.247] (-2819.170) (-2832.110) -- 0:05:11
401000 -- (-2823.130) (-2812.101) (-2821.488) [-2809.907] * (-2813.215) (-2817.817) [-2812.777] (-2820.160) -- 0:05:12
401500 -- (-2821.932) (-2820.727) [-2818.933] (-2818.446) * (-2816.902) (-2831.671) [-2818.343] (-2812.103) -- 0:05:11
402000 -- (-2826.725) (-2827.568) (-2815.285) [-2813.973] * (-2816.958) (-2820.987) [-2820.847] (-2810.092) -- 0:05:10
402500 -- [-2823.077] (-2820.690) (-2820.701) (-2821.267) * (-2811.420) [-2814.068] (-2827.105) (-2813.076) -- 0:05:10
403000 -- (-2817.055) (-2830.924) (-2817.309) [-2816.480] * (-2806.685) (-2821.950) (-2829.178) [-2812.947] -- 0:05:11
403500 -- [-2812.445] (-2815.709) (-2823.775) (-2818.076) * (-2813.349) [-2817.450] (-2826.228) (-2818.993) -- 0:05:10
404000 -- [-2811.039] (-2825.122) (-2819.671) (-2825.084) * (-2827.568) (-2818.920) [-2815.490] (-2819.174) -- 0:05:09
404500 -- (-2815.852) (-2813.245) [-2819.305] (-2828.350) * [-2810.786] (-2812.277) (-2813.816) (-2829.968) -- 0:05:09
405000 -- (-2819.335) (-2822.003) (-2812.573) [-2813.191] * (-2823.043) [-2815.899] (-2817.312) (-2813.746) -- 0:05:09
Average standard deviation of split frequencies: 0.001806
405500 -- [-2809.842] (-2827.827) (-2811.838) (-2817.326) * (-2815.037) (-2814.109) (-2818.066) [-2806.123] -- 0:05:09
406000 -- (-2814.863) (-2816.060) [-2817.046] (-2823.655) * (-2818.992) [-2811.644] (-2808.508) (-2811.013) -- 0:05:08
406500 -- (-2809.441) (-2811.417) (-2813.717) [-2815.295] * (-2824.383) (-2813.047) (-2814.869) [-2812.278] -- 0:05:08
407000 -- (-2816.782) (-2817.020) [-2812.033] (-2828.974) * (-2815.742) (-2814.650) (-2824.513) [-2813.532] -- 0:05:08
407500 -- (-2813.861) [-2813.300] (-2828.776) (-2816.418) * (-2819.703) (-2813.973) [-2812.038] (-2815.753) -- 0:05:08
408000 -- (-2823.894) [-2818.701] (-2811.450) (-2809.934) * (-2810.229) (-2808.932) [-2817.579] (-2820.532) -- 0:05:07
408500 -- (-2824.466) (-2812.680) (-2818.271) [-2811.010] * (-2814.404) (-2812.721) [-2812.482] (-2823.434) -- 0:05:06
409000 -- (-2824.713) (-2811.119) [-2814.749] (-2812.516) * (-2814.130) [-2822.350] (-2815.286) (-2822.951) -- 0:05:07
409500 -- (-2816.751) [-2817.324] (-2818.645) (-2815.099) * [-2817.510] (-2823.520) (-2824.971) (-2819.298) -- 0:05:07
410000 -- (-2815.429) (-2811.944) [-2814.677] (-2811.729) * [-2823.161] (-2815.452) (-2824.890) (-2818.979) -- 0:05:06
Average standard deviation of split frequencies: 0.002423
410500 -- (-2807.803) (-2821.858) (-2812.024) [-2811.477] * (-2823.429) [-2824.036] (-2823.495) (-2812.492) -- 0:05:07
411000 -- (-2811.295) (-2813.224) [-2813.742] (-2826.690) * (-2836.318) (-2823.452) [-2812.270] (-2818.239) -- 0:05:06
411500 -- (-2812.754) (-2817.355) [-2813.644] (-2812.083) * (-2819.979) (-2816.259) (-2808.716) [-2814.388] -- 0:05:06
412000 -- (-2825.065) [-2817.313] (-2815.971) (-2817.684) * (-2816.943) (-2817.239) (-2821.286) [-2814.948] -- 0:05:05
412500 -- [-2814.690] (-2817.018) (-2813.574) (-2817.448) * (-2817.805) [-2806.883] (-2811.571) (-2816.166) -- 0:05:06
413000 -- [-2818.140] (-2825.062) (-2822.132) (-2815.708) * (-2811.068) (-2818.698) [-2811.554] (-2815.628) -- 0:05:05
413500 -- (-2818.792) (-2821.330) (-2814.796) [-2814.470] * [-2823.477] (-2815.131) (-2825.269) (-2810.278) -- 0:05:04
414000 -- (-2817.237) [-2810.206] (-2811.744) (-2812.587) * (-2828.456) (-2818.189) (-2808.414) [-2813.887] -- 0:05:04
414500 -- [-2816.721] (-2814.665) (-2815.332) (-2813.437) * (-2820.192) (-2818.669) [-2811.899] (-2810.519) -- 0:05:05
415000 -- [-2812.669] (-2818.826) (-2817.681) (-2820.020) * [-2814.668] (-2823.567) (-2824.939) (-2825.198) -- 0:05:04
Average standard deviation of split frequencies: 0.001763
415500 -- (-2808.854) [-2822.815] (-2822.289) (-2818.551) * (-2811.697) [-2815.474] (-2815.497) (-2824.617) -- 0:05:03
416000 -- (-2817.868) (-2825.970) [-2815.956] (-2816.732) * (-2820.350) (-2813.137) (-2815.715) [-2819.023] -- 0:05:03
416500 -- [-2822.221] (-2809.902) (-2826.363) (-2831.747) * (-2819.307) [-2813.494] (-2818.818) (-2817.942) -- 0:05:04
417000 -- (-2811.896) [-2814.067] (-2812.630) (-2827.904) * [-2822.523] (-2825.515) (-2818.914) (-2815.749) -- 0:05:03
417500 -- (-2816.366) [-2811.474] (-2811.917) (-2827.058) * (-2824.732) (-2814.966) [-2816.803] (-2819.606) -- 0:05:02
418000 -- (-2814.873) (-2813.084) [-2810.703] (-2820.389) * [-2812.212] (-2815.187) (-2816.432) (-2813.866) -- 0:05:02
418500 -- (-2813.293) (-2818.683) (-2815.213) [-2815.187] * [-2816.416] (-2810.600) (-2814.394) (-2816.338) -- 0:05:02
419000 -- (-2825.840) (-2815.196) [-2806.046] (-2813.181) * (-2817.012) (-2808.773) [-2821.619] (-2815.361) -- 0:05:02
419500 -- (-2809.701) [-2816.070] (-2809.157) (-2815.440) * (-2839.504) (-2811.618) [-2808.649] (-2818.635) -- 0:05:01
420000 -- (-2814.853) [-2816.720] (-2812.188) (-2819.650) * (-2816.489) (-2815.288) (-2826.953) [-2814.031] -- 0:05:01
Average standard deviation of split frequencies: 0.002615
420500 -- (-2813.761) (-2813.315) [-2812.050] (-2825.292) * [-2816.589] (-2813.932) (-2835.537) (-2813.266) -- 0:05:01
421000 -- (-2820.946) (-2817.449) [-2810.756] (-2810.000) * (-2816.952) [-2818.273] (-2823.345) (-2818.729) -- 0:05:01
421500 -- [-2809.428] (-2812.877) (-2810.555) (-2820.549) * (-2813.725) (-2813.564) [-2813.569] (-2812.250) -- 0:05:00
422000 -- (-2811.009) (-2818.635) [-2817.830] (-2819.894) * [-2829.412] (-2814.042) (-2812.958) (-2807.066) -- 0:04:59
422500 -- [-2817.337] (-2809.800) (-2818.920) (-2818.402) * (-2818.273) [-2808.277] (-2812.286) (-2822.092) -- 0:05:00
423000 -- [-2815.872] (-2819.505) (-2820.744) (-2815.611) * (-2814.692) [-2815.491] (-2828.102) (-2818.376) -- 0:05:00
423500 -- (-2814.802) (-2812.068) (-2828.802) [-2808.381] * [-2816.831] (-2814.269) (-2827.243) (-2806.705) -- 0:04:59
424000 -- (-2816.373) (-2822.401) (-2830.495) [-2811.293] * [-2816.306] (-2812.069) (-2822.331) (-2816.456) -- 0:04:58
424500 -- (-2817.889) [-2812.628] (-2812.494) (-2814.375) * (-2808.890) [-2809.032] (-2825.152) (-2813.268) -- 0:04:59
425000 -- [-2814.745] (-2826.462) (-2815.036) (-2818.368) * (-2810.335) (-2821.314) [-2814.020] (-2817.207) -- 0:04:59
Average standard deviation of split frequencies: 0.002459
425500 -- (-2825.665) (-2816.654) [-2808.128] (-2820.806) * (-2825.188) (-2816.033) (-2809.892) [-2817.321] -- 0:04:58
426000 -- [-2812.809] (-2817.345) (-2810.708) (-2818.260) * [-2809.161] (-2819.768) (-2826.779) (-2816.996) -- 0:04:57
426500 -- (-2816.183) (-2812.487) [-2811.109] (-2814.338) * (-2811.662) [-2812.884] (-2810.027) (-2811.083) -- 0:04:58
427000 -- [-2808.944] (-2812.043) (-2821.306) (-2813.347) * [-2819.156] (-2819.129) (-2822.225) (-2816.889) -- 0:04:57
427500 -- (-2819.692) (-2814.598) (-2821.183) [-2817.560] * (-2812.099) (-2823.513) [-2809.581] (-2815.517) -- 0:04:57
428000 -- (-2817.543) (-2818.783) [-2811.582] (-2821.841) * (-2815.386) (-2812.534) (-2813.248) [-2810.461] -- 0:04:56
428500 -- (-2813.502) [-2810.602] (-2812.360) (-2823.831) * (-2826.822) (-2819.704) (-2812.985) [-2810.397] -- 0:04:57
429000 -- [-2816.113] (-2816.619) (-2809.420) (-2809.785) * (-2820.069) (-2815.006) [-2812.152] (-2814.814) -- 0:04:56
429500 -- (-2813.565) [-2809.528] (-2815.256) (-2808.459) * (-2818.307) [-2811.846] (-2815.484) (-2819.772) -- 0:04:56
430000 -- [-2813.566] (-2818.272) (-2818.979) (-2812.114) * (-2810.419) (-2819.417) (-2817.973) [-2818.857] -- 0:04:56
Average standard deviation of split frequencies: 0.002554
430500 -- (-2815.758) [-2813.231] (-2813.437) (-2824.797) * (-2818.697) (-2816.222) [-2808.483] (-2815.939) -- 0:04:56
431000 -- (-2821.575) [-2812.350] (-2815.097) (-2816.126) * (-2813.872) (-2813.523) [-2816.589] (-2818.192) -- 0:04:55
431500 -- [-2814.781] (-2821.469) (-2820.358) (-2818.128) * (-2815.489) (-2819.937) (-2820.165) [-2821.116] -- 0:04:55
432000 -- [-2819.222] (-2811.337) (-2815.567) (-2816.097) * (-2817.119) (-2810.999) (-2817.222) [-2812.780] -- 0:04:55
432500 -- (-2815.356) (-2815.620) (-2815.925) [-2816.854] * (-2815.431) (-2822.325) [-2817.423] (-2818.499) -- 0:04:55
433000 -- (-2821.206) [-2817.350] (-2814.088) (-2810.598) * (-2811.209) [-2812.913] (-2819.454) (-2818.569) -- 0:04:54
433500 -- (-2833.880) (-2819.940) [-2812.099] (-2811.403) * (-2816.764) [-2815.906] (-2816.124) (-2826.741) -- 0:04:54
434000 -- [-2815.968] (-2813.724) (-2818.018) (-2810.600) * [-2814.134] (-2823.288) (-2822.512) (-2812.912) -- 0:04:54
434500 -- (-2824.391) (-2808.471) [-2816.062] (-2815.337) * (-2813.482) (-2819.719) [-2819.542] (-2815.428) -- 0:04:54
435000 -- (-2828.909) (-2814.766) (-2816.536) [-2814.879] * [-2809.153] (-2827.213) (-2811.204) (-2816.838) -- 0:04:53
Average standard deviation of split frequencies: 0.002883
435500 -- (-2815.416) (-2820.138) [-2813.188] (-2824.515) * (-2813.188) (-2823.460) [-2812.594] (-2815.331) -- 0:04:52
436000 -- [-2816.147] (-2820.772) (-2812.931) (-2816.723) * (-2813.785) (-2822.577) (-2816.054) [-2812.355] -- 0:04:53
436500 -- (-2813.249) (-2817.683) [-2809.551] (-2826.809) * [-2813.206] (-2818.599) (-2813.591) (-2820.378) -- 0:04:53
437000 -- (-2821.601) (-2818.424) (-2816.428) [-2817.028] * (-2814.851) [-2818.919] (-2822.270) (-2811.128) -- 0:04:52
437500 -- (-2814.388) (-2823.004) (-2824.503) [-2810.817] * (-2811.646) (-2819.023) [-2810.163] (-2817.196) -- 0:04:51
438000 -- (-2825.678) (-2816.841) (-2822.990) [-2817.650] * (-2821.124) [-2818.913] (-2817.772) (-2827.914) -- 0:04:52
438500 -- (-2821.410) (-2812.962) (-2814.410) [-2810.111] * (-2822.854) [-2813.111] (-2814.218) (-2813.200) -- 0:04:51
439000 -- [-2815.135] (-2814.516) (-2815.828) (-2809.405) * (-2815.582) [-2816.223] (-2820.406) (-2817.966) -- 0:04:51
439500 -- (-2817.770) (-2811.996) [-2812.360] (-2817.157) * (-2820.381) (-2821.811) [-2814.271] (-2809.061) -- 0:04:50
440000 -- (-2815.143) [-2811.904] (-2823.783) (-2815.142) * (-2820.054) [-2818.421] (-2820.910) (-2813.621) -- 0:04:51
Average standard deviation of split frequencies: 0.002140
440500 -- (-2813.131) (-2808.939) [-2811.256] (-2816.234) * (-2821.178) (-2816.514) (-2820.245) [-2811.565] -- 0:04:50
441000 -- [-2810.443] (-2816.451) (-2813.602) (-2832.708) * [-2813.697] (-2828.482) (-2811.736) (-2810.719) -- 0:04:50
441500 -- (-2817.638) (-2819.544) (-2809.698) [-2812.971] * (-2814.791) (-2829.571) [-2812.371] (-2817.315) -- 0:04:49
442000 -- (-2824.660) [-2809.335] (-2819.085) (-2816.007) * (-2823.654) (-2815.119) (-2827.698) [-2810.384] -- 0:04:50
442500 -- [-2819.271] (-2816.677) (-2819.646) (-2811.934) * [-2814.874] (-2811.622) (-2817.158) (-2818.976) -- 0:04:49
443000 -- (-2815.331) [-2815.049] (-2814.242) (-2825.175) * (-2812.510) [-2815.232] (-2818.688) (-2819.727) -- 0:04:49
443500 -- (-2821.978) (-2813.564) (-2823.587) [-2823.440] * (-2819.947) (-2823.771) [-2812.296] (-2813.227) -- 0:04:48
444000 -- [-2817.922] (-2821.369) (-2814.102) (-2819.000) * (-2813.418) [-2809.603] (-2809.471) (-2806.513) -- 0:04:49
444500 -- [-2806.960] (-2818.838) (-2813.122) (-2815.444) * (-2820.168) (-2823.437) [-2817.443] (-2815.802) -- 0:04:48
445000 -- [-2808.794] (-2818.407) (-2813.816) (-2819.782) * (-2822.848) (-2813.678) (-2827.027) [-2816.379] -- 0:04:48
Average standard deviation of split frequencies: 0.002114
445500 -- (-2816.827) [-2816.132] (-2824.283) (-2816.032) * (-2825.240) (-2813.894) [-2817.630] (-2812.683) -- 0:04:47
446000 -- (-2809.910) (-2820.566) (-2824.481) [-2813.075] * (-2813.036) (-2817.993) [-2812.773] (-2817.007) -- 0:04:48
446500 -- (-2810.221) [-2807.420] (-2820.929) (-2819.275) * (-2819.201) (-2815.460) [-2812.848] (-2821.283) -- 0:04:47
447000 -- (-2818.348) (-2812.194) (-2825.615) [-2816.732] * (-2823.615) (-2817.275) (-2818.154) [-2810.146] -- 0:04:47
447500 -- [-2823.946] (-2816.631) (-2817.271) (-2814.799) * (-2819.018) (-2816.923) (-2817.675) [-2816.483] -- 0:04:47
448000 -- (-2815.371) (-2812.477) [-2815.593] (-2812.687) * (-2818.866) (-2811.928) (-2828.531) [-2821.111] -- 0:04:47
448500 -- [-2813.308] (-2811.515) (-2823.248) (-2827.930) * (-2834.952) [-2819.613] (-2823.464) (-2817.063) -- 0:04:46
449000 -- (-2814.630) (-2816.242) (-2820.068) [-2810.618] * (-2834.315) [-2815.832] (-2822.228) (-2816.778) -- 0:04:45
449500 -- [-2812.263] (-2812.159) (-2826.586) (-2830.698) * (-2818.981) (-2818.885) (-2820.465) [-2818.292] -- 0:04:46
450000 -- [-2820.848] (-2816.155) (-2816.382) (-2826.154) * (-2816.344) (-2815.977) [-2808.279] (-2824.740) -- 0:04:46
Average standard deviation of split frequencies: 0.002557
450500 -- (-2829.437) (-2816.422) (-2818.293) [-2813.565] * (-2810.802) (-2819.995) [-2814.004] (-2813.119) -- 0:04:45
451000 -- (-2811.381) [-2815.758] (-2817.710) (-2816.867) * [-2819.406] (-2815.908) (-2813.986) (-2808.720) -- 0:04:44
451500 -- (-2813.361) [-2815.617] (-2822.068) (-2816.525) * (-2814.819) (-2819.081) [-2810.682] (-2829.638) -- 0:04:45
452000 -- (-2820.337) [-2810.825] (-2818.739) (-2827.401) * (-2820.832) (-2811.329) [-2809.620] (-2815.836) -- 0:04:44
452500 -- (-2815.763) (-2821.893) (-2813.546) [-2814.027] * (-2820.101) (-2822.281) (-2823.603) [-2824.679] -- 0:04:44
453000 -- (-2817.535) (-2815.647) (-2820.271) [-2813.366] * (-2813.492) (-2816.042) (-2817.839) [-2825.776] -- 0:04:43
453500 -- (-2817.208) (-2820.769) [-2816.196] (-2822.035) * (-2819.421) (-2820.435) (-2822.763) [-2826.697] -- 0:04:44
454000 -- [-2818.616] (-2815.062) (-2820.625) (-2823.212) * [-2810.087] (-2830.834) (-2815.484) (-2818.644) -- 0:04:43
454500 -- (-2822.794) (-2819.567) [-2809.209] (-2812.462) * (-2818.088) (-2810.048) [-2825.711] (-2821.724) -- 0:04:43
455000 -- (-2814.005) (-2828.545) (-2822.353) [-2811.614] * [-2812.387] (-2814.555) (-2833.153) (-2820.348) -- 0:04:42
Average standard deviation of split frequencies: 0.002182
455500 -- [-2821.787] (-2821.147) (-2813.202) (-2810.592) * (-2820.254) (-2816.657) (-2821.833) [-2825.485] -- 0:04:43
456000 -- (-2810.967) (-2827.710) [-2825.656] (-2810.445) * (-2813.201) (-2815.389) (-2821.765) [-2812.656] -- 0:04:42
456500 -- (-2815.535) (-2813.765) [-2816.123] (-2814.930) * [-2815.008] (-2820.312) (-2810.464) (-2818.217) -- 0:04:42
457000 -- (-2810.978) (-2814.373) (-2818.486) [-2818.231] * (-2820.853) (-2825.966) [-2813.120] (-2817.601) -- 0:04:41
457500 -- (-2814.455) (-2820.599) (-2813.284) [-2811.683] * (-2816.824) [-2811.310] (-2812.234) (-2822.379) -- 0:04:42
458000 -- (-2813.200) (-2819.919) (-2813.810) [-2809.185] * (-2819.118) [-2813.036] (-2824.077) (-2832.604) -- 0:04:41
458500 -- [-2810.377] (-2809.545) (-2819.964) (-2813.180) * (-2817.780) (-2822.154) [-2816.867] (-2821.075) -- 0:04:41
459000 -- (-2817.682) (-2812.226) (-2819.096) [-2816.589] * [-2808.468] (-2827.902) (-2823.626) (-2818.561) -- 0:04:40
459500 -- (-2821.802) (-2815.909) [-2817.487] (-2819.878) * (-2817.828) (-2819.981) (-2822.497) [-2812.271] -- 0:04:41
460000 -- [-2817.085] (-2816.568) (-2817.958) (-2808.615) * [-2812.580] (-2822.667) (-2826.775) (-2822.053) -- 0:04:40
Average standard deviation of split frequencies: 0.001933
460500 -- (-2816.307) [-2812.261] (-2819.212) (-2828.040) * (-2815.253) [-2820.679] (-2830.473) (-2823.634) -- 0:04:40
461000 -- (-2820.317) (-2820.043) [-2817.969] (-2820.715) * [-2820.627] (-2819.803) (-2819.535) (-2819.435) -- 0:04:39
461500 -- [-2817.056] (-2816.773) (-2828.918) (-2819.424) * (-2822.078) (-2820.810) [-2820.014] (-2831.206) -- 0:04:40
462000 -- (-2816.659) [-2812.092] (-2822.172) (-2812.062) * (-2810.108) (-2822.633) (-2825.889) [-2815.640] -- 0:04:39
462500 -- [-2815.765] (-2816.588) (-2812.873) (-2825.774) * (-2814.934) (-2826.482) (-2818.311) [-2814.100] -- 0:04:38
463000 -- (-2819.215) (-2809.777) [-2816.338] (-2813.132) * [-2809.513] (-2816.952) (-2811.730) (-2819.686) -- 0:04:38
463500 -- (-2827.033) (-2821.812) [-2818.895] (-2822.742) * [-2814.263] (-2816.828) (-2817.420) (-2819.289) -- 0:04:38
464000 -- (-2812.345) (-2817.168) [-2811.387] (-2827.662) * (-2813.800) [-2819.979] (-2813.199) (-2819.379) -- 0:04:38
464500 -- [-2818.390] (-2814.984) (-2818.429) (-2821.235) * [-2817.118] (-2809.605) (-2819.309) (-2819.431) -- 0:04:37
465000 -- (-2818.281) [-2813.556] (-2825.681) (-2815.148) * (-2816.283) (-2818.827) [-2815.182] (-2819.461) -- 0:04:38
Average standard deviation of split frequencies: 0.002360
465500 -- (-2822.886) (-2816.636) [-2816.179] (-2812.502) * (-2815.621) (-2817.204) [-2811.226] (-2812.211) -- 0:04:37
466000 -- [-2813.347] (-2818.612) (-2826.258) (-2824.184) * [-2810.795] (-2829.459) (-2810.151) (-2813.986) -- 0:04:37
466500 -- (-2816.159) [-2812.352] (-2813.267) (-2815.231) * (-2818.819) (-2821.103) [-2809.123] (-2824.576) -- 0:04:36
467000 -- (-2823.042) (-2814.861) (-2815.118) [-2828.993] * [-2813.154] (-2820.257) (-2831.345) (-2817.431) -- 0:04:37
467500 -- (-2816.493) [-2813.216] (-2815.164) (-2816.556) * (-2820.457) (-2829.510) [-2816.381] (-2816.003) -- 0:04:36
468000 -- (-2815.740) (-2810.289) [-2809.664] (-2822.462) * (-2815.080) [-2818.850] (-2818.329) (-2818.172) -- 0:04:36
468500 -- (-2808.825) (-2822.826) (-2822.055) [-2807.085] * (-2813.212) (-2816.572) (-2817.754) [-2813.519] -- 0:04:35
469000 -- (-2812.597) (-2824.847) [-2809.113] (-2827.602) * (-2812.108) (-2816.971) [-2818.614] (-2816.128) -- 0:04:36
469500 -- [-2816.956] (-2818.681) (-2820.010) (-2818.846) * (-2810.110) (-2817.026) (-2818.429) [-2821.578] -- 0:04:35
470000 -- [-2815.806] (-2815.276) (-2822.332) (-2822.576) * (-2815.157) [-2818.769] (-2829.024) (-2810.632) -- 0:04:35
Average standard deviation of split frequencies: 0.002337
470500 -- (-2822.025) [-2815.644] (-2819.196) (-2816.913) * [-2817.312] (-2818.900) (-2822.793) (-2819.555) -- 0:04:34
471000 -- (-2811.387) (-2812.941) (-2822.301) [-2810.435] * (-2815.899) (-2818.815) (-2818.296) [-2821.361] -- 0:04:35
471500 -- (-2812.790) (-2813.516) [-2825.495] (-2816.278) * [-2826.811] (-2813.850) (-2819.150) (-2827.178) -- 0:04:34
472000 -- (-2818.793) (-2817.993) [-2811.626] (-2812.913) * (-2819.787) (-2812.890) (-2822.909) [-2815.099] -- 0:04:34
472500 -- (-2811.727) [-2815.853] (-2813.657) (-2815.043) * [-2815.234] (-2823.947) (-2825.978) (-2815.636) -- 0:04:33
473000 -- (-2813.766) [-2813.019] (-2813.246) (-2817.290) * [-2817.396] (-2820.425) (-2826.575) (-2821.025) -- 0:04:34
473500 -- (-2812.659) [-2812.584] (-2823.699) (-2813.246) * (-2820.574) (-2824.382) (-2817.372) [-2820.036] -- 0:04:33
474000 -- (-2825.030) (-2816.166) (-2818.163) [-2814.665] * (-2817.435) (-2813.972) (-2824.290) [-2822.864] -- 0:04:32
474500 -- (-2818.846) [-2816.496] (-2815.312) (-2816.725) * (-2811.881) (-2828.229) (-2818.275) [-2813.341] -- 0:04:32
475000 -- (-2816.433) [-2812.036] (-2820.066) (-2813.318) * (-2817.063) (-2820.437) [-2820.424] (-2814.103) -- 0:04:33
Average standard deviation of split frequencies: 0.002311
475500 -- (-2826.960) (-2809.846) (-2820.368) [-2816.305] * (-2816.065) (-2819.790) [-2815.095] (-2815.813) -- 0:04:32
476000 -- (-2825.293) (-2813.540) [-2824.183] (-2818.662) * (-2813.191) (-2817.991) (-2816.010) [-2820.412] -- 0:04:31
476500 -- (-2812.123) (-2815.260) (-2818.411) [-2813.622] * (-2823.754) [-2809.802] (-2811.977) (-2808.283) -- 0:04:31
477000 -- (-2820.962) (-2825.445) (-2816.151) [-2821.526] * (-2816.530) (-2817.936) [-2810.445] (-2816.516) -- 0:04:31
477500 -- (-2812.838) [-2818.001] (-2813.928) (-2811.940) * (-2819.602) (-2819.458) (-2819.634) [-2815.930] -- 0:04:31
478000 -- (-2820.661) (-2814.840) [-2812.946] (-2816.635) * (-2809.014) (-2827.462) (-2818.746) [-2818.761] -- 0:04:30
478500 -- (-2814.546) (-2823.691) [-2819.309] (-2833.403) * [-2815.598] (-2809.303) (-2819.597) (-2825.146) -- 0:04:30
479000 -- (-2811.718) [-2826.604] (-2820.388) (-2812.923) * (-2819.485) [-2811.569] (-2823.593) (-2814.286) -- 0:04:30
479500 -- (-2815.808) (-2817.393) (-2811.041) [-2818.678] * (-2819.965) (-2812.836) [-2812.057] (-2815.693) -- 0:04:30
480000 -- [-2818.280] (-2815.938) (-2818.957) (-2826.447) * (-2812.958) [-2816.341] (-2812.726) (-2816.793) -- 0:04:29
Average standard deviation of split frequencies: 0.002506
480500 -- (-2818.162) (-2811.240) (-2818.275) [-2818.488] * [-2813.236] (-2817.199) (-2821.233) (-2812.502) -- 0:04:29
481000 -- [-2817.349] (-2811.148) (-2823.287) (-2812.034) * (-2813.137) [-2819.028] (-2817.954) (-2807.596) -- 0:04:29
481500 -- (-2818.819) (-2823.888) [-2815.965] (-2816.803) * (-2819.630) (-2809.265) [-2813.413] (-2814.154) -- 0:04:29
482000 -- (-2822.505) [-2821.572] (-2831.450) (-2816.531) * (-2818.347) [-2813.835] (-2818.697) (-2811.636) -- 0:04:28
482500 -- [-2814.116] (-2811.256) (-2821.691) (-2814.799) * [-2810.785] (-2821.834) (-2816.201) (-2821.854) -- 0:04:29
483000 -- (-2816.008) (-2815.706) [-2813.214] (-2815.070) * (-2812.514) (-2814.409) (-2821.515) [-2817.475] -- 0:04:28
483500 -- (-2817.409) (-2812.809) (-2820.601) [-2815.379] * (-2815.895) (-2820.840) (-2818.981) [-2820.721] -- 0:04:28
484000 -- [-2813.970] (-2816.330) (-2816.780) (-2812.158) * (-2818.046) (-2818.864) (-2816.372) [-2813.011] -- 0:04:27
484500 -- [-2808.493] (-2822.022) (-2806.494) (-2815.384) * [-2812.364] (-2818.094) (-2812.099) (-2814.010) -- 0:04:28
485000 -- (-2813.466) [-2813.889] (-2812.820) (-2812.981) * (-2813.934) (-2825.488) (-2809.801) [-2821.886] -- 0:04:27
Average standard deviation of split frequencies: 0.003018
485500 -- [-2816.481] (-2810.443) (-2818.560) (-2820.243) * (-2819.422) (-2817.764) (-2819.935) [-2815.862] -- 0:04:27
486000 -- (-2818.153) [-2813.399] (-2812.276) (-2821.417) * (-2825.018) (-2811.012) (-2809.830) [-2816.695] -- 0:04:26
486500 -- [-2811.314] (-2811.040) (-2817.393) (-2825.855) * [-2810.603] (-2816.781) (-2818.394) (-2819.447) -- 0:04:27
487000 -- (-2817.807) [-2815.487] (-2814.629) (-2820.755) * (-2815.110) [-2813.097] (-2817.332) (-2809.887) -- 0:04:26
487500 -- (-2810.278) [-2815.369] (-2813.454) (-2815.892) * (-2812.675) [-2813.106] (-2819.303) (-2817.166) -- 0:04:25
488000 -- (-2821.867) [-2815.586] (-2812.955) (-2809.771) * [-2811.895] (-2817.113) (-2829.813) (-2811.220) -- 0:04:25
488500 -- (-2819.259) (-2810.233) (-2812.458) [-2812.994] * (-2817.386) (-2815.874) (-2824.700) [-2815.282] -- 0:04:25
489000 -- [-2817.264] (-2816.710) (-2813.223) (-2820.266) * (-2820.303) (-2818.908) [-2807.235] (-2817.983) -- 0:04:25
489500 -- (-2822.113) [-2812.271] (-2826.756) (-2817.402) * (-2814.850) (-2814.544) [-2814.848] (-2816.168) -- 0:04:24
490000 -- (-2815.811) [-2806.800] (-2820.992) (-2820.058) * [-2811.160] (-2822.543) (-2824.811) (-2824.419) -- 0:04:24
Average standard deviation of split frequencies: 0.003309
490500 -- (-2809.514) [-2813.008] (-2817.739) (-2816.904) * [-2813.534] (-2816.988) (-2817.162) (-2811.749) -- 0:04:24
491000 -- (-2818.840) (-2817.581) (-2812.306) [-2821.944] * (-2817.807) [-2817.684] (-2815.773) (-2821.093) -- 0:04:24
491500 -- (-2818.571) [-2810.680] (-2823.643) (-2812.525) * (-2815.977) [-2812.335] (-2826.923) (-2825.230) -- 0:04:23
492000 -- (-2812.132) (-2817.537) [-2817.990] (-2826.054) * (-2819.793) (-2809.764) (-2826.064) [-2814.747] -- 0:04:23
492500 -- [-2813.127] (-2821.936) (-2817.610) (-2820.688) * (-2814.296) [-2825.225] (-2817.796) (-2832.117) -- 0:04:23
493000 -- [-2806.454] (-2816.184) (-2816.661) (-2824.272) * (-2818.445) (-2813.465) [-2814.587] (-2828.606) -- 0:04:23
493500 -- [-2815.309] (-2814.732) (-2814.417) (-2809.227) * (-2828.059) [-2810.273] (-2816.667) (-2817.695) -- 0:04:22
494000 -- (-2815.361) (-2818.012) (-2820.764) [-2814.809] * (-2812.821) (-2821.581) [-2807.881] (-2817.361) -- 0:04:22
494500 -- (-2813.510) (-2817.186) (-2818.009) [-2804.086] * (-2816.166) (-2817.754) [-2813.591] (-2814.712) -- 0:04:22
495000 -- [-2827.043] (-2819.717) (-2816.316) (-2815.963) * [-2819.860] (-2811.907) (-2814.547) (-2826.368) -- 0:04:22
Average standard deviation of split frequencies: 0.004224
495500 -- (-2821.278) [-2811.731] (-2809.699) (-2815.639) * (-2832.965) (-2819.044) (-2812.791) [-2814.861] -- 0:04:21
496000 -- (-2814.900) [-2812.797] (-2812.109) (-2823.859) * [-2816.201] (-2819.571) (-2816.742) (-2808.858) -- 0:04:21
496500 -- (-2824.184) (-2825.014) (-2811.192) [-2811.632] * [-2811.844] (-2812.954) (-2816.092) (-2821.975) -- 0:04:21
497000 -- (-2815.622) (-2816.550) (-2811.501) [-2806.454] * [-2813.880] (-2820.836) (-2821.773) (-2816.176) -- 0:04:21
497500 -- [-2819.424] (-2811.433) (-2813.563) (-2814.025) * (-2814.842) (-2818.057) (-2821.622) [-2819.275] -- 0:04:20
498000 -- (-2821.751) (-2829.173) (-2810.476) [-2810.569] * (-2808.643) (-2824.910) (-2824.380) [-2814.169] -- 0:04:20
498500 -- (-2822.849) (-2819.723) [-2815.126] (-2816.823) * (-2816.179) (-2823.039) (-2822.366) [-2813.209] -- 0:04:20
499000 -- [-2818.433] (-2824.194) (-2815.095) (-2826.282) * [-2824.966] (-2818.941) (-2819.153) (-2817.465) -- 0:04:20
499500 -- (-2817.075) (-2819.881) (-2820.122) [-2815.842] * (-2821.400) (-2828.666) [-2810.864] (-2817.019) -- 0:04:19
500000 -- [-2819.621] (-2821.838) (-2820.452) (-2814.625) * (-2815.750) (-2820.349) [-2819.328] (-2830.222) -- 0:04:20
Average standard deviation of split frequencies: 0.004917
500500 -- (-2828.611) (-2820.855) (-2824.514) [-2817.224] * (-2822.349) (-2816.756) [-2810.333] (-2823.749) -- 0:04:19
501000 -- (-2814.559) (-2822.075) (-2816.792) [-2811.423] * (-2811.031) [-2812.089] (-2815.389) (-2823.574) -- 0:04:18
501500 -- [-2808.857] (-2812.173) (-2818.965) (-2809.148) * (-2813.806) (-2817.431) [-2812.752] (-2842.241) -- 0:04:18
502000 -- (-2815.663) (-2820.911) [-2816.914] (-2825.579) * (-2818.313) [-2818.835] (-2827.633) (-2820.857) -- 0:04:18
502500 -- [-2812.907] (-2811.865) (-2823.279) (-2816.930) * [-2815.349] (-2814.163) (-2830.507) (-2828.355) -- 0:04:18
503000 -- (-2821.052) [-2809.849] (-2811.162) (-2818.271) * [-2813.672] (-2820.652) (-2814.500) (-2827.766) -- 0:04:17
503500 -- (-2825.318) (-2821.185) (-2810.684) [-2816.809] * [-2811.145] (-2814.131) (-2814.579) (-2815.458) -- 0:04:17
504000 -- (-2825.592) (-2831.664) (-2821.291) [-2816.432] * [-2811.377] (-2815.695) (-2815.059) (-2824.362) -- 0:04:17
504500 -- (-2817.752) (-2821.717) [-2813.258] (-2821.311) * [-2813.136] (-2821.226) (-2810.075) (-2811.805) -- 0:04:17
505000 -- [-2814.020] (-2833.484) (-2825.150) (-2817.389) * (-2814.198) (-2815.155) [-2820.243] (-2820.886) -- 0:04:16
Average standard deviation of split frequencies: 0.004451
505500 -- (-2818.749) (-2823.658) [-2813.371] (-2817.649) * (-2822.166) [-2819.266] (-2827.969) (-2811.577) -- 0:04:16
506000 -- [-2813.067] (-2816.144) (-2819.314) (-2813.656) * (-2815.313) [-2816.451] (-2824.379) (-2817.437) -- 0:04:16
506500 -- [-2816.610] (-2828.646) (-2807.790) (-2811.670) * [-2812.062] (-2823.775) (-2819.848) (-2822.529) -- 0:04:16
507000 -- (-2815.587) (-2823.842) [-2812.387] (-2816.167) * (-2820.080) (-2822.371) (-2819.331) [-2813.965] -- 0:04:15
507500 -- [-2818.699] (-2812.762) (-2814.235) (-2825.533) * (-2819.808) [-2814.887] (-2820.694) (-2818.547) -- 0:04:15
508000 -- (-2824.062) [-2808.280] (-2817.548) (-2822.925) * [-2813.255] (-2814.831) (-2822.902) (-2829.137) -- 0:04:15
508500 -- (-2824.565) (-2816.518) [-2813.555] (-2814.436) * (-2817.470) [-2813.616] (-2817.949) (-2811.117) -- 0:04:15
509000 -- (-2817.950) (-2820.328) (-2808.360) [-2817.510] * (-2824.837) [-2815.676] (-2821.566) (-2814.139) -- 0:04:14
509500 -- [-2811.476] (-2819.786) (-2812.294) (-2814.652) * [-2812.506] (-2830.543) (-2820.679) (-2818.221) -- 0:04:14
510000 -- (-2824.822) (-2816.618) (-2819.373) [-2818.226] * (-2812.480) (-2813.087) (-2814.281) [-2815.236] -- 0:04:14
Average standard deviation of split frequencies: 0.003487
510500 -- (-2816.251) (-2815.372) (-2819.331) [-2822.713] * (-2810.888) (-2814.840) (-2819.817) [-2810.265] -- 0:04:14
511000 -- (-2813.852) [-2819.505] (-2826.381) (-2819.219) * (-2820.166) (-2831.504) (-2816.876) [-2814.363] -- 0:04:13
511500 -- [-2818.107] (-2818.712) (-2824.650) (-2813.895) * (-2817.279) (-2813.245) (-2818.473) [-2818.880] -- 0:04:13
512000 -- (-2822.101) [-2813.213] (-2819.004) (-2818.276) * (-2815.964) [-2818.040] (-2811.764) (-2818.473) -- 0:04:13
512500 -- [-2811.841] (-2815.455) (-2813.268) (-2818.220) * [-2810.719] (-2823.535) (-2816.496) (-2813.339) -- 0:04:13
513000 -- (-2814.276) (-2819.744) [-2815.200] (-2819.062) * (-2806.142) (-2823.312) [-2810.962] (-2808.919) -- 0:04:12
513500 -- (-2815.026) [-2811.453] (-2815.319) (-2814.199) * (-2818.792) [-2815.724] (-2820.254) (-2810.822) -- 0:04:12
514000 -- (-2810.772) [-2813.429] (-2821.089) (-2820.199) * (-2817.335) (-2821.691) [-2814.013] (-2826.725) -- 0:04:12
514500 -- (-2824.039) (-2812.066) [-2810.782] (-2820.794) * [-2813.442] (-2822.984) (-2814.845) (-2818.385) -- 0:04:11
515000 -- (-2813.587) (-2818.373) [-2820.852] (-2819.221) * (-2814.229) (-2824.632) (-2816.402) [-2813.498] -- 0:04:11
Average standard deviation of split frequencies: 0.003248
515500 -- (-2818.786) (-2819.992) (-2812.263) [-2818.624] * (-2822.129) [-2809.495] (-2816.428) (-2823.332) -- 0:04:10
516000 -- (-2814.503) [-2815.569] (-2816.124) (-2821.591) * (-2816.907) (-2810.303) (-2815.461) [-2810.744] -- 0:04:11
516500 -- (-2822.639) (-2804.727) [-2811.306] (-2824.882) * (-2821.569) (-2820.540) [-2814.429] (-2816.388) -- 0:04:10
517000 -- (-2812.650) (-2817.602) (-2811.921) [-2810.930] * [-2817.063] (-2821.389) (-2824.043) (-2807.457) -- 0:04:10
517500 -- (-2818.941) (-2809.310) (-2816.509) [-2822.844] * (-2815.138) (-2824.062) (-2817.922) [-2813.713] -- 0:04:10
518000 -- [-2817.990] (-2827.233) (-2818.864) (-2819.900) * [-2813.763] (-2817.149) (-2811.964) (-2817.787) -- 0:04:10
518500 -- (-2819.355) (-2820.180) (-2820.590) [-2812.246] * [-2815.273] (-2815.761) (-2813.164) (-2810.207) -- 0:04:09
519000 -- (-2813.414) [-2812.237] (-2813.915) (-2820.489) * (-2812.161) (-2814.475) [-2812.332] (-2820.149) -- 0:04:09
519500 -- [-2811.787] (-2823.160) (-2833.614) (-2824.244) * (-2815.804) (-2811.270) (-2821.592) [-2820.451] -- 0:04:09
520000 -- (-2815.748) (-2824.205) (-2822.363) [-2808.666] * [-2813.889] (-2820.713) (-2810.634) (-2820.944) -- 0:04:09
Average standard deviation of split frequencies: 0.003320
520500 -- [-2815.930] (-2830.289) (-2823.548) (-2806.541) * [-2810.848] (-2810.613) (-2813.633) (-2817.468) -- 0:04:08
521000 -- (-2814.422) (-2821.888) (-2821.610) [-2808.650] * (-2818.638) (-2814.431) [-2811.435] (-2823.273) -- 0:04:08
521500 -- (-2814.698) [-2819.769] (-2818.682) (-2810.728) * [-2818.321] (-2815.286) (-2817.784) (-2810.760) -- 0:04:08
522000 -- (-2822.917) [-2813.510] (-2812.050) (-2811.822) * (-2817.146) (-2815.633) [-2812.648] (-2811.694) -- 0:04:08
522500 -- (-2810.494) (-2816.484) (-2815.217) [-2810.980] * (-2819.447) (-2814.958) (-2816.787) [-2811.456] -- 0:04:07
523000 -- [-2813.719] (-2820.670) (-2813.087) (-2817.562) * (-2819.527) (-2816.321) (-2817.821) [-2816.060] -- 0:04:07
523500 -- (-2825.742) (-2821.776) (-2821.075) [-2811.923] * [-2814.522] (-2819.468) (-2816.404) (-2814.292) -- 0:04:07
524000 -- (-2822.109) (-2819.297) [-2822.103] (-2815.762) * [-2805.537] (-2823.310) (-2814.767) (-2810.137) -- 0:04:07
524500 -- (-2822.111) (-2813.519) (-2825.752) [-2814.927] * (-2814.887) (-2817.556) (-2820.554) [-2810.581] -- 0:04:06
525000 -- [-2814.538] (-2819.220) (-2820.409) (-2816.996) * [-2811.663] (-2810.795) (-2813.019) (-2820.669) -- 0:04:06
Average standard deviation of split frequencies: 0.002489
525500 -- [-2816.227] (-2814.937) (-2818.580) (-2813.637) * (-2812.757) [-2819.596] (-2816.401) (-2819.418) -- 0:04:06
526000 -- [-2817.794] (-2819.460) (-2814.483) (-2817.528) * (-2816.055) (-2815.520) [-2812.501] (-2825.002) -- 0:04:06
526500 -- (-2814.374) [-2816.000] (-2813.873) (-2818.195) * [-2808.399] (-2819.686) (-2819.618) (-2819.474) -- 0:04:05
527000 -- [-2820.874] (-2821.830) (-2820.591) (-2814.067) * [-2808.674] (-2819.194) (-2811.026) (-2823.178) -- 0:04:05
527500 -- (-2809.956) (-2815.911) (-2815.884) [-2815.241] * (-2822.138) (-2814.737) (-2813.245) [-2812.870] -- 0:04:05
528000 -- (-2808.794) (-2810.593) [-2819.640] (-2814.533) * (-2820.491) (-2821.765) [-2811.564] (-2812.793) -- 0:04:04
528500 -- (-2825.548) (-2816.372) (-2829.284) [-2813.813] * [-2809.290] (-2821.839) (-2822.833) (-2814.892) -- 0:04:04
529000 -- (-2821.057) (-2823.394) (-2818.740) [-2813.593] * [-2807.085] (-2820.548) (-2814.564) (-2814.126) -- 0:04:03
529500 -- [-2814.927] (-2813.681) (-2829.883) (-2826.358) * (-2816.994) (-2818.165) [-2815.392] (-2813.631) -- 0:04:04
530000 -- (-2826.716) (-2821.219) (-2832.115) [-2818.514] * [-2814.947] (-2820.379) (-2820.035) (-2808.387) -- 0:04:03
Average standard deviation of split frequencies: 0.002171
530500 -- [-2814.664] (-2816.306) (-2821.941) (-2824.619) * (-2814.132) [-2816.198] (-2812.172) (-2815.093) -- 0:04:03
531000 -- (-2813.994) [-2818.873] (-2822.672) (-2836.622) * [-2812.833] (-2820.807) (-2812.384) (-2819.494) -- 0:04:02
531500 -- [-2815.947] (-2820.827) (-2815.061) (-2819.861) * (-2814.143) (-2816.522) [-2811.697] (-2822.547) -- 0:04:03
532000 -- (-2817.539) (-2815.213) (-2823.904) [-2814.624] * (-2825.439) (-2815.683) [-2821.143] (-2813.146) -- 0:04:02
532500 -- (-2817.531) (-2824.859) (-2817.345) [-2810.460] * (-2818.963) (-2827.166) (-2820.103) [-2809.293] -- 0:04:02
533000 -- [-2815.873] (-2816.468) (-2820.561) (-2823.278) * (-2835.069) (-2817.947) [-2804.080] (-2812.647) -- 0:04:01
533500 -- [-2807.896] (-2806.458) (-2820.180) (-2822.134) * (-2817.571) (-2814.153) (-2821.292) [-2816.835] -- 0:04:02
534000 -- (-2811.209) (-2817.374) [-2818.209] (-2816.859) * (-2821.480) (-2817.301) [-2805.662] (-2817.760) -- 0:04:01
534500 -- (-2817.184) (-2823.311) [-2816.077] (-2818.861) * [-2817.036] (-2811.571) (-2815.591) (-2810.888) -- 0:04:01
535000 -- (-2821.102) (-2818.309) [-2810.860] (-2820.927) * (-2822.363) [-2818.720] (-2821.222) (-2813.625) -- 0:04:00
Average standard deviation of split frequencies: 0.001661
535500 -- [-2819.704] (-2810.316) (-2824.581) (-2825.281) * (-2825.409) [-2811.968] (-2818.809) (-2818.877) -- 0:04:01
536000 -- [-2811.809] (-2813.477) (-2809.127) (-2824.634) * [-2815.625] (-2812.888) (-2814.988) (-2816.803) -- 0:04:00
536500 -- (-2818.913) [-2808.978] (-2823.985) (-2810.699) * (-2823.086) (-2823.545) (-2810.200) [-2811.360] -- 0:04:00
537000 -- (-2814.308) [-2814.324] (-2813.978) (-2817.465) * (-2817.248) [-2814.152] (-2812.768) (-2828.625) -- 0:03:59
537500 -- [-2812.274] (-2817.923) (-2819.928) (-2812.571) * (-2813.090) (-2814.533) (-2812.393) [-2815.940] -- 0:04:00
538000 -- (-2819.713) (-2816.280) [-2812.574] (-2814.562) * [-2820.756] (-2826.365) (-2823.596) (-2820.856) -- 0:03:59
538500 -- (-2821.978) (-2816.099) (-2812.320) [-2809.032] * (-2818.532) [-2821.650] (-2824.400) (-2820.464) -- 0:03:59
539000 -- (-2818.155) (-2817.745) [-2812.596] (-2812.579) * [-2812.746] (-2813.983) (-2825.006) (-2810.552) -- 0:03:59
539500 -- (-2810.964) [-2820.256] (-2819.230) (-2815.472) * (-2812.224) [-2811.298] (-2820.201) (-2818.212) -- 0:03:58
540000 -- [-2809.065] (-2811.702) (-2813.169) (-2817.120) * [-2810.341] (-2816.016) (-2830.379) (-2812.446) -- 0:03:58
Average standard deviation of split frequencies: 0.001453
540500 -- (-2813.993) (-2818.692) (-2821.438) [-2823.189] * (-2827.985) (-2817.981) (-2819.586) [-2827.100] -- 0:03:58
541000 -- [-2815.323] (-2827.749) (-2818.387) (-2817.810) * (-2828.623) (-2814.696) (-2822.103) [-2812.580] -- 0:03:58
541500 -- (-2821.583) (-2822.298) (-2817.698) [-2815.567] * (-2824.973) [-2818.605] (-2822.837) (-2810.123) -- 0:03:57
542000 -- [-2819.225] (-2820.560) (-2818.339) (-2820.760) * [-2815.430] (-2826.455) (-2816.950) (-2815.375) -- 0:03:57
542500 -- [-2812.580] (-2831.468) (-2814.521) (-2822.363) * (-2823.314) [-2814.412] (-2819.811) (-2822.270) -- 0:03:56
543000 -- (-2819.576) (-2818.760) [-2809.315] (-2819.605) * (-2818.467) (-2822.562) [-2814.971] (-2822.824) -- 0:03:57
543500 -- (-2822.624) [-2812.705] (-2816.206) (-2825.193) * (-2812.383) (-2820.721) (-2814.443) [-2812.224] -- 0:03:56
544000 -- (-2817.828) [-2817.588] (-2819.882) (-2829.229) * (-2817.337) (-2810.112) (-2822.150) [-2823.717] -- 0:03:56
544500 -- (-2808.266) (-2816.830) [-2818.588] (-2813.558) * (-2817.860) [-2813.281] (-2812.220) (-2818.165) -- 0:03:55
545000 -- (-2813.447) [-2810.048] (-2816.284) (-2811.283) * (-2823.384) [-2815.578] (-2816.208) (-2813.906) -- 0:03:56
Average standard deviation of split frequencies: 0.001631
545500 -- (-2816.953) [-2810.319] (-2818.898) (-2816.495) * (-2813.759) (-2834.671) (-2817.156) [-2810.942] -- 0:03:55
546000 -- (-2817.380) (-2818.798) (-2816.322) [-2809.144] * [-2805.907] (-2820.418) (-2813.814) (-2817.901) -- 0:03:55
546500 -- [-2821.619] (-2826.287) (-2817.180) (-2820.078) * (-2823.371) [-2813.957] (-2818.021) (-2816.445) -- 0:03:54
547000 -- [-2816.090] (-2826.252) (-2813.603) (-2813.703) * (-2818.881) (-2817.920) (-2820.956) [-2820.821] -- 0:03:55
547500 -- [-2815.109] (-2826.820) (-2813.491) (-2816.820) * (-2829.769) [-2815.125] (-2827.069) (-2819.978) -- 0:03:54
548000 -- (-2817.638) [-2813.775] (-2822.799) (-2820.960) * [-2822.834] (-2826.456) (-2815.040) (-2820.902) -- 0:03:54
548500 -- (-2820.476) [-2812.633] (-2813.711) (-2813.534) * (-2821.392) (-2813.422) [-2807.188] (-2817.252) -- 0:03:53
549000 -- [-2813.376] (-2815.216) (-2817.789) (-2813.805) * [-2815.452] (-2815.026) (-2810.336) (-2822.144) -- 0:03:54
549500 -- (-2820.436) (-2818.551) [-2817.666] (-2817.214) * (-2812.183) (-2813.888) (-2819.148) [-2818.406] -- 0:03:53
550000 -- (-2820.958) (-2824.286) [-2808.133] (-2822.211) * (-2828.124) (-2817.116) (-2826.440) [-2813.098] -- 0:03:53
Average standard deviation of split frequencies: 0.001617
550500 -- (-2819.506) (-2818.938) (-2822.468) [-2813.297] * (-2815.879) (-2815.187) [-2817.998] (-2820.310) -- 0:03:52
551000 -- (-2813.268) (-2816.931) [-2811.082] (-2810.459) * (-2813.209) (-2812.357) [-2821.622] (-2822.412) -- 0:03:53
551500 -- (-2813.093) (-2820.089) [-2807.152] (-2813.362) * (-2816.361) [-2822.243] (-2819.440) (-2816.728) -- 0:03:52
552000 -- [-2816.287] (-2827.318) (-2816.614) (-2815.668) * (-2814.916) (-2822.114) [-2817.026] (-2818.821) -- 0:03:52
552500 -- (-2815.328) (-2819.919) (-2814.315) [-2814.649] * [-2819.405] (-2812.808) (-2820.600) (-2808.368) -- 0:03:51
553000 -- (-2810.653) (-2818.478) (-2817.520) [-2814.655] * (-2816.576) (-2818.505) [-2816.152] (-2819.163) -- 0:03:51
553500 -- (-2813.397) (-2817.135) [-2809.187] (-2821.349) * (-2822.439) (-2809.368) [-2811.120] (-2812.258) -- 0:03:51
554000 -- (-2817.141) (-2826.882) [-2806.078] (-2824.282) * [-2815.769] (-2809.878) (-2819.526) (-2817.025) -- 0:03:51
554500 -- (-2817.841) (-2814.451) (-2813.558) [-2811.794] * (-2816.715) (-2819.447) (-2816.097) [-2809.152] -- 0:03:50
555000 -- (-2821.101) [-2811.539] (-2817.836) (-2817.924) * (-2824.005) [-2819.481] (-2819.052) (-2811.010) -- 0:03:50
Average standard deviation of split frequencies: 0.001884
555500 -- (-2815.216) [-2817.461] (-2824.103) (-2818.772) * [-2812.758] (-2813.544) (-2813.175) (-2813.919) -- 0:03:50
556000 -- (-2808.124) [-2818.346] (-2829.381) (-2824.947) * [-2818.832] (-2817.658) (-2818.831) (-2818.637) -- 0:03:49
556500 -- (-2807.717) (-2818.292) [-2812.439] (-2827.170) * [-2814.701] (-2823.668) (-2812.388) (-2815.437) -- 0:03:49
557000 -- (-2819.900) (-2821.439) (-2814.015) [-2815.086] * (-2820.853) (-2819.335) [-2814.628] (-2811.974) -- 0:03:49
557500 -- (-2816.921) [-2823.803] (-2818.977) (-2817.803) * (-2819.558) (-2810.726) [-2808.898] (-2814.494) -- 0:03:49
558000 -- (-2828.835) (-2817.372) [-2813.552] (-2814.573) * (-2825.849) (-2811.692) [-2813.200] (-2816.881) -- 0:03:48
558500 -- (-2813.290) (-2831.196) [-2819.955] (-2813.628) * (-2816.781) [-2813.048] (-2815.354) (-2822.708) -- 0:03:49
559000 -- [-2815.811] (-2825.153) (-2817.943) (-2816.823) * [-2802.942] (-2818.216) (-2826.961) (-2814.713) -- 0:03:48
559500 -- [-2818.852] (-2818.182) (-2819.451) (-2822.470) * [-2812.584] (-2830.432) (-2825.689) (-2815.666) -- 0:03:48
560000 -- [-2813.195] (-2814.126) (-2822.397) (-2821.683) * (-2816.536) [-2818.649] (-2834.553) (-2812.538) -- 0:03:47
Average standard deviation of split frequencies: 0.001682
560500 -- (-2823.324) (-2821.089) (-2824.256) [-2819.431] * (-2813.203) (-2815.645) (-2825.693) [-2811.385] -- 0:03:48
561000 -- [-2818.699] (-2828.437) (-2819.355) (-2816.335) * (-2818.596) (-2822.658) [-2814.351] (-2814.168) -- 0:03:47
561500 -- [-2816.611] (-2819.534) (-2812.325) (-2820.875) * (-2818.231) (-2817.321) (-2815.949) [-2817.675] -- 0:03:47
562000 -- (-2814.064) (-2826.297) (-2822.479) [-2819.835] * [-2813.767] (-2817.195) (-2818.217) (-2812.922) -- 0:03:46
562500 -- [-2809.972] (-2831.234) (-2823.017) (-2813.516) * (-2829.174) (-2818.037) (-2813.573) [-2810.984] -- 0:03:47
563000 -- (-2811.945) [-2816.557] (-2815.332) (-2822.954) * (-2830.776) [-2814.789] (-2816.557) (-2815.953) -- 0:03:46
563500 -- (-2809.821) [-2818.146] (-2825.180) (-2819.859) * (-2824.556) [-2818.313] (-2815.888) (-2813.698) -- 0:03:46
564000 -- [-2814.195] (-2817.445) (-2824.373) (-2809.005) * (-2822.277) (-2813.269) (-2813.845) [-2811.800] -- 0:03:45
564500 -- (-2812.688) [-2824.025] (-2830.237) (-2810.002) * (-2824.477) (-2810.882) (-2810.918) [-2808.757] -- 0:03:46
565000 -- (-2823.185) (-2817.204) [-2820.686] (-2820.028) * [-2820.182] (-2812.879) (-2821.572) (-2815.162) -- 0:03:45
Average standard deviation of split frequencies: 0.001851
565500 -- (-2819.581) [-2814.101] (-2814.115) (-2815.888) * [-2811.759] (-2812.762) (-2808.787) (-2822.571) -- 0:03:45
566000 -- (-2821.740) (-2818.852) [-2805.418] (-2818.993) * (-2814.555) [-2808.491] (-2821.743) (-2822.549) -- 0:03:44
566500 -- (-2826.297) [-2825.656] (-2821.218) (-2813.812) * (-2813.772) (-2807.210) (-2819.298) [-2819.546] -- 0:03:44
567000 -- [-2814.223] (-2818.856) (-2826.450) (-2811.145) * (-2822.831) [-2815.016] (-2822.831) (-2827.840) -- 0:03:44
567500 -- (-2815.191) (-2815.787) (-2818.611) [-2810.667] * (-2819.565) [-2817.548] (-2816.195) (-2814.097) -- 0:03:44
568000 -- (-2813.987) [-2825.372] (-2815.810) (-2823.323) * (-2830.077) (-2821.922) [-2812.089] (-2811.665) -- 0:03:43
568500 -- (-2822.763) [-2814.794] (-2817.262) (-2815.201) * (-2828.337) (-2817.721) [-2821.236] (-2815.780) -- 0:03:43
569000 -- (-2823.890) (-2810.133) (-2820.937) [-2809.815] * (-2817.392) (-2820.666) (-2814.316) [-2814.401] -- 0:03:43
569500 -- (-2825.548) (-2829.987) (-2813.699) [-2816.032] * (-2815.284) [-2823.093] (-2819.019) (-2815.399) -- 0:03:42
570000 -- [-2817.817] (-2817.657) (-2819.512) (-2821.531) * [-2827.375] (-2820.033) (-2825.384) (-2825.369) -- 0:03:42
Average standard deviation of split frequencies: 0.001469
570500 -- [-2810.553] (-2819.271) (-2824.860) (-2816.581) * (-2828.016) (-2816.604) [-2819.268] (-2816.195) -- 0:03:42
571000 -- (-2814.982) (-2819.397) (-2811.244) [-2813.776] * (-2833.519) [-2810.212] (-2817.909) (-2811.102) -- 0:03:42
571500 -- (-2821.954) (-2813.138) [-2810.919] (-2818.163) * (-2818.190) [-2816.605] (-2826.367) (-2822.227) -- 0:03:41
572000 -- (-2818.637) [-2817.793] (-2812.609) (-2822.016) * [-2815.241] (-2817.625) (-2826.479) (-2812.235) -- 0:03:41
572500 -- [-2810.820] (-2820.187) (-2821.438) (-2808.592) * (-2822.842) (-2824.768) [-2820.469] (-2813.563) -- 0:03:41
573000 -- (-2816.475) (-2822.038) [-2817.028] (-2819.133) * (-2816.602) (-2821.033) [-2817.735] (-2817.565) -- 0:03:41
573500 -- (-2827.220) (-2820.384) [-2810.176] (-2813.865) * (-2818.818) [-2810.531] (-2817.036) (-2817.414) -- 0:03:40
574000 -- (-2819.748) (-2816.266) (-2819.302) [-2815.589] * (-2827.619) [-2812.160] (-2817.508) (-2813.153) -- 0:03:40
574500 -- (-2815.584) [-2817.549] (-2828.564) (-2816.931) * (-2816.195) (-2811.804) [-2813.784] (-2816.828) -- 0:03:40
575000 -- (-2817.032) [-2813.679] (-2830.362) (-2813.019) * (-2815.125) (-2816.978) [-2815.986] (-2807.482) -- 0:03:40
Average standard deviation of split frequencies: 0.001546
575500 -- (-2817.061) [-2806.484] (-2843.082) (-2816.116) * (-2814.955) (-2820.605) [-2815.000] (-2819.301) -- 0:03:39
576000 -- (-2818.496) (-2820.627) [-2815.047] (-2809.767) * [-2810.253] (-2814.617) (-2817.423) (-2816.758) -- 0:03:39
576500 -- (-2818.503) [-2809.542] (-2818.523) (-2816.740) * [-2806.726] (-2818.601) (-2825.058) (-2814.671) -- 0:03:39
577000 -- [-2823.548] (-2812.485) (-2819.111) (-2813.985) * [-2808.059] (-2824.103) (-2826.531) (-2819.126) -- 0:03:39
577500 -- (-2823.620) (-2815.274) [-2818.721] (-2820.597) * (-2809.560) (-2816.061) [-2816.846] (-2811.056) -- 0:03:38
578000 -- (-2828.795) [-2814.994] (-2806.809) (-2817.640) * (-2814.356) (-2819.041) (-2829.007) [-2816.937] -- 0:03:39
578500 -- (-2822.912) (-2811.729) (-2813.483) [-2814.311] * (-2816.005) (-2816.389) [-2816.365] (-2815.489) -- 0:03:38
579000 -- (-2817.712) [-2815.199] (-2815.598) (-2819.261) * [-2813.615] (-2830.907) (-2812.649) (-2813.444) -- 0:03:38
579500 -- [-2812.108] (-2812.826) (-2809.369) (-2821.640) * (-2818.297) (-2814.791) (-2820.023) [-2812.979] -- 0:03:37
580000 -- (-2830.101) (-2819.600) [-2814.080] (-2811.605) * (-2818.962) (-2822.456) (-2825.495) [-2813.882] -- 0:03:37
Average standard deviation of split frequencies: 0.001443
580500 -- (-2823.486) (-2815.863) [-2819.152] (-2817.461) * (-2809.394) (-2817.480) (-2823.675) [-2821.223] -- 0:03:37
581000 -- (-2823.151) (-2817.396) (-2823.418) [-2817.897] * (-2808.492) (-2821.208) [-2817.737] (-2826.114) -- 0:03:37
581500 -- (-2814.655) [-2811.990] (-2820.827) (-2814.622) * (-2811.311) (-2829.614) [-2808.869] (-2810.089) -- 0:03:36
582000 -- (-2810.403) [-2812.507] (-2818.540) (-2822.670) * (-2814.357) (-2812.636) (-2816.293) [-2818.298] -- 0:03:36
582500 -- (-2811.178) (-2819.345) (-2820.204) [-2822.281] * (-2828.219) (-2812.941) [-2812.760] (-2818.252) -- 0:03:36
583000 -- (-2817.081) [-2811.536] (-2808.605) (-2816.462) * (-2820.866) (-2814.154) [-2815.259] (-2811.584) -- 0:03:36
583500 -- (-2820.741) [-2810.486] (-2807.920) (-2817.294) * [-2813.135] (-2816.013) (-2808.994) (-2814.880) -- 0:03:35
584000 -- (-2822.369) (-2807.464) (-2816.377) [-2810.182] * [-2817.411] (-2814.635) (-2811.964) (-2816.330) -- 0:03:35
584500 -- [-2813.608] (-2817.287) (-2820.697) (-2816.094) * (-2823.072) (-2820.275) [-2812.340] (-2820.678) -- 0:03:35
585000 -- (-2819.028) (-2816.051) (-2811.391) [-2816.998] * (-2827.593) (-2827.423) (-2812.376) [-2822.629] -- 0:03:34
Average standard deviation of split frequencies: 0.001162
585500 -- [-2813.372] (-2815.232) (-2829.430) (-2817.258) * (-2818.910) (-2823.066) [-2808.586] (-2816.225) -- 0:03:34
586000 -- (-2811.260) [-2814.071] (-2815.222) (-2819.445) * (-2814.336) (-2822.526) [-2819.335] (-2810.927) -- 0:03:34
586500 -- [-2814.973] (-2812.365) (-2811.311) (-2819.420) * (-2813.102) (-2821.832) (-2824.169) [-2813.339] -- 0:03:34
587000 -- (-2813.419) (-2818.751) [-2815.548] (-2815.482) * [-2817.613] (-2816.998) (-2815.842) (-2816.480) -- 0:03:33
587500 -- (-2819.283) (-2829.757) [-2815.806] (-2823.010) * [-2814.678] (-2820.275) (-2816.973) (-2813.148) -- 0:03:33
588000 -- (-2813.565) (-2819.768) (-2817.621) [-2810.641] * (-2813.680) (-2821.833) (-2816.089) [-2812.579] -- 0:03:33
588500 -- [-2810.123] (-2814.700) (-2817.589) (-2810.809) * [-2810.391] (-2817.427) (-2826.741) (-2812.721) -- 0:03:33
589000 -- (-2812.023) (-2814.125) (-2817.493) [-2816.579] * (-2810.517) (-2817.267) (-2817.813) [-2817.831] -- 0:03:32
589500 -- (-2817.966) (-2819.251) [-2818.757] (-2813.300) * (-2819.243) (-2812.523) (-2826.288) [-2817.364] -- 0:03:32
590000 -- (-2811.685) [-2818.003] (-2816.576) (-2816.387) * [-2808.897] (-2821.345) (-2819.581) (-2810.591) -- 0:03:32
Average standard deviation of split frequencies: 0.001241
590500 -- (-2811.727) (-2822.301) (-2818.523) [-2816.872] * (-2815.661) (-2821.730) (-2822.723) [-2815.477] -- 0:03:32
591000 -- (-2811.936) (-2821.388) (-2821.273) [-2817.749] * (-2809.888) (-2828.219) [-2812.965] (-2826.122) -- 0:03:31
591500 -- (-2821.084) (-2814.826) (-2816.413) [-2810.169] * (-2809.310) (-2811.448) [-2822.237] (-2828.783) -- 0:03:31
592000 -- (-2822.577) (-2816.787) (-2820.535) [-2809.914] * (-2812.886) (-2810.887) (-2819.529) [-2815.782] -- 0:03:31
592500 -- [-2814.926] (-2813.111) (-2814.657) (-2811.790) * [-2813.596] (-2822.451) (-2816.358) (-2808.578) -- 0:03:31
593000 -- [-2819.127] (-2812.438) (-2814.505) (-2817.317) * (-2814.133) (-2824.581) [-2814.996] (-2824.866) -- 0:03:30
593500 -- (-2820.523) [-2812.985] (-2812.197) (-2814.560) * [-2810.153] (-2827.698) (-2816.720) (-2814.307) -- 0:03:30
594000 -- (-2817.486) (-2815.467) [-2815.408] (-2816.727) * [-2822.950] (-2822.922) (-2812.165) (-2823.932) -- 0:03:30
594500 -- [-2818.825] (-2825.263) (-2823.487) (-2820.488) * [-2809.331] (-2827.678) (-2820.960) (-2822.324) -- 0:03:30
595000 -- (-2816.988) (-2824.533) [-2814.353] (-2818.866) * (-2814.387) [-2817.461] (-2821.002) (-2819.515) -- 0:03:29
Average standard deviation of split frequencies: 0.001230
595500 -- (-2819.884) (-2821.696) (-2810.574) [-2825.648] * (-2814.102) (-2817.888) (-2821.082) [-2817.807] -- 0:03:29
596000 -- (-2824.331) [-2819.072] (-2821.147) (-2817.210) * (-2821.983) (-2818.222) (-2827.474) [-2815.284] -- 0:03:29
596500 -- (-2816.705) [-2810.272] (-2816.306) (-2806.639) * (-2811.695) [-2812.349] (-2824.608) (-2818.039) -- 0:03:29
597000 -- (-2817.709) [-2817.016] (-2821.518) (-2811.227) * (-2809.063) [-2813.676] (-2821.106) (-2813.479) -- 0:03:28
597500 -- (-2815.878) [-2816.406] (-2822.551) (-2813.548) * (-2815.960) [-2811.794] (-2821.776) (-2821.727) -- 0:03:28
598000 -- (-2816.102) (-2816.838) (-2819.311) [-2815.092] * (-2815.494) (-2816.496) (-2822.265) [-2812.842] -- 0:03:28
598500 -- (-2823.656) [-2813.889] (-2825.149) (-2816.859) * (-2813.672) [-2819.840] (-2816.065) (-2826.255) -- 0:03:27
599000 -- (-2816.751) (-2815.807) [-2817.057] (-2814.361) * (-2810.329) (-2815.387) (-2821.599) [-2824.541] -- 0:03:27
599500 -- (-2807.477) [-2813.918] (-2816.148) (-2815.871) * (-2812.699) [-2812.059] (-2819.451) (-2812.158) -- 0:03:27
600000 -- (-2812.198) (-2819.062) [-2814.239] (-2814.861) * [-2810.864] (-2822.155) (-2826.658) (-2816.764) -- 0:03:27
Average standard deviation of split frequencies: 0.001308
600500 -- (-2817.026) (-2816.510) (-2827.283) [-2823.479] * (-2814.696) (-2812.107) [-2818.199] (-2817.188) -- 0:03:26
601000 -- (-2815.431) (-2820.213) (-2814.800) [-2808.523] * [-2805.199] (-2815.149) (-2815.701) (-2817.115) -- 0:03:26
601500 -- (-2812.897) (-2817.448) [-2812.901] (-2816.604) * [-2808.933] (-2813.663) (-2814.414) (-2808.424) -- 0:03:26
602000 -- (-2817.839) (-2824.309) [-2811.392] (-2818.936) * (-2811.965) (-2819.269) [-2811.708] (-2811.631) -- 0:03:26
602500 -- (-2813.800) (-2827.714) [-2821.714] (-2824.205) * [-2813.346] (-2813.823) (-2817.641) (-2819.478) -- 0:03:25
603000 -- [-2809.465] (-2823.215) (-2809.726) (-2818.071) * (-2815.672) (-2818.103) (-2815.244) [-2810.901] -- 0:03:25
603500 -- (-2820.775) (-2813.426) (-2816.169) [-2810.928] * [-2817.352] (-2818.764) (-2815.150) (-2815.219) -- 0:03:25
604000 -- (-2831.818) [-2807.097] (-2817.155) (-2817.125) * (-2814.372) [-2814.429] (-2815.957) (-2823.278) -- 0:03:25
604500 -- (-2819.312) (-2819.065) [-2814.041] (-2818.841) * (-2818.038) (-2822.038) (-2808.872) [-2821.130] -- 0:03:24
605000 -- (-2826.872) [-2814.516] (-2819.260) (-2815.648) * [-2810.165] (-2809.629) (-2823.333) (-2819.763) -- 0:03:24
Average standard deviation of split frequencies: 0.001556
605500 -- (-2822.738) (-2820.268) [-2822.051] (-2820.579) * [-2808.315] (-2815.714) (-2813.256) (-2819.329) -- 0:03:24
606000 -- [-2811.742] (-2813.698) (-2818.078) (-2814.221) * (-2825.514) (-2815.883) (-2811.486) [-2819.791] -- 0:03:24
606500 -- (-2812.577) (-2820.367) (-2824.082) [-2810.285] * (-2820.792) (-2819.766) [-2808.945] (-2814.885) -- 0:03:23
607000 -- (-2813.610) (-2818.206) (-2816.879) [-2808.647] * (-2824.195) [-2810.482] (-2823.506) (-2833.242) -- 0:03:23
607500 -- (-2816.766) [-2812.094] (-2825.804) (-2813.361) * (-2819.419) (-2812.812) (-2819.997) [-2812.576] -- 0:03:23
608000 -- (-2814.780) [-2820.207] (-2814.536) (-2818.563) * (-2814.090) [-2816.070] (-2816.415) (-2819.944) -- 0:03:23
608500 -- (-2822.303) (-2820.035) (-2821.449) [-2808.253] * (-2815.306) [-2815.882] (-2817.451) (-2823.802) -- 0:03:22
609000 -- (-2814.924) (-2812.472) (-2810.801) [-2811.086] * (-2830.894) [-2813.790] (-2817.463) (-2828.628) -- 0:03:22
609500 -- (-2818.257) (-2815.845) (-2819.195) [-2815.769] * (-2814.728) (-2827.114) [-2813.569] (-2817.801) -- 0:03:22
610000 -- (-2816.515) (-2818.294) (-2817.937) [-2812.669] * (-2816.473) [-2815.265] (-2805.977) (-2824.199) -- 0:03:22
Average standard deviation of split frequencies: 0.001544
610500 -- (-2823.705) [-2816.144] (-2818.524) (-2827.910) * [-2819.973] (-2818.501) (-2819.243) (-2821.050) -- 0:03:21
611000 -- (-2813.177) [-2818.845] (-2818.257) (-2826.598) * (-2819.531) (-2816.300) (-2828.583) [-2810.374] -- 0:03:21
611500 -- (-2823.023) [-2817.842] (-2817.208) (-2811.520) * (-2825.561) (-2825.706) [-2813.933] (-2819.060) -- 0:03:21
612000 -- (-2816.689) [-2811.434] (-2814.634) (-2807.490) * (-2820.857) (-2817.795) [-2809.683] (-2820.900) -- 0:03:20
612500 -- (-2811.001) (-2831.174) [-2814.744] (-2819.698) * (-2822.151) (-2816.601) [-2818.005] (-2813.737) -- 0:03:20
613000 -- [-2812.032] (-2817.198) (-2818.147) (-2807.048) * [-2816.737] (-2821.244) (-2816.827) (-2831.899) -- 0:03:20
613500 -- (-2812.544) (-2817.553) (-2818.699) [-2818.241] * (-2821.784) (-2818.641) [-2810.305] (-2827.973) -- 0:03:20
614000 -- [-2816.114] (-2819.663) (-2814.557) (-2815.601) * (-2817.331) [-2812.145] (-2819.376) (-2818.577) -- 0:03:19
614500 -- (-2815.416) [-2813.296] (-2816.275) (-2818.308) * [-2816.549] (-2819.911) (-2819.524) (-2816.363) -- 0:03:19
615000 -- (-2822.075) [-2812.139] (-2813.658) (-2814.794) * (-2810.442) (-2817.551) (-2824.302) [-2815.658] -- 0:03:19
Average standard deviation of split frequencies: 0.001531
615500 -- [-2812.630] (-2817.614) (-2820.552) (-2809.363) * [-2806.656] (-2815.584) (-2821.129) (-2807.809) -- 0:03:19
616000 -- (-2815.067) [-2812.008] (-2817.744) (-2813.997) * (-2815.073) [-2819.828] (-2820.771) (-2821.424) -- 0:03:18
616500 -- (-2822.264) [-2817.107] (-2812.406) (-2816.975) * [-2813.538] (-2819.047) (-2815.482) (-2808.743) -- 0:03:18
617000 -- (-2818.979) (-2819.088) [-2818.313] (-2826.331) * [-2815.835] (-2816.185) (-2814.485) (-2815.023) -- 0:03:18
617500 -- (-2824.149) (-2816.945) [-2817.418] (-2825.896) * (-2817.777) (-2816.781) (-2814.545) [-2813.999] -- 0:03:18
618000 -- [-2812.598] (-2816.790) (-2832.637) (-2821.970) * [-2815.649] (-2807.473) (-2818.886) (-2816.103) -- 0:03:17
618500 -- (-2809.084) (-2819.132) [-2818.771] (-2834.822) * (-2820.876) [-2810.230] (-2827.382) (-2817.943) -- 0:03:17
619000 -- [-2809.316] (-2810.800) (-2818.450) (-2824.249) * (-2829.878) [-2816.477] (-2821.708) (-2825.544) -- 0:03:17
619500 -- (-2814.588) (-2815.761) (-2817.904) [-2823.806] * [-2816.276] (-2826.247) (-2822.306) (-2817.500) -- 0:03:17
620000 -- (-2816.569) [-2817.070] (-2812.334) (-2817.372) * (-2818.471) (-2817.406) (-2814.815) [-2815.006] -- 0:03:16
Average standard deviation of split frequencies: 0.001772
620500 -- [-2817.741] (-2810.761) (-2813.057) (-2831.007) * (-2814.626) [-2819.459] (-2820.673) (-2816.857) -- 0:03:16
621000 -- (-2820.273) [-2807.842] (-2827.182) (-2821.947) * (-2818.198) (-2821.544) (-2820.878) [-2807.071] -- 0:03:16
621500 -- [-2817.662] (-2818.504) (-2816.051) (-2813.948) * (-2819.361) (-2821.971) [-2815.621] (-2813.682) -- 0:03:16
622000 -- (-2812.764) (-2818.638) [-2816.014] (-2815.617) * (-2816.925) (-2820.289) (-2809.619) [-2809.874] -- 0:03:15
622500 -- (-2826.227) (-2811.848) (-2816.049) [-2815.717] * (-2819.540) (-2814.415) [-2814.839] (-2814.016) -- 0:03:15
623000 -- (-2829.254) (-2811.719) (-2817.344) [-2811.157] * (-2825.654) (-2828.211) [-2817.996] (-2824.774) -- 0:03:15
623500 -- (-2818.384) [-2815.157] (-2811.657) (-2818.288) * (-2827.547) (-2816.481) [-2822.048] (-2817.629) -- 0:03:15
624000 -- (-2826.036) (-2816.734) (-2810.702) [-2810.979] * (-2817.941) (-2822.453) [-2813.202] (-2810.991) -- 0:03:14
624500 -- (-2815.044) (-2815.111) [-2807.533] (-2813.158) * (-2818.718) (-2817.446) (-2814.596) [-2812.706] -- 0:03:14
625000 -- (-2823.656) (-2812.244) [-2815.395] (-2818.148) * (-2829.871) [-2812.533] (-2811.022) (-2818.930) -- 0:03:14
Average standard deviation of split frequencies: 0.001506
625500 -- (-2815.738) (-2813.713) [-2820.365] (-2827.814) * (-2807.140) [-2814.046] (-2812.957) (-2812.028) -- 0:03:13
626000 -- [-2822.536] (-2820.069) (-2812.588) (-2819.131) * (-2818.495) (-2818.988) (-2821.490) [-2815.132] -- 0:03:13
626500 -- [-2812.036] (-2814.212) (-2816.457) (-2817.909) * (-2828.059) [-2819.360] (-2818.918) (-2817.593) -- 0:03:13
627000 -- (-2818.806) [-2817.041] (-2826.550) (-2816.134) * (-2811.208) (-2823.360) (-2810.892) [-2816.939] -- 0:03:13
627500 -- (-2813.414) (-2815.261) [-2816.176] (-2816.927) * (-2816.447) [-2820.060] (-2821.876) (-2815.931) -- 0:03:12
628000 -- (-2817.076) [-2811.388] (-2814.848) (-2809.155) * (-2810.668) (-2817.478) (-2811.819) [-2815.653] -- 0:03:12
628500 -- (-2813.137) [-2814.088] (-2807.760) (-2819.404) * (-2818.869) (-2813.694) [-2810.964] (-2817.293) -- 0:03:12
629000 -- (-2813.532) (-2820.853) [-2810.780] (-2816.131) * (-2814.974) (-2817.777) (-2812.202) [-2816.650] -- 0:03:12
629500 -- [-2810.977] (-2820.812) (-2826.151) (-2819.620) * (-2815.837) (-2817.433) [-2813.837] (-2833.140) -- 0:03:11
630000 -- (-2818.054) (-2820.031) [-2811.163] (-2824.455) * (-2822.499) (-2819.246) [-2808.584] (-2819.921) -- 0:03:11
Average standard deviation of split frequencies: 0.001910
630500 -- [-2820.027] (-2815.752) (-2813.047) (-2817.943) * (-2821.700) (-2821.223) (-2823.163) [-2821.024] -- 0:03:11
631000 -- (-2814.971) (-2820.157) (-2812.041) [-2818.843] * (-2829.547) [-2812.934] (-2816.904) (-2817.391) -- 0:03:11
631500 -- [-2815.271] (-2813.321) (-2818.077) (-2818.507) * (-2818.423) (-2817.784) (-2825.590) [-2811.710] -- 0:03:10
632000 -- [-2810.675] (-2814.930) (-2813.684) (-2815.729) * (-2812.096) [-2811.894] (-2824.274) (-2823.972) -- 0:03:10
632500 -- [-2812.592] (-2820.066) (-2823.158) (-2821.393) * (-2820.221) [-2813.925] (-2831.863) (-2816.029) -- 0:03:09
633000 -- (-2816.177) (-2824.358) (-2820.980) [-2813.343] * (-2820.408) (-2809.145) [-2814.797] (-2813.649) -- 0:03:10
633500 -- (-2817.194) (-2815.979) (-2822.920) [-2816.874] * (-2819.000) [-2809.488] (-2814.270) (-2807.511) -- 0:03:09
634000 -- (-2829.248) (-2813.138) [-2824.890] (-2819.874) * (-2814.590) [-2816.142] (-2820.883) (-2831.430) -- 0:03:09
634500 -- [-2816.016] (-2811.863) (-2819.673) (-2819.809) * [-2812.409] (-2822.312) (-2811.624) (-2822.793) -- 0:03:08
635000 -- (-2813.250) [-2815.370] (-2834.370) (-2810.114) * [-2812.471] (-2816.870) (-2812.608) (-2823.094) -- 0:03:09
Average standard deviation of split frequencies: 0.001565
635500 -- [-2814.125] (-2821.575) (-2811.152) (-2817.619) * (-2820.209) [-2809.919] (-2818.466) (-2831.294) -- 0:03:08
636000 -- (-2812.376) (-2819.151) (-2819.463) [-2805.459] * [-2823.038] (-2812.672) (-2816.538) (-2829.602) -- 0:03:08
636500 -- (-2821.093) [-2813.854] (-2813.591) (-2811.503) * (-2819.563) (-2809.471) [-2820.277] (-2831.632) -- 0:03:07
637000 -- (-2822.834) [-2810.330] (-2819.256) (-2816.802) * [-2810.709] (-2815.050) (-2826.699) (-2815.894) -- 0:03:08
637500 -- [-2817.269] (-2820.809) (-2811.777) (-2814.182) * [-2815.963] (-2820.599) (-2819.049) (-2828.016) -- 0:03:07
638000 -- [-2812.828] (-2820.077) (-2814.757) (-2813.080) * (-2817.619) (-2815.779) [-2818.715] (-2820.175) -- 0:03:07
638500 -- (-2813.989) (-2831.384) [-2816.049] (-2817.176) * (-2815.197) [-2816.614] (-2834.521) (-2831.746) -- 0:03:06
639000 -- [-2812.934] (-2822.278) (-2816.938) (-2825.743) * (-2822.463) [-2817.065] (-2811.272) (-2822.222) -- 0:03:06
639500 -- (-2809.662) (-2819.710) (-2813.864) [-2814.311] * (-2807.200) (-2815.194) [-2816.905] (-2820.971) -- 0:03:06
640000 -- [-2810.536] (-2814.472) (-2815.781) (-2825.135) * [-2814.680] (-2829.877) (-2821.810) (-2816.591) -- 0:03:06
Average standard deviation of split frequencies: 0.002207
640500 -- [-2814.941] (-2816.562) (-2820.782) (-2812.096) * [-2811.537] (-2825.438) (-2815.556) (-2819.238) -- 0:03:06
641000 -- (-2818.679) (-2818.767) [-2817.663] (-2815.905) * (-2819.962) (-2815.218) [-2815.057] (-2816.481) -- 0:03:05
641500 -- (-2824.645) (-2816.747) (-2820.239) [-2814.196] * [-2819.293] (-2813.636) (-2818.335) (-2822.291) -- 0:03:05
642000 -- (-2817.482) [-2817.625] (-2813.358) (-2819.572) * (-2818.255) [-2813.841] (-2812.829) (-2817.046) -- 0:03:05
642500 -- [-2817.523] (-2811.195) (-2820.168) (-2811.077) * [-2816.680] (-2812.897) (-2817.654) (-2835.693) -- 0:03:05
643000 -- (-2823.657) (-2813.187) [-2810.339] (-2811.332) * [-2811.140] (-2819.173) (-2820.851) (-2813.857) -- 0:03:04
643500 -- [-2817.044] (-2811.251) (-2817.395) (-2818.014) * (-2810.678) [-2810.874] (-2808.226) (-2820.343) -- 0:03:04
644000 -- (-2814.467) [-2819.943] (-2820.832) (-2818.438) * (-2821.354) (-2813.469) [-2822.830] (-2822.176) -- 0:03:04
644500 -- [-2809.656] (-2824.808) (-2818.236) (-2828.930) * (-2821.156) [-2809.983] (-2816.563) (-2813.788) -- 0:03:04
645000 -- (-2815.693) (-2823.425) (-2819.839) [-2810.809] * (-2813.262) [-2814.573] (-2819.650) (-2813.172) -- 0:03:03
Average standard deviation of split frequencies: 0.002027
645500 -- (-2809.033) (-2812.895) [-2810.599] (-2817.576) * (-2823.160) (-2822.368) (-2818.575) [-2811.817] -- 0:03:03
646000 -- [-2822.163] (-2818.487) (-2812.687) (-2826.765) * (-2824.993) (-2818.884) [-2814.165] (-2825.417) -- 0:03:03
646500 -- (-2814.544) [-2820.454] (-2812.365) (-2816.671) * [-2816.483] (-2829.936) (-2818.233) (-2812.665) -- 0:03:03
647000 -- (-2817.369) (-2825.557) [-2811.806] (-2824.629) * (-2818.481) (-2816.263) (-2815.614) [-2813.929] -- 0:03:02
647500 -- (-2818.619) [-2814.802] (-2809.681) (-2821.064) * (-2819.900) [-2810.311] (-2816.893) (-2817.765) -- 0:03:02
648000 -- (-2814.384) (-2824.619) (-2807.135) [-2816.654] * [-2809.417] (-2823.983) (-2820.959) (-2808.291) -- 0:03:01
648500 -- (-2820.763) (-2826.668) (-2812.726) [-2810.839] * (-2813.222) (-2816.116) [-2814.699] (-2812.637) -- 0:03:02
649000 -- (-2821.309) (-2824.973) [-2814.599] (-2815.502) * (-2821.953) (-2817.526) [-2812.674] (-2821.178) -- 0:03:01
649500 -- [-2818.139] (-2816.580) (-2815.888) (-2814.074) * (-2835.453) (-2819.707) [-2818.599] (-2819.800) -- 0:03:01
650000 -- (-2812.659) (-2827.213) (-2812.662) [-2825.153] * (-2827.652) (-2820.630) [-2814.178] (-2821.352) -- 0:03:00
Average standard deviation of split frequencies: 0.001851
650500 -- (-2816.563) [-2815.968] (-2818.870) (-2814.154) * (-2814.513) [-2816.482] (-2822.628) (-2815.123) -- 0:03:01
651000 -- (-2824.294) [-2811.501] (-2821.342) (-2812.189) * (-2821.150) (-2823.461) (-2818.169) [-2812.958] -- 0:03:00
651500 -- (-2815.378) [-2811.672] (-2812.128) (-2822.631) * (-2815.041) (-2812.674) (-2832.855) [-2815.961] -- 0:03:00
652000 -- [-2821.066] (-2822.286) (-2824.129) (-2810.253) * (-2819.971) (-2821.242) (-2812.159) [-2814.239] -- 0:02:59
652500 -- (-2818.808) [-2814.345] (-2816.646) (-2812.447) * (-2821.285) [-2814.514] (-2819.588) (-2814.110) -- 0:03:00
653000 -- (-2836.586) (-2811.053) (-2812.529) [-2814.764] * (-2813.539) (-2812.414) [-2813.253] (-2820.823) -- 0:02:59
653500 -- (-2819.494) (-2829.452) [-2810.760] (-2811.649) * [-2811.562] (-2815.303) (-2811.849) (-2815.034) -- 0:02:59
654000 -- (-2826.606) (-2821.019) (-2817.465) [-2810.482] * (-2819.912) [-2816.394] (-2817.004) (-2819.450) -- 0:02:58
654500 -- [-2817.300] (-2817.383) (-2824.120) (-2814.778) * (-2821.640) (-2819.161) [-2814.770] (-2816.549) -- 0:02:58
655000 -- [-2822.820] (-2826.393) (-2820.557) (-2812.644) * (-2821.805) [-2826.915] (-2826.143) (-2819.830) -- 0:02:58
Average standard deviation of split frequencies: 0.001836
655500 -- (-2824.718) [-2813.248] (-2816.236) (-2816.957) * (-2811.297) (-2823.949) [-2813.638] (-2825.271) -- 0:02:58
656000 -- (-2823.502) (-2808.574) (-2810.224) [-2816.872] * [-2812.882] (-2822.071) (-2811.655) (-2827.400) -- 0:02:57
656500 -- (-2821.327) (-2815.855) [-2809.569] (-2822.248) * [-2824.986] (-2816.131) (-2816.627) (-2820.278) -- 0:02:57
657000 -- (-2816.231) [-2808.680] (-2815.494) (-2809.199) * (-2816.807) (-2817.123) (-2820.178) [-2824.309] -- 0:02:57
657500 -- [-2814.880] (-2822.790) (-2816.423) (-2814.359) * [-2816.104] (-2816.206) (-2818.211) (-2818.617) -- 0:02:57
658000 -- (-2816.736) (-2817.869) (-2817.494) [-2808.034] * [-2817.771] (-2815.169) (-2814.868) (-2811.300) -- 0:02:57
658500 -- [-2817.895] (-2820.674) (-2822.164) (-2820.511) * (-2832.534) [-2818.586] (-2826.511) (-2825.084) -- 0:02:56
659000 -- [-2807.648] (-2823.373) (-2812.589) (-2814.110) * (-2825.683) [-2822.468] (-2827.873) (-2821.028) -- 0:02:56
659500 -- (-2826.909) (-2817.163) [-2814.351] (-2822.142) * (-2826.292) [-2807.586] (-2817.484) (-2826.110) -- 0:02:56
660000 -- [-2811.796] (-2814.154) (-2815.601) (-2823.999) * (-2815.308) (-2811.035) [-2812.067] (-2827.106) -- 0:02:56
Average standard deviation of split frequencies: 0.001823
660500 -- (-2818.224) (-2828.156) [-2810.252] (-2827.395) * (-2818.609) [-2814.062] (-2820.038) (-2829.200) -- 0:02:55
661000 -- [-2814.406] (-2819.728) (-2816.114) (-2819.178) * (-2817.625) [-2814.998] (-2821.906) (-2831.296) -- 0:02:55
661500 -- [-2814.649] (-2830.800) (-2813.310) (-2814.773) * (-2821.527) (-2817.519) [-2817.489] (-2816.247) -- 0:02:55
662000 -- (-2817.237) (-2822.250) [-2812.346] (-2816.447) * (-2817.956) (-2813.592) [-2810.274] (-2818.461) -- 0:02:55
662500 -- [-2819.937] (-2825.930) (-2818.511) (-2815.333) * (-2815.674) [-2810.561] (-2813.624) (-2818.878) -- 0:02:54
663000 -- (-2813.569) (-2815.057) [-2823.459] (-2835.407) * (-2814.110) [-2813.988] (-2820.162) (-2816.175) -- 0:02:54
663500 -- (-2818.121) [-2814.080] (-2812.714) (-2814.214) * (-2816.133) [-2819.787] (-2827.792) (-2818.162) -- 0:02:53
664000 -- [-2812.245] (-2812.240) (-2817.013) (-2816.242) * [-2821.302] (-2824.636) (-2826.179) (-2821.150) -- 0:02:54
664500 -- (-2818.782) (-2826.719) [-2818.454] (-2820.617) * (-2817.795) [-2817.896] (-2824.962) (-2828.885) -- 0:02:53
665000 -- (-2819.091) (-2816.870) (-2812.625) [-2813.383] * (-2814.854) (-2813.994) (-2827.459) [-2822.115] -- 0:02:53
Average standard deviation of split frequencies: 0.001809
665500 -- (-2817.060) (-2808.919) [-2811.575] (-2814.177) * (-2819.470) (-2816.452) (-2823.177) [-2814.917] -- 0:02:52
666000 -- (-2814.213) (-2816.796) [-2810.097] (-2811.353) * (-2828.390) (-2816.368) (-2818.469) [-2809.273] -- 0:02:53
666500 -- (-2818.498) (-2815.620) (-2810.791) [-2814.813] * (-2821.286) (-2811.863) (-2827.328) [-2817.672] -- 0:02:52
667000 -- (-2819.498) (-2822.126) [-2810.423] (-2825.752) * (-2814.929) [-2812.761] (-2818.932) (-2821.862) -- 0:02:52
667500 -- [-2814.903] (-2819.294) (-2814.920) (-2829.503) * (-2814.814) (-2830.176) (-2811.519) [-2816.663] -- 0:02:51
668000 -- (-2812.861) (-2821.814) (-2812.520) [-2816.383] * (-2822.795) (-2811.359) [-2818.680] (-2811.091) -- 0:02:51
668500 -- [-2810.446] (-2812.824) (-2814.998) (-2818.505) * (-2811.850) (-2822.615) [-2815.108] (-2819.212) -- 0:02:51
669000 -- (-2811.217) (-2825.785) [-2815.790] (-2819.269) * [-2812.094] (-2823.481) (-2815.167) (-2819.276) -- 0:02:51
669500 -- (-2814.483) [-2816.544] (-2813.777) (-2817.664) * (-2813.320) (-2812.904) [-2814.856] (-2828.844) -- 0:02:50
670000 -- (-2821.094) [-2822.202] (-2814.198) (-2817.361) * (-2823.075) (-2814.544) [-2809.648] (-2811.322) -- 0:02:50
Average standard deviation of split frequencies: 0.002265
670500 -- (-2817.305) [-2812.743] (-2817.526) (-2820.711) * (-2813.145) [-2814.832] (-2819.360) (-2815.566) -- 0:02:50
671000 -- (-2815.717) (-2826.028) (-2818.893) [-2813.727] * (-2824.508) (-2815.214) [-2808.755] (-2810.263) -- 0:02:50
671500 -- (-2821.081) (-2822.884) [-2813.774] (-2822.270) * (-2814.472) (-2810.754) (-2820.817) [-2812.404] -- 0:02:49
672000 -- (-2817.149) (-2827.357) (-2820.633) [-2817.003] * (-2816.058) (-2807.316) [-2823.013] (-2814.748) -- 0:02:49
672500 -- [-2816.480] (-2815.288) (-2820.985) (-2821.193) * (-2825.960) [-2810.314] (-2814.821) (-2831.134) -- 0:02:49
673000 -- (-2820.219) [-2816.139] (-2821.369) (-2818.130) * (-2812.263) (-2812.743) [-2814.651] (-2817.237) -- 0:02:49
673500 -- (-2817.758) [-2818.076] (-2813.442) (-2820.315) * (-2820.366) (-2815.882) (-2823.813) [-2817.883] -- 0:02:48
674000 -- (-2813.659) (-2811.751) (-2817.637) [-2819.606] * (-2823.168) [-2814.966] (-2813.267) (-2814.842) -- 0:02:48
674500 -- [-2812.914] (-2814.834) (-2817.745) (-2823.630) * (-2821.837) (-2820.972) (-2816.002) [-2818.062] -- 0:02:48
675000 -- (-2825.475) [-2812.661] (-2818.090) (-2818.734) * (-2822.625) [-2809.394] (-2828.797) (-2823.131) -- 0:02:48
Average standard deviation of split frequencies: 0.002479
675500 -- [-2808.048] (-2821.868) (-2821.444) (-2823.419) * (-2825.790) (-2823.548) [-2817.634] (-2820.131) -- 0:02:47
676000 -- (-2815.029) (-2820.509) (-2810.015) [-2811.144] * (-2822.871) (-2811.668) (-2816.583) [-2808.144] -- 0:02:47
676500 -- (-2827.465) (-2812.345) [-2822.800] (-2816.622) * (-2814.902) (-2827.374) [-2811.649] (-2811.321) -- 0:02:47
677000 -- (-2815.704) (-2816.051) [-2820.797] (-2813.748) * (-2816.524) (-2823.967) (-2812.346) [-2812.541] -- 0:02:46
677500 -- (-2821.434) (-2818.523) (-2817.019) [-2810.459] * (-2818.754) (-2814.040) [-2811.130] (-2820.137) -- 0:02:47
678000 -- [-2810.766] (-2823.182) (-2816.838) (-2812.841) * (-2826.799) (-2816.393) [-2811.053] (-2825.728) -- 0:02:46
678500 -- (-2818.547) (-2817.214) [-2815.841] (-2818.912) * (-2818.432) (-2817.161) [-2818.517] (-2812.640) -- 0:02:46
679000 -- (-2816.754) (-2813.844) [-2813.895] (-2827.845) * (-2819.251) (-2811.222) (-2817.573) [-2810.594] -- 0:02:45
679500 -- (-2820.887) (-2814.984) (-2809.389) [-2815.561] * [-2816.070] (-2824.134) (-2817.385) (-2816.106) -- 0:02:46
680000 -- [-2814.086] (-2831.708) (-2817.128) (-2818.862) * (-2817.217) (-2818.904) (-2815.372) [-2816.195] -- 0:02:45
Average standard deviation of split frequencies: 0.002693
680500 -- [-2808.282] (-2825.282) (-2816.648) (-2813.324) * (-2819.772) [-2816.772] (-2816.967) (-2809.412) -- 0:02:45
681000 -- (-2815.800) (-2812.165) [-2808.156] (-2814.474) * (-2810.046) (-2823.389) (-2818.852) [-2820.596] -- 0:02:44
681500 -- (-2817.308) (-2811.107) (-2822.578) [-2818.033] * [-2812.959] (-2820.280) (-2812.953) (-2816.847) -- 0:02:44
682000 -- (-2819.672) (-2822.050) (-2816.371) [-2809.509] * (-2813.809) (-2819.050) (-2816.023) [-2820.782] -- 0:02:44
682500 -- (-2821.655) (-2818.903) (-2818.305) [-2822.862] * (-2817.154) (-2823.275) (-2815.891) [-2819.948] -- 0:02:44
683000 -- [-2815.119] (-2814.836) (-2813.977) (-2816.567) * (-2809.254) (-2813.335) [-2812.486] (-2812.411) -- 0:02:43
683500 -- [-2815.798] (-2808.562) (-2817.269) (-2819.081) * (-2816.588) [-2816.500] (-2822.868) (-2815.685) -- 0:02:43
684000 -- (-2826.758) [-2811.984] (-2823.789) (-2814.418) * (-2820.753) [-2814.406] (-2817.005) (-2821.281) -- 0:02:43
684500 -- (-2819.767) [-2808.579] (-2829.103) (-2817.698) * (-2816.184) (-2810.576) [-2818.977] (-2815.684) -- 0:02:43
685000 -- (-2820.048) (-2824.676) (-2828.324) [-2818.117] * (-2814.832) [-2812.696] (-2818.738) (-2824.626) -- 0:02:42
Average standard deviation of split frequencies: 0.002749
685500 -- (-2805.792) (-2820.714) (-2814.496) [-2814.099] * [-2813.314] (-2813.678) (-2820.486) (-2810.910) -- 0:02:42
686000 -- (-2815.153) (-2818.204) (-2816.550) [-2821.650] * [-2824.211] (-2816.204) (-2814.480) (-2815.865) -- 0:02:42
686500 -- (-2819.800) [-2808.271] (-2818.154) (-2816.935) * (-2819.427) (-2822.388) (-2820.388) [-2818.255] -- 0:02:42
687000 -- [-2815.717] (-2822.330) (-2819.239) (-2820.752) * (-2822.401) (-2819.143) (-2825.242) [-2818.964] -- 0:02:41
687500 -- (-2822.844) [-2816.329] (-2824.861) (-2819.277) * (-2815.588) [-2815.529] (-2813.403) (-2811.686) -- 0:02:41
688000 -- [-2821.257] (-2815.814) (-2820.753) (-2823.049) * (-2824.751) (-2811.751) (-2826.046) [-2808.477] -- 0:02:41
688500 -- (-2821.060) (-2818.152) (-2810.014) [-2816.111] * [-2810.494] (-2817.979) (-2816.263) (-2813.428) -- 0:02:41
689000 -- (-2835.409) (-2819.721) [-2812.809] (-2811.387) * (-2811.179) (-2817.005) (-2815.281) [-2813.502] -- 0:02:40
689500 -- [-2822.559] (-2818.470) (-2814.171) (-2817.976) * (-2814.461) (-2822.042) [-2818.624] (-2817.526) -- 0:02:40
690000 -- [-2818.160] (-2814.542) (-2822.940) (-2813.455) * [-2811.682] (-2812.431) (-2814.930) (-2823.657) -- 0:02:40
Average standard deviation of split frequencies: 0.003109
690500 -- (-2830.022) [-2818.428] (-2821.588) (-2815.559) * (-2810.530) [-2810.896] (-2824.773) (-2818.417) -- 0:02:40
691000 -- [-2814.065] (-2821.496) (-2820.134) (-2818.924) * (-2820.882) (-2811.460) (-2817.186) [-2811.189] -- 0:02:39
691500 -- (-2816.586) [-2815.590] (-2810.146) (-2820.638) * (-2816.593) (-2810.344) (-2831.673) [-2809.095] -- 0:02:39
692000 -- (-2821.433) (-2816.455) [-2810.425] (-2816.064) * (-2823.226) [-2812.352] (-2816.638) (-2812.521) -- 0:02:39
692500 -- (-2818.907) (-2820.300) (-2821.126) [-2815.133] * (-2822.797) (-2818.046) (-2809.212) [-2810.575] -- 0:02:38
693000 -- [-2822.875] (-2820.252) (-2833.164) (-2808.167) * [-2817.012] (-2808.185) (-2814.039) (-2824.828) -- 0:02:38
693500 -- (-2816.236) (-2824.756) (-2813.644) [-2816.666] * (-2820.908) [-2806.893] (-2816.144) (-2818.531) -- 0:02:38
694000 -- (-2821.915) (-2817.014) [-2818.129] (-2825.275) * (-2814.785) [-2815.083] (-2815.867) (-2815.989) -- 0:02:38
694500 -- (-2808.078) (-2826.624) [-2813.929] (-2823.077) * (-2821.704) (-2819.278) (-2812.214) [-2807.790] -- 0:02:37
695000 -- [-2814.410] (-2820.821) (-2821.792) (-2815.865) * (-2815.652) [-2814.935] (-2821.400) (-2815.124) -- 0:02:37
Average standard deviation of split frequencies: 0.002784
695500 -- (-2829.105) (-2819.358) [-2816.197] (-2816.817) * (-2813.171) (-2814.858) [-2814.162] (-2813.992) -- 0:02:37
696000 -- (-2839.250) (-2818.520) (-2813.816) [-2827.335] * [-2822.623] (-2818.815) (-2820.659) (-2813.444) -- 0:02:37
696500 -- [-2832.226] (-2824.420) (-2817.240) (-2817.928) * (-2819.804) (-2817.840) (-2819.354) [-2825.922] -- 0:02:36
697000 -- (-2818.338) (-2817.427) [-2826.128] (-2818.758) * (-2823.537) [-2823.563] (-2808.371) (-2813.499) -- 0:02:36
697500 -- (-2825.787) (-2829.357) [-2824.188] (-2817.882) * (-2817.088) (-2825.624) [-2813.082] (-2818.481) -- 0:02:36
698000 -- [-2816.813] (-2820.015) (-2818.144) (-2811.832) * [-2814.247] (-2818.464) (-2812.333) (-2818.745) -- 0:02:36
698500 -- (-2820.419) (-2812.177) [-2813.940] (-2819.066) * (-2825.317) (-2820.198) [-2813.763] (-2815.184) -- 0:02:35
699000 -- (-2811.388) (-2814.007) [-2816.693] (-2816.235) * (-2825.818) [-2815.892] (-2813.071) (-2820.330) -- 0:02:35
699500 -- [-2828.884] (-2814.150) (-2818.188) (-2828.281) * (-2827.130) (-2812.549) (-2816.639) [-2812.380] -- 0:02:35
700000 -- [-2815.020] (-2832.599) (-2825.371) (-2813.286) * (-2827.752) (-2815.394) [-2811.368] (-2813.069) -- 0:02:35
Average standard deviation of split frequencies: 0.003214
700500 -- (-2817.261) (-2834.934) [-2814.216] (-2824.916) * (-2823.742) (-2814.812) (-2813.410) [-2816.256] -- 0:02:34
701000 -- (-2814.944) (-2836.540) [-2821.411] (-2809.312) * [-2820.914] (-2817.363) (-2822.823) (-2827.172) -- 0:02:34
701500 -- (-2811.597) (-2814.668) [-2812.568] (-2823.209) * (-2811.351) (-2817.515) (-2822.396) [-2817.605] -- 0:02:34
702000 -- (-2828.902) (-2818.237) [-2818.219] (-2817.297) * (-2824.071) [-2829.499] (-2810.398) (-2823.620) -- 0:02:34
702500 -- (-2817.984) (-2824.404) (-2819.655) [-2812.143] * (-2819.822) [-2810.843] (-2814.245) (-2827.088) -- 0:02:33
703000 -- (-2815.610) (-2826.137) (-2818.623) [-2810.093] * (-2814.174) (-2813.679) (-2817.082) [-2810.943] -- 0:02:33
703500 -- (-2815.105) (-2811.156) (-2823.157) [-2818.275] * [-2816.113] (-2820.170) (-2816.956) (-2823.887) -- 0:02:33
704000 -- [-2820.415] (-2821.074) (-2826.570) (-2816.637) * [-2813.432] (-2824.177) (-2813.865) (-2826.473) -- 0:02:33
704500 -- (-2813.537) [-2820.097] (-2826.002) (-2815.597) * (-2819.959) (-2819.504) (-2829.738) [-2809.428] -- 0:02:32
705000 -- (-2814.795) [-2817.208] (-2818.239) (-2819.301) * (-2813.087) (-2819.802) (-2827.526) [-2814.807] -- 0:02:32
Average standard deviation of split frequencies: 0.003710
705500 -- (-2818.375) (-2825.909) [-2812.381] (-2826.020) * [-2816.897] (-2825.462) (-2814.502) (-2812.892) -- 0:02:32
706000 -- (-2826.859) (-2823.329) (-2810.417) [-2809.355] * (-2810.731) [-2811.533] (-2817.004) (-2814.115) -- 0:02:31
706500 -- [-2811.156] (-2817.453) (-2813.612) (-2822.975) * (-2809.976) (-2812.968) [-2820.817] (-2828.528) -- 0:02:31
707000 -- [-2810.774] (-2814.847) (-2814.886) (-2815.705) * (-2812.161) [-2808.231] (-2822.403) (-2814.255) -- 0:02:31
707500 -- [-2812.850] (-2818.315) (-2819.587) (-2831.459) * (-2814.903) (-2821.492) (-2814.841) [-2808.660] -- 0:02:31
708000 -- (-2812.398) [-2817.565] (-2836.457) (-2807.728) * (-2811.890) [-2813.609] (-2816.935) (-2816.960) -- 0:02:30
708500 -- (-2813.369) (-2819.251) (-2822.644) [-2813.060] * [-2818.126] (-2823.881) (-2813.906) (-2820.776) -- 0:02:30
709000 -- (-2816.997) (-2820.675) (-2814.556) [-2811.344] * (-2813.464) (-2821.233) (-2816.181) [-2810.894] -- 0:02:30
709500 -- (-2820.546) (-2827.510) [-2823.764] (-2817.723) * (-2814.654) [-2809.938] (-2819.939) (-2806.874) -- 0:02:30
710000 -- (-2816.436) [-2807.713] (-2816.895) (-2808.700) * (-2817.343) [-2807.419] (-2818.917) (-2818.818) -- 0:02:29
Average standard deviation of split frequencies: 0.003980
710500 -- (-2825.306) (-2819.414) [-2819.331] (-2811.755) * [-2811.823] (-2811.282) (-2816.438) (-2809.493) -- 0:02:29
711000 -- (-2822.240) [-2817.331] (-2814.694) (-2821.791) * (-2816.650) (-2813.940) [-2821.959] (-2820.458) -- 0:02:29
711500 -- (-2827.247) (-2817.623) [-2814.981] (-2811.965) * (-2820.846) (-2817.323) [-2817.727] (-2817.764) -- 0:02:29
712000 -- (-2823.048) (-2815.500) [-2810.568] (-2817.615) * [-2810.920] (-2811.457) (-2812.967) (-2817.135) -- 0:02:28
712500 -- (-2817.839) [-2815.042] (-2815.573) (-2819.197) * [-2811.668] (-2817.261) (-2815.186) (-2811.701) -- 0:02:28
713000 -- (-2830.807) (-2810.345) [-2806.711] (-2827.765) * [-2821.056] (-2813.049) (-2819.716) (-2825.445) -- 0:02:28
713500 -- (-2813.757) (-2809.979) [-2814.791] (-2813.034) * [-2818.852] (-2812.001) (-2815.374) (-2814.236) -- 0:02:28
714000 -- [-2821.923] (-2816.837) (-2817.211) (-2818.250) * (-2817.690) (-2828.029) [-2808.403] (-2812.325) -- 0:02:27
714500 -- (-2821.110) (-2821.066) [-2820.199] (-2811.562) * (-2818.729) (-2827.698) [-2810.206] (-2812.720) -- 0:02:27
715000 -- (-2818.796) (-2821.594) [-2825.164] (-2816.543) * (-2819.340) [-2818.882] (-2815.413) (-2807.435) -- 0:02:27
Average standard deviation of split frequencies: 0.003585
715500 -- (-2811.509) (-2826.962) (-2817.905) [-2823.100] * [-2814.807] (-2818.438) (-2813.393) (-2812.109) -- 0:02:27
716000 -- (-2826.440) (-2829.809) [-2812.442] (-2818.230) * (-2823.249) (-2812.848) (-2819.716) [-2811.423] -- 0:02:26
716500 -- (-2813.959) (-2823.489) [-2814.355] (-2818.591) * (-2827.502) (-2821.194) [-2815.100] (-2813.515) -- 0:02:26
717000 -- (-2817.372) (-2818.402) (-2823.106) [-2808.765] * (-2826.343) [-2819.118] (-2829.297) (-2812.899) -- 0:02:26
717500 -- (-2814.138) [-2812.002] (-2818.631) (-2816.694) * (-2821.136) (-2819.267) (-2823.711) [-2813.186] -- 0:02:26
718000 -- (-2814.245) (-2816.564) (-2813.351) [-2813.907] * (-2814.230) [-2816.984] (-2814.788) (-2815.554) -- 0:02:25
718500 -- (-2810.606) (-2816.751) [-2815.859] (-2818.080) * [-2820.371] (-2819.742) (-2812.418) (-2811.046) -- 0:02:25
719000 -- (-2818.721) [-2825.140] (-2816.239) (-2823.318) * (-2818.750) [-2819.694] (-2813.719) (-2815.302) -- 0:02:25
719500 -- [-2816.802] (-2829.501) (-2812.204) (-2818.575) * [-2811.761] (-2822.844) (-2821.849) (-2814.471) -- 0:02:25
720000 -- (-2825.867) [-2812.085] (-2822.879) (-2821.578) * [-2819.573] (-2826.912) (-2815.596) (-2816.716) -- 0:02:24
Average standard deviation of split frequencies: 0.003707
720500 -- [-2823.850] (-2818.168) (-2821.382) (-2812.206) * (-2821.469) (-2820.417) [-2817.215] (-2815.974) -- 0:02:24
721000 -- (-2820.846) (-2817.038) (-2816.240) [-2816.729] * [-2818.128] (-2824.601) (-2812.378) (-2822.796) -- 0:02:24
721500 -- (-2808.661) [-2807.183] (-2818.982) (-2820.443) * (-2816.380) (-2817.253) (-2815.609) [-2812.298] -- 0:02:23
722000 -- (-2814.033) (-2821.744) (-2820.807) [-2810.414] * (-2819.430) [-2813.602] (-2817.096) (-2818.315) -- 0:02:23
722500 -- [-2811.255] (-2833.998) (-2812.133) (-2810.987) * [-2820.132] (-2821.984) (-2812.238) (-2818.588) -- 0:02:23
723000 -- (-2824.013) (-2815.280) [-2821.442] (-2813.757) * (-2815.522) (-2819.841) [-2809.799] (-2822.425) -- 0:02:23
723500 -- (-2817.864) (-2818.962) (-2817.699) [-2819.018] * [-2815.090] (-2813.295) (-2824.866) (-2822.609) -- 0:02:22
724000 -- (-2834.630) (-2810.327) (-2820.628) [-2814.001] * [-2809.873] (-2817.148) (-2817.223) (-2812.442) -- 0:02:22
724500 -- (-2813.666) [-2812.789] (-2823.289) (-2831.735) * (-2817.877) (-2823.991) (-2807.348) [-2814.638] -- 0:02:22
725000 -- [-2812.685] (-2810.789) (-2822.008) (-2823.202) * [-2818.244] (-2824.369) (-2817.406) (-2811.088) -- 0:02:22
Average standard deviation of split frequencies: 0.003896
725500 -- (-2815.085) [-2803.354] (-2819.449) (-2820.087) * [-2814.022] (-2812.340) (-2821.575) (-2820.519) -- 0:02:21
726000 -- (-2825.245) [-2808.550] (-2818.415) (-2815.394) * (-2826.801) (-2816.851) [-2816.158] (-2818.887) -- 0:02:21
726500 -- [-2809.585] (-2813.850) (-2810.714) (-2815.998) * [-2812.870] (-2819.019) (-2819.454) (-2811.393) -- 0:02:21
727000 -- (-2811.841) (-2818.308) (-2815.006) [-2812.254] * [-2811.478] (-2817.748) (-2818.153) (-2824.330) -- 0:02:21
727500 -- (-2820.953) [-2815.392] (-2812.544) (-2818.453) * [-2810.308] (-2818.841) (-2814.293) (-2822.515) -- 0:02:20
728000 -- [-2814.427] (-2818.527) (-2818.766) (-2826.159) * (-2817.068) [-2813.697] (-2808.872) (-2829.646) -- 0:02:20
728500 -- (-2815.533) (-2814.220) (-2814.109) [-2814.099] * (-2809.143) (-2809.937) [-2807.936] (-2816.731) -- 0:02:20
729000 -- (-2816.159) (-2810.109) [-2814.897] (-2824.008) * [-2808.741] (-2829.065) (-2813.807) (-2821.927) -- 0:02:20
729500 -- (-2816.874) (-2817.228) [-2812.169] (-2826.772) * [-2811.233] (-2820.350) (-2814.241) (-2813.899) -- 0:02:19
730000 -- [-2816.231] (-2811.967) (-2824.240) (-2821.604) * (-2818.670) (-2819.346) (-2820.093) [-2821.311] -- 0:02:19
Average standard deviation of split frequencies: 0.003799
730500 -- (-2815.331) (-2814.919) [-2817.986] (-2818.859) * (-2811.778) [-2818.831] (-2818.220) (-2818.504) -- 0:02:19
731000 -- (-2815.485) (-2824.844) (-2827.795) [-2813.541] * (-2815.637) (-2819.540) [-2812.060] (-2816.550) -- 0:02:19
731500 -- [-2809.220] (-2818.413) (-2817.028) (-2824.072) * (-2823.710) (-2822.281) [-2817.703] (-2816.027) -- 0:02:18
732000 -- (-2813.950) (-2820.284) [-2812.868] (-2821.382) * (-2816.039) (-2816.045) [-2808.964] (-2817.793) -- 0:02:18
732500 -- (-2813.782) (-2818.104) (-2819.279) [-2814.435] * (-2816.491) (-2813.058) (-2812.744) [-2814.594] -- 0:02:18
733000 -- (-2819.250) (-2810.644) (-2819.513) [-2813.555] * [-2813.809] (-2811.646) (-2819.198) (-2815.330) -- 0:02:18
733500 -- [-2820.037] (-2811.475) (-2838.573) (-2815.225) * (-2819.210) (-2818.083) (-2825.808) [-2813.199] -- 0:02:17
734000 -- (-2822.593) (-2817.731) (-2819.703) [-2808.544] * (-2814.493) (-2818.195) (-2817.726) [-2814.004] -- 0:02:17
734500 -- (-2824.472) (-2817.000) (-2809.385) [-2814.209] * [-2812.774] (-2814.251) (-2820.246) (-2814.024) -- 0:02:17
735000 -- (-2820.994) (-2812.722) (-2815.506) [-2820.458] * (-2813.543) (-2814.335) (-2816.649) [-2811.841] -- 0:02:17
Average standard deviation of split frequencies: 0.003985
735500 -- (-2823.694) (-2822.978) [-2811.759] (-2817.216) * (-2812.985) [-2813.536] (-2813.738) (-2812.823) -- 0:02:16
736000 -- (-2819.397) (-2828.102) [-2815.209] (-2813.405) * (-2819.626) [-2814.661] (-2825.111) (-2822.642) -- 0:02:16
736500 -- (-2819.608) (-2816.568) [-2817.316] (-2817.819) * [-2812.680] (-2815.413) (-2813.035) (-2838.076) -- 0:02:16
737000 -- (-2815.830) (-2816.755) [-2812.312] (-2817.938) * (-2818.078) (-2811.792) [-2817.430] (-2835.453) -- 0:02:15
737500 -- (-2811.642) [-2814.131] (-2826.001) (-2819.076) * [-2818.588] (-2819.055) (-2829.411) (-2827.292) -- 0:02:15
738000 -- (-2812.763) (-2815.640) (-2819.984) [-2813.532] * (-2820.283) (-2809.414) (-2821.546) [-2815.646] -- 0:02:15
738500 -- (-2822.948) (-2816.712) (-2817.279) [-2811.387] * (-2819.711) (-2818.500) [-2816.168] (-2820.077) -- 0:02:15
739000 -- (-2821.110) (-2816.950) (-2818.815) [-2821.428] * (-2816.281) [-2809.294] (-2811.245) (-2819.107) -- 0:02:14
739500 -- [-2817.858] (-2816.344) (-2818.029) (-2820.012) * (-2813.893) [-2810.870] (-2813.510) (-2824.060) -- 0:02:14
740000 -- (-2813.586) (-2812.275) [-2819.055] (-2827.975) * [-2815.385] (-2819.151) (-2816.555) (-2828.152) -- 0:02:14
Average standard deviation of split frequencies: 0.003960
740500 -- (-2814.242) [-2809.798] (-2821.578) (-2819.872) * (-2820.794) (-2817.555) (-2817.077) [-2815.022] -- 0:02:14
741000 -- (-2822.624) (-2816.728) (-2824.006) [-2809.026] * [-2818.366] (-2813.935) (-2812.660) (-2809.225) -- 0:02:13
741500 -- (-2820.004) [-2815.838] (-2818.366) (-2816.127) * (-2818.970) [-2825.480] (-2811.845) (-2813.531) -- 0:02:13
742000 -- (-2814.901) (-2822.566) [-2819.796] (-2813.007) * (-2820.368) (-2812.970) [-2806.828] (-2816.590) -- 0:02:13
742500 -- (-2811.947) (-2832.784) (-2816.448) [-2812.698] * (-2827.924) (-2814.282) [-2818.550] (-2818.948) -- 0:02:13
743000 -- (-2808.876) (-2837.153) [-2819.263] (-2811.659) * [-2814.205] (-2812.811) (-2820.368) (-2820.308) -- 0:02:12
743500 -- (-2809.927) (-2831.904) [-2816.183] (-2825.580) * [-2820.089] (-2810.495) (-2816.732) (-2824.582) -- 0:02:12
744000 -- (-2815.741) (-2819.064) [-2816.978] (-2820.597) * (-2811.342) (-2826.801) (-2825.940) [-2823.067] -- 0:02:12
744500 -- [-2820.156] (-2820.530) (-2821.205) (-2816.110) * (-2812.234) [-2820.072] (-2814.417) (-2814.006) -- 0:02:12
745000 -- (-2817.990) [-2811.119] (-2811.961) (-2824.205) * [-2812.039] (-2820.139) (-2817.337) (-2825.940) -- 0:02:11
Average standard deviation of split frequencies: 0.004283
745500 -- (-2814.105) [-2811.424] (-2813.062) (-2827.241) * (-2813.423) [-2816.862] (-2817.781) (-2817.584) -- 0:02:11
746000 -- [-2817.869] (-2811.305) (-2818.747) (-2828.121) * (-2811.022) (-2816.280) [-2826.141] (-2820.263) -- 0:02:11
746500 -- (-2821.449) [-2816.515] (-2823.446) (-2831.415) * (-2825.261) (-2813.942) (-2816.887) [-2813.259] -- 0:02:11
747000 -- (-2824.855) (-2817.672) [-2804.869] (-2824.572) * (-2821.290) [-2814.548] (-2824.644) (-2809.074) -- 0:02:10
747500 -- (-2821.184) (-2815.845) (-2813.082) [-2823.945] * (-2811.641) (-2820.877) (-2821.724) [-2812.690] -- 0:02:10
748000 -- (-2816.562) (-2820.491) (-2819.887) [-2819.587] * [-2820.734] (-2818.740) (-2809.371) (-2824.423) -- 0:02:10
748500 -- (-2824.159) (-2815.442) (-2817.763) [-2811.426] * (-2814.780) (-2817.693) (-2809.441) [-2806.681] -- 0:02:10
749000 -- (-2820.449) (-2816.949) (-2815.742) [-2818.526] * (-2815.378) (-2815.030) [-2819.734] (-2816.829) -- 0:02:09
749500 -- (-2808.704) [-2810.955] (-2825.798) (-2816.339) * (-2815.315) (-2813.622) [-2811.415] (-2819.703) -- 0:02:09
750000 -- (-2817.675) [-2816.417] (-2819.191) (-2814.789) * (-2835.472) [-2814.446] (-2814.931) (-2816.633) -- 0:02:09
Average standard deviation of split frequencies: 0.003977
750500 -- (-2819.370) (-2829.206) (-2820.150) [-2813.551] * [-2823.721] (-2821.991) (-2821.818) (-2815.072) -- 0:02:08
751000 -- [-2812.295] (-2822.241) (-2808.869) (-2818.408) * (-2816.328) [-2821.675] (-2815.235) (-2817.517) -- 0:02:08
751500 -- (-2816.434) [-2818.536] (-2812.642) (-2813.631) * (-2821.681) (-2826.829) [-2816.108] (-2822.256) -- 0:02:08
752000 -- [-2814.176] (-2821.397) (-2813.575) (-2811.975) * (-2817.864) (-2815.998) [-2816.160] (-2816.694) -- 0:02:08
752500 -- [-2814.791] (-2821.652) (-2815.220) (-2832.267) * [-2814.572] (-2815.735) (-2814.797) (-2816.270) -- 0:02:07
753000 -- (-2816.864) (-2819.900) (-2817.490) [-2819.211] * (-2818.858) (-2815.067) [-2808.309] (-2821.880) -- 0:02:07
753500 -- (-2825.019) [-2811.219] (-2815.917) (-2811.198) * (-2827.262) [-2806.942] (-2814.214) (-2836.833) -- 0:02:07
754000 -- [-2810.472] (-2815.318) (-2819.274) (-2821.107) * [-2824.788] (-2816.299) (-2818.406) (-2819.323) -- 0:02:07
754500 -- (-2816.185) (-2824.618) [-2814.975] (-2827.351) * (-2824.936) (-2820.131) (-2821.726) [-2826.612] -- 0:02:06
755000 -- (-2819.920) (-2817.402) [-2816.877] (-2830.001) * (-2819.153) [-2814.405] (-2815.823) (-2815.960) -- 0:02:06
Average standard deviation of split frequencies: 0.003533
755500 -- [-2816.391] (-2811.111) (-2819.992) (-2813.933) * [-2815.725] (-2815.627) (-2808.769) (-2818.805) -- 0:02:06
756000 -- [-2821.702] (-2820.882) (-2826.794) (-2807.378) * [-2818.676] (-2818.977) (-2816.427) (-2810.658) -- 0:02:06
756500 -- [-2809.391] (-2815.456) (-2816.762) (-2810.371) * [-2817.878] (-2826.004) (-2817.131) (-2820.029) -- 0:02:05
757000 -- [-2816.628] (-2826.381) (-2816.086) (-2814.156) * (-2821.638) [-2816.777] (-2821.175) (-2819.444) -- 0:02:05
757500 -- (-2810.230) (-2813.207) [-2813.165] (-2816.910) * [-2812.719] (-2813.483) (-2816.211) (-2817.110) -- 0:02:05
758000 -- (-2811.358) (-2816.558) (-2813.273) [-2813.554] * [-2822.382] (-2813.394) (-2828.234) (-2816.732) -- 0:02:05
758500 -- (-2820.990) [-2805.090] (-2815.753) (-2823.264) * [-2827.633] (-2816.423) (-2818.477) (-2822.213) -- 0:02:04
759000 -- [-2812.597] (-2823.810) (-2807.280) (-2814.847) * (-2836.073) (-2821.272) [-2814.356] (-2814.158) -- 0:02:04
759500 -- (-2822.383) [-2809.151] (-2812.537) (-2818.857) * (-2822.561) (-2810.689) [-2808.574] (-2814.236) -- 0:02:04
760000 -- [-2809.119] (-2816.879) (-2817.524) (-2815.221) * (-2825.089) (-2814.036) [-2810.596] (-2816.653) -- 0:02:04
Average standard deviation of split frequencies: 0.003443
760500 -- (-2815.859) [-2817.416] (-2817.482) (-2824.287) * (-2811.427) (-2820.405) [-2811.728] (-2822.146) -- 0:02:03
761000 -- (-2813.976) (-2815.886) [-2815.645] (-2823.407) * (-2822.799) (-2813.997) [-2815.048] (-2820.991) -- 0:02:03
761500 -- (-2818.428) (-2816.016) (-2824.235) [-2809.550] * (-2814.523) [-2812.768] (-2810.983) (-2821.594) -- 0:02:03
762000 -- [-2816.687] (-2816.391) (-2820.419) (-2815.938) * [-2821.405] (-2813.837) (-2813.936) (-2824.539) -- 0:02:03
762500 -- (-2819.917) (-2815.104) [-2826.223] (-2818.902) * (-2835.339) (-2816.266) [-2813.878] (-2822.656) -- 0:02:02
763000 -- (-2810.887) (-2814.760) [-2823.307] (-2816.466) * (-2826.622) [-2817.247] (-2809.438) (-2817.125) -- 0:02:02
763500 -- (-2820.702) (-2816.463) [-2813.068] (-2818.305) * (-2813.625) [-2816.242] (-2814.049) (-2820.575) -- 0:02:02
764000 -- (-2821.714) [-2810.638] (-2818.098) (-2820.279) * (-2814.185) [-2818.135] (-2819.976) (-2830.849) -- 0:02:02
764500 -- (-2815.072) [-2816.562] (-2818.280) (-2827.908) * [-2807.898] (-2830.108) (-2815.361) (-2820.408) -- 0:02:01
765000 -- (-2811.954) (-2815.147) (-2815.525) [-2818.242] * (-2807.324) (-2817.425) (-2819.840) [-2813.772] -- 0:02:01
Average standard deviation of split frequencies: 0.003419
765500 -- (-2815.111) (-2814.569) [-2812.872] (-2829.431) * (-2814.832) [-2820.113] (-2814.426) (-2823.604) -- 0:02:01
766000 -- (-2827.310) (-2818.497) (-2810.568) [-2813.813] * (-2817.970) (-2814.996) (-2814.644) [-2821.154] -- 0:02:00
766500 -- (-2813.814) (-2816.931) [-2820.598] (-2813.371) * (-2826.090) [-2819.283] (-2821.908) (-2821.646) -- 0:02:00
767000 -- (-2822.772) (-2820.318) (-2823.239) [-2816.691] * (-2812.503) (-2822.157) [-2817.716] (-2822.670) -- 0:02:00
767500 -- (-2814.764) (-2813.038) [-2809.996] (-2820.650) * (-2819.537) [-2816.819] (-2818.377) (-2813.784) -- 0:02:00
768000 -- (-2812.231) [-2817.132] (-2812.244) (-2828.784) * [-2815.683] (-2816.818) (-2821.647) (-2816.075) -- 0:01:59
768500 -- (-2814.190) [-2817.847] (-2810.408) (-2821.515) * (-2817.264) (-2813.578) [-2818.879] (-2810.364) -- 0:01:59
769000 -- (-2825.801) (-2823.784) (-2817.411) [-2811.691] * [-2814.457] (-2820.158) (-2815.147) (-2810.683) -- 0:01:59
769500 -- (-2824.026) [-2813.923] (-2813.146) (-2818.645) * (-2820.481) (-2822.370) [-2814.782] (-2815.964) -- 0:01:59
770000 -- (-2820.589) (-2824.042) [-2814.661] (-2821.506) * (-2815.419) (-2825.680) (-2810.883) [-2809.806] -- 0:01:58
Average standard deviation of split frequencies: 0.003058
770500 -- (-2817.211) [-2818.882] (-2818.328) (-2815.982) * [-2811.253] (-2812.835) (-2817.948) (-2814.574) -- 0:01:58
771000 -- [-2820.786] (-2816.006) (-2812.912) (-2813.290) * (-2817.148) [-2809.086] (-2826.873) (-2814.887) -- 0:01:58
771500 -- (-2815.428) (-2830.562) [-2817.149] (-2820.149) * [-2816.296] (-2816.283) (-2818.858) (-2838.623) -- 0:01:58
772000 -- [-2816.844] (-2824.047) (-2817.769) (-2844.830) * (-2816.568) (-2813.529) (-2816.350) [-2820.642] -- 0:01:57
772500 -- (-2816.406) (-2816.535) [-2824.380] (-2835.268) * [-2814.784] (-2821.357) (-2816.231) (-2813.822) -- 0:01:57
773000 -- (-2815.450) [-2814.222] (-2816.013) (-2823.040) * (-2812.122) (-2830.462) (-2818.962) [-2812.163] -- 0:01:57
773500 -- (-2814.291) (-2812.921) [-2818.723] (-2823.551) * (-2811.352) (-2820.637) [-2822.144] (-2815.245) -- 0:01:57
774000 -- [-2820.474] (-2815.151) (-2819.296) (-2815.416) * (-2815.177) [-2813.776] (-2816.854) (-2824.966) -- 0:01:56
774500 -- (-2825.897) [-2814.693] (-2814.172) (-2820.271) * (-2830.465) [-2819.332] (-2815.312) (-2820.345) -- 0:01:56
775000 -- (-2814.487) (-2825.267) [-2812.104] (-2820.993) * (-2819.054) (-2826.224) [-2811.270] (-2815.027) -- 0:01:56
Average standard deviation of split frequencies: 0.002970
775500 -- (-2817.379) (-2812.086) [-2811.133] (-2809.870) * (-2816.869) (-2821.861) [-2809.078] (-2822.332) -- 0:01:56
776000 -- (-2827.447) [-2817.119] (-2821.483) (-2815.951) * [-2814.871] (-2823.680) (-2817.372) (-2813.607) -- 0:01:55
776500 -- (-2825.300) (-2824.765) [-2819.370] (-2824.369) * [-2813.467] (-2821.583) (-2810.161) (-2817.150) -- 0:01:55
777000 -- (-2820.861) (-2820.508) (-2817.565) [-2820.979] * (-2824.875) (-2827.395) [-2813.585] (-2823.223) -- 0:01:55
777500 -- [-2817.544] (-2818.924) (-2818.253) (-2816.596) * (-2814.383) [-2815.770] (-2812.977) (-2820.830) -- 0:01:55
778000 -- (-2822.271) (-2817.403) (-2822.965) [-2816.871] * (-2811.482) (-2818.306) (-2815.404) [-2817.316] -- 0:01:54
778500 -- (-2813.731) (-2817.024) (-2824.175) [-2810.819] * (-2820.331) (-2826.320) [-2815.025] (-2813.863) -- 0:01:54
779000 -- [-2808.042] (-2824.370) (-2819.937) (-2817.212) * [-2820.685] (-2828.708) (-2810.132) (-2814.139) -- 0:01:54
779500 -- (-2830.693) (-2810.472) [-2818.062] (-2817.906) * (-2822.931) (-2817.816) (-2819.694) [-2814.096] -- 0:01:53
780000 -- [-2809.795] (-2828.714) (-2830.494) (-2813.981) * (-2821.838) (-2819.779) (-2821.686) [-2814.135] -- 0:01:53
Average standard deviation of split frequencies: 0.003086
780500 -- (-2810.853) [-2819.137] (-2822.090) (-2832.044) * (-2819.019) (-2816.163) (-2822.637) [-2815.156] -- 0:01:53
781000 -- [-2814.991] (-2817.229) (-2821.558) (-2827.651) * [-2824.229] (-2823.148) (-2824.645) (-2817.736) -- 0:01:53
781500 -- (-2813.650) [-2809.849] (-2816.196) (-2812.663) * [-2808.414] (-2816.661) (-2816.690) (-2810.827) -- 0:01:52
782000 -- (-2813.927) (-2810.786) (-2813.784) [-2806.490] * (-2817.251) [-2814.317] (-2812.501) (-2821.794) -- 0:01:52
782500 -- [-2810.109] (-2814.655) (-2810.649) (-2824.292) * [-2816.094] (-2824.248) (-2815.129) (-2819.071) -- 0:01:52
783000 -- (-2809.863) (-2823.132) (-2814.486) [-2813.826] * (-2816.857) (-2824.760) [-2818.856] (-2814.899) -- 0:01:52
783500 -- (-2815.433) [-2818.763] (-2810.282) (-2810.617) * [-2811.488] (-2832.225) (-2814.589) (-2811.784) -- 0:01:51
784000 -- (-2819.855) (-2817.248) (-2811.197) [-2810.992] * (-2821.450) (-2818.739) (-2824.906) [-2812.231] -- 0:01:51
784500 -- [-2816.157] (-2836.910) (-2814.527) (-2811.809) * (-2827.674) [-2809.851] (-2821.123) (-2827.173) -- 0:01:51
785000 -- (-2817.918) (-2825.240) [-2808.997] (-2815.931) * [-2820.367] (-2821.616) (-2825.880) (-2822.677) -- 0:01:51
Average standard deviation of split frequencies: 0.002732
785500 -- (-2821.169) [-2811.400] (-2824.596) (-2819.068) * [-2807.614] (-2822.552) (-2818.441) (-2816.942) -- 0:01:50
786000 -- [-2814.503] (-2815.383) (-2816.036) (-2819.740) * (-2815.387) (-2820.259) (-2812.181) [-2814.060] -- 0:01:50
786500 -- (-2811.626) [-2810.926] (-2819.168) (-2817.629) * (-2828.230) (-2815.369) (-2820.725) [-2819.926] -- 0:01:50
787000 -- [-2814.553] (-2814.486) (-2813.429) (-2813.942) * (-2822.101) (-2815.548) (-2820.538) [-2809.719] -- 0:01:50
787500 -- (-2814.107) (-2824.377) (-2813.777) [-2818.064] * [-2815.543] (-2816.602) (-2816.214) (-2814.821) -- 0:01:49
788000 -- (-2820.796) [-2819.041] (-2823.809) (-2814.304) * (-2820.385) (-2817.441) [-2816.204] (-2811.706) -- 0:01:49
788500 -- (-2827.245) (-2813.472) (-2811.099) [-2813.767] * [-2809.027] (-2825.652) (-2810.686) (-2818.373) -- 0:01:49
789000 -- (-2818.689) [-2816.528] (-2816.267) (-2808.246) * (-2816.346) [-2817.462] (-2824.254) (-2820.916) -- 0:01:49
789500 -- (-2817.471) (-2823.296) [-2809.694] (-2813.133) * (-2815.609) (-2817.192) [-2814.659] (-2818.640) -- 0:01:48
790000 -- (-2819.981) (-2824.703) [-2815.810] (-2816.620) * [-2815.152] (-2818.970) (-2812.634) (-2811.037) -- 0:01:48
Average standard deviation of split frequencies: 0.003114
790500 -- (-2817.153) (-2823.052) [-2814.191] (-2815.260) * [-2818.419] (-2820.468) (-2814.918) (-2812.728) -- 0:01:48
791000 -- (-2812.294) [-2821.758] (-2824.031) (-2825.149) * (-2823.562) (-2815.327) [-2808.984] (-2810.495) -- 0:01:48
791500 -- (-2808.671) (-2818.633) [-2820.739] (-2825.174) * (-2817.394) (-2813.581) [-2811.068] (-2810.852) -- 0:01:47
792000 -- (-2811.533) (-2810.989) (-2809.578) [-2813.091] * [-2819.412] (-2817.904) (-2816.044) (-2825.763) -- 0:01:47
792500 -- (-2826.580) (-2811.820) (-2809.255) [-2815.871] * (-2819.784) (-2823.634) (-2827.067) [-2816.278] -- 0:01:47
793000 -- (-2812.946) [-2807.298] (-2822.855) (-2815.383) * (-2824.574) (-2814.934) [-2820.939] (-2815.880) -- 0:01:47
793500 -- [-2822.246] (-2817.321) (-2823.285) (-2820.180) * [-2816.549] (-2815.189) (-2810.116) (-2808.128) -- 0:01:46
794000 -- (-2822.112) (-2816.951) [-2817.176] (-2826.979) * (-2812.338) (-2813.043) [-2819.270] (-2819.391) -- 0:01:46
794500 -- (-2820.819) [-2815.986] (-2818.072) (-2819.221) * (-2813.980) (-2816.484) (-2807.273) [-2818.708] -- 0:01:46
795000 -- [-2815.536] (-2824.046) (-2820.851) (-2820.149) * (-2809.379) (-2823.261) [-2815.403] (-2816.769) -- 0:01:45
Average standard deviation of split frequencies: 0.003027
795500 -- [-2814.807] (-2817.151) (-2818.734) (-2823.435) * (-2812.664) [-2813.672] (-2818.604) (-2810.185) -- 0:01:45
796000 -- [-2806.975] (-2814.580) (-2825.670) (-2816.802) * [-2819.165] (-2820.045) (-2813.787) (-2824.371) -- 0:01:45
796500 -- (-2808.494) [-2811.992] (-2818.579) (-2819.202) * [-2809.870] (-2822.233) (-2817.647) (-2814.649) -- 0:01:45
797000 -- (-2823.071) [-2817.141] (-2818.587) (-2812.311) * (-2821.369) [-2815.888] (-2814.399) (-2815.009) -- 0:01:44
797500 -- [-2810.613] (-2820.364) (-2817.301) (-2818.915) * (-2823.971) (-2821.663) [-2812.617] (-2823.539) -- 0:01:44
798000 -- (-2815.606) [-2813.010] (-2815.262) (-2824.171) * (-2822.657) (-2828.325) [-2822.218] (-2821.874) -- 0:01:44
798500 -- (-2815.722) [-2818.873] (-2819.626) (-2813.996) * (-2825.003) (-2820.699) (-2821.245) [-2817.180] -- 0:01:44
799000 -- (-2813.782) [-2818.946] (-2815.698) (-2820.365) * (-2818.114) (-2813.972) (-2832.700) [-2816.571] -- 0:01:43
799500 -- (-2821.254) (-2819.470) (-2820.028) [-2814.090] * [-2814.892] (-2815.731) (-2812.582) (-2818.010) -- 0:01:43
800000 -- (-2825.255) (-2833.002) (-2820.072) [-2818.993] * (-2815.098) [-2818.032] (-2808.277) (-2816.852) -- 0:01:43
Average standard deviation of split frequencies: 0.002813
800500 -- (-2820.927) [-2818.540] (-2809.033) (-2815.042) * (-2812.606) [-2814.098] (-2821.726) (-2823.035) -- 0:01:43
801000 -- (-2813.203) (-2830.047) (-2821.671) [-2823.184] * (-2817.072) (-2820.430) [-2810.439] (-2820.443) -- 0:01:42
801500 -- (-2815.215) [-2814.083] (-2819.281) (-2816.967) * (-2816.479) (-2812.603) [-2811.200] (-2817.634) -- 0:01:42
802000 -- (-2808.753) [-2813.587] (-2817.175) (-2822.603) * (-2831.708) (-2820.056) [-2810.192] (-2812.079) -- 0:01:42
802500 -- (-2817.277) (-2817.643) [-2815.732] (-2818.734) * [-2817.540] (-2817.359) (-2817.990) (-2816.104) -- 0:01:42
803000 -- (-2816.773) [-2812.093] (-2814.428) (-2812.204) * [-2818.599] (-2819.774) (-2821.697) (-2818.753) -- 0:01:41
803500 -- (-2814.470) (-2816.417) (-2818.596) [-2811.986] * [-2815.704] (-2822.279) (-2818.026) (-2814.400) -- 0:01:41
804000 -- (-2828.931) (-2815.900) (-2812.913) [-2807.819] * (-2816.646) (-2817.367) (-2820.686) [-2812.821] -- 0:01:41
804500 -- (-2826.027) [-2811.644] (-2825.947) (-2816.275) * [-2809.427] (-2817.303) (-2810.526) (-2816.611) -- 0:01:41
805000 -- (-2819.940) (-2812.355) (-2835.979) [-2825.542] * (-2816.002) (-2809.500) [-2813.742] (-2821.942) -- 0:01:40
Average standard deviation of split frequencies: 0.002599
805500 -- (-2817.640) (-2808.825) (-2819.859) [-2822.678] * [-2821.143] (-2818.333) (-2811.581) (-2826.345) -- 0:01:40
806000 -- (-2816.057) (-2816.801) [-2820.807] (-2826.182) * (-2824.089) (-2810.654) (-2815.861) [-2812.403] -- 0:01:40
806500 -- (-2814.493) (-2818.155) [-2820.407] (-2816.156) * (-2830.921) (-2817.125) [-2816.917] (-2811.646) -- 0:01:40
807000 -- [-2816.441] (-2816.098) (-2820.169) (-2817.158) * (-2814.986) (-2821.414) (-2819.018) [-2814.634] -- 0:01:39
807500 -- (-2823.600) (-2816.637) (-2818.208) [-2822.219] * (-2819.859) (-2816.017) (-2817.484) [-2811.078] -- 0:01:39
808000 -- (-2830.954) (-2816.210) [-2817.525] (-2812.376) * (-2824.470) (-2817.858) (-2817.578) [-2812.792] -- 0:01:39
808500 -- (-2822.264) (-2819.243) (-2813.588) [-2812.701] * (-2812.964) [-2813.495] (-2813.892) (-2820.403) -- 0:01:39
809000 -- (-2826.387) (-2817.450) [-2819.063] (-2816.311) * (-2820.259) [-2816.101] (-2811.945) (-2815.244) -- 0:01:38
809500 -- [-2818.481] (-2812.078) (-2814.872) (-2816.012) * [-2811.481] (-2813.507) (-2809.602) (-2818.450) -- 0:01:38
810000 -- (-2812.770) [-2814.485] (-2817.130) (-2817.480) * [-2813.389] (-2809.809) (-2811.040) (-2819.379) -- 0:01:38
Average standard deviation of split frequencies: 0.002326
810500 -- (-2820.688) [-2810.850] (-2817.223) (-2818.024) * (-2813.710) (-2815.188) [-2809.513] (-2817.917) -- 0:01:37
811000 -- (-2818.605) [-2819.713] (-2819.695) (-2811.199) * [-2812.434] (-2817.051) (-2810.387) (-2819.282) -- 0:01:37
811500 -- (-2823.027) (-2811.108) (-2818.391) [-2814.955] * (-2822.936) (-2810.766) (-2815.561) [-2811.812] -- 0:01:37
812000 -- (-2813.987) [-2811.349] (-2816.540) (-2821.060) * [-2814.968] (-2814.879) (-2814.708) (-2816.982) -- 0:01:37
812500 -- (-2812.806) [-2817.703] (-2816.088) (-2817.765) * (-2820.356) [-2820.278] (-2811.113) (-2813.124) -- 0:01:36
813000 -- (-2811.586) [-2811.118] (-2811.992) (-2824.268) * (-2805.141) [-2811.841] (-2825.937) (-2812.652) -- 0:01:36
813500 -- (-2825.433) [-2812.323] (-2814.050) (-2818.270) * (-2826.536) (-2829.858) (-2819.531) [-2812.168] -- 0:01:36
814000 -- (-2824.213) [-2807.096] (-2820.088) (-2814.531) * (-2828.446) (-2824.969) [-2830.715] (-2806.980) -- 0:01:36
814500 -- (-2823.448) [-2812.897] (-2820.220) (-2819.481) * (-2821.571) [-2811.689] (-2826.006) (-2818.541) -- 0:01:35
815000 -- (-2817.414) (-2817.431) (-2814.996) [-2813.771] * [-2809.106] (-2817.691) (-2819.424) (-2816.687) -- 0:01:35
Average standard deviation of split frequencies: 0.001926
815500 -- [-2815.657] (-2808.591) (-2816.066) (-2837.890) * (-2810.444) (-2810.099) (-2818.247) [-2812.140] -- 0:01:35
816000 -- [-2816.146] (-2814.329) (-2819.280) (-2831.714) * [-2811.694] (-2813.472) (-2822.049) (-2809.039) -- 0:01:35
816500 -- (-2823.266) [-2820.799] (-2819.721) (-2832.101) * (-2822.248) (-2823.370) (-2814.298) [-2818.721] -- 0:01:34
817000 -- (-2822.506) (-2812.300) [-2818.039] (-2818.202) * (-2814.284) (-2818.669) [-2816.025] (-2824.404) -- 0:01:34
817500 -- (-2816.734) (-2825.241) [-2815.303] (-2824.995) * [-2813.908] (-2811.668) (-2816.437) (-2816.277) -- 0:01:34
818000 -- (-2814.071) [-2816.568] (-2820.096) (-2813.988) * [-2815.391] (-2818.364) (-2817.673) (-2809.115) -- 0:01:34
818500 -- (-2814.672) (-2824.534) [-2811.056] (-2816.767) * (-2816.613) (-2816.844) [-2828.728] (-2814.506) -- 0:01:33
819000 -- (-2823.693) (-2822.144) (-2813.179) [-2818.105] * [-2818.526] (-2812.627) (-2825.090) (-2826.123) -- 0:01:33
819500 -- (-2816.820) [-2814.753] (-2820.760) (-2820.732) * [-2810.981] (-2812.716) (-2817.537) (-2821.217) -- 0:01:33
820000 -- [-2816.524] (-2820.145) (-2819.829) (-2811.827) * (-2820.610) [-2820.260] (-2811.057) (-2831.417) -- 0:01:33
Average standard deviation of split frequencies: 0.002106
820500 -- [-2811.588] (-2818.363) (-2820.091) (-2810.081) * [-2823.331] (-2817.509) (-2815.416) (-2814.309) -- 0:01:32
821000 -- (-2813.647) (-2819.626) [-2813.186] (-2817.044) * (-2811.414) (-2827.682) [-2812.097] (-2811.000) -- 0:01:32
821500 -- (-2816.531) (-2822.552) (-2823.588) [-2813.731] * (-2820.955) [-2810.427] (-2816.307) (-2816.686) -- 0:01:32
822000 -- [-2810.008] (-2811.508) (-2816.644) (-2806.155) * (-2817.979) [-2821.548] (-2818.688) (-2826.375) -- 0:01:32
822500 -- (-2826.118) (-2826.345) (-2817.306) [-2809.526] * (-2817.866) (-2821.629) [-2815.976] (-2812.392) -- 0:01:31
823000 -- (-2811.134) [-2825.045] (-2819.714) (-2812.848) * (-2815.458) [-2819.285] (-2811.282) (-2821.507) -- 0:01:31
823500 -- (-2824.063) [-2821.182] (-2822.040) (-2813.204) * (-2811.755) (-2814.297) [-2814.254] (-2812.435) -- 0:01:31
824000 -- (-2817.646) [-2814.579] (-2825.809) (-2809.106) * [-2815.436] (-2822.928) (-2821.462) (-2814.179) -- 0:01:30
824500 -- [-2808.583] (-2820.311) (-2810.756) (-2826.178) * (-2817.465) [-2808.201] (-2815.997) (-2814.988) -- 0:01:30
825000 -- (-2815.140) [-2813.870] (-2817.921) (-2819.460) * (-2818.058) (-2819.251) [-2810.377] (-2808.726) -- 0:01:30
Average standard deviation of split frequencies: 0.002283
825500 -- (-2816.915) [-2815.304] (-2818.704) (-2815.471) * (-2815.103) [-2812.793] (-2817.214) (-2816.308) -- 0:01:30
826000 -- (-2821.635) [-2812.447] (-2814.500) (-2816.025) * (-2817.581) (-2815.728) [-2812.155] (-2814.456) -- 0:01:29
826500 -- [-2812.721] (-2821.646) (-2818.000) (-2817.460) * (-2823.001) (-2821.942) (-2810.443) [-2820.724] -- 0:01:29
827000 -- [-2809.516] (-2826.341) (-2829.745) (-2819.572) * [-2812.891] (-2816.753) (-2816.896) (-2811.644) -- 0:01:29
827500 -- [-2818.907] (-2825.278) (-2817.971) (-2816.812) * [-2822.913] (-2830.749) (-2819.047) (-2815.153) -- 0:01:29
828000 -- [-2813.645] (-2831.969) (-2821.819) (-2812.383) * [-2822.695] (-2813.420) (-2826.372) (-2822.453) -- 0:01:28
828500 -- (-2819.686) (-2816.734) (-2819.316) [-2816.643] * (-2815.372) (-2819.450) [-2812.776] (-2814.911) -- 0:01:28
829000 -- [-2809.272] (-2810.028) (-2822.803) (-2818.076) * (-2819.819) (-2820.334) [-2814.075] (-2815.046) -- 0:01:28
829500 -- [-2816.705] (-2819.413) (-2817.686) (-2818.415) * (-2815.206) (-2816.839) (-2808.944) [-2822.587] -- 0:01:28
830000 -- [-2817.847] (-2816.254) (-2826.246) (-2821.148) * [-2810.266] (-2816.562) (-2822.964) (-2812.046) -- 0:01:27
Average standard deviation of split frequencies: 0.002270
830500 -- [-2813.448] (-2818.505) (-2819.528) (-2814.901) * (-2810.084) (-2828.330) [-2812.459] (-2815.636) -- 0:01:27
831000 -- (-2811.703) (-2814.478) [-2813.981] (-2821.042) * [-2813.962] (-2813.921) (-2813.337) (-2821.216) -- 0:01:27
831500 -- (-2811.651) (-2822.183) (-2821.465) [-2812.006] * (-2816.592) (-2814.933) [-2816.336] (-2814.246) -- 0:01:27
832000 -- (-2820.413) [-2817.951] (-2820.463) (-2807.980) * (-2822.577) [-2816.473] (-2819.165) (-2815.295) -- 0:01:26
832500 -- [-2809.481] (-2814.073) (-2823.697) (-2818.268) * (-2818.919) [-2816.861] (-2812.950) (-2819.519) -- 0:01:26
833000 -- [-2819.404] (-2819.899) (-2823.786) (-2819.671) * (-2813.565) (-2815.591) (-2823.588) [-2818.560] -- 0:01:26
833500 -- [-2816.708] (-2818.403) (-2827.166) (-2811.806) * (-2819.130) (-2821.943) (-2815.097) [-2809.947] -- 0:01:26
834000 -- (-2814.210) [-2809.987] (-2816.402) (-2814.399) * (-2813.810) (-2811.461) (-2817.444) [-2809.499] -- 0:01:25
834500 -- (-2814.312) (-2814.215) [-2818.722] (-2821.643) * (-2814.492) [-2827.406] (-2819.975) (-2823.727) -- 0:01:25
835000 -- (-2817.730) (-2820.936) (-2819.889) [-2816.571] * (-2818.962) [-2819.363] (-2815.535) (-2815.203) -- 0:01:25
Average standard deviation of split frequencies: 0.002256
835500 -- [-2813.662] (-2813.316) (-2821.917) (-2815.993) * (-2817.511) (-2815.264) (-2812.372) [-2810.212] -- 0:01:25
836000 -- (-2812.509) [-2819.865] (-2823.229) (-2824.374) * (-2813.128) [-2815.858] (-2838.125) (-2818.599) -- 0:01:24
836500 -- [-2814.080] (-2819.612) (-2821.232) (-2813.553) * (-2821.513) (-2818.483) [-2813.316] (-2818.340) -- 0:01:24
837000 -- (-2816.060) (-2810.920) (-2815.785) [-2815.810] * [-2813.242] (-2814.914) (-2814.003) (-2819.487) -- 0:01:24
837500 -- (-2820.446) (-2816.588) (-2819.420) [-2811.233] * (-2814.736) [-2811.093] (-2811.066) (-2809.162) -- 0:01:24
838000 -- [-2813.717] (-2823.351) (-2822.947) (-2815.894) * (-2815.970) (-2828.894) [-2812.290] (-2809.628) -- 0:01:23
838500 -- (-2828.760) (-2815.040) (-2815.278) [-2815.921] * (-2815.992) (-2817.421) (-2809.388) [-2817.394] -- 0:01:23
839000 -- (-2820.502) (-2812.148) [-2816.923] (-2812.825) * (-2823.423) [-2815.273] (-2827.891) (-2820.337) -- 0:01:23
839500 -- (-2814.983) (-2814.085) (-2820.058) [-2811.596] * (-2825.157) (-2815.451) (-2824.446) [-2815.771] -- 0:01:22
840000 -- (-2818.381) (-2826.547) [-2812.013] (-2814.813) * (-2817.014) (-2814.072) (-2813.053) [-2811.069] -- 0:01:22
Average standard deviation of split frequencies: 0.001994
840500 -- (-2813.698) (-2832.106) [-2821.544] (-2815.958) * (-2816.539) [-2812.855] (-2815.761) (-2806.351) -- 0:01:22
841000 -- (-2812.623) (-2811.948) (-2815.186) [-2811.639] * (-2828.701) (-2813.049) (-2809.078) [-2811.729] -- 0:01:22
841500 -- (-2827.179) [-2822.885] (-2811.920) (-2812.156) * [-2818.251] (-2806.652) (-2823.653) (-2813.341) -- 0:01:21
842000 -- [-2812.033] (-2820.689) (-2814.555) (-2815.131) * [-2817.689] (-2810.740) (-2822.652) (-2818.447) -- 0:01:21
842500 -- [-2809.892] (-2815.984) (-2816.440) (-2822.825) * [-2816.029] (-2811.118) (-2824.841) (-2804.461) -- 0:01:21
843000 -- (-2822.775) [-2811.558] (-2813.023) (-2816.931) * (-2816.639) (-2819.144) [-2818.109] (-2811.718) -- 0:01:21
843500 -- (-2815.854) (-2818.284) [-2810.220] (-2813.313) * (-2819.830) (-2821.080) (-2813.166) [-2809.234] -- 0:01:20
844000 -- [-2816.194] (-2809.528) (-2816.907) (-2810.531) * (-2816.731) (-2814.980) (-2818.664) [-2818.322] -- 0:01:20
844500 -- [-2822.055] (-2823.992) (-2822.157) (-2812.880) * (-2828.740) [-2812.587] (-2809.803) (-2813.868) -- 0:01:20
845000 -- [-2818.621] (-2825.327) (-2815.088) (-2829.376) * (-2820.272) (-2822.625) (-2825.371) [-2815.740] -- 0:01:20
Average standard deviation of split frequencies: 0.002105
845500 -- [-2814.683] (-2824.127) (-2817.547) (-2820.134) * (-2838.022) [-2814.153] (-2818.431) (-2823.453) -- 0:01:19
846000 -- (-2825.350) [-2815.113] (-2827.910) (-2810.923) * (-2825.934) (-2815.377) [-2806.853] (-2823.138) -- 0:01:19
846500 -- (-2816.472) (-2817.462) (-2811.871) [-2817.459] * [-2824.947] (-2824.464) (-2814.139) (-2833.375) -- 0:01:19
847000 -- (-2814.784) [-2824.152] (-2816.809) (-2819.192) * (-2825.518) (-2820.964) [-2808.873] (-2812.559) -- 0:01:19
847500 -- (-2826.439) [-2823.539] (-2814.742) (-2823.002) * [-2814.072] (-2818.335) (-2816.560) (-2824.325) -- 0:01:18
848000 -- (-2816.745) (-2822.989) (-2813.360) [-2821.307] * (-2823.538) (-2814.908) (-2816.984) [-2809.441] -- 0:01:18
848500 -- (-2815.147) (-2820.149) [-2820.031] (-2823.837) * (-2818.613) (-2830.772) [-2820.078] (-2809.171) -- 0:01:18
849000 -- (-2818.950) (-2829.147) [-2813.266] (-2822.239) * (-2811.110) [-2807.909] (-2818.507) (-2822.247) -- 0:01:18
849500 -- (-2825.681) (-2819.161) [-2824.531] (-2817.230) * [-2816.982] (-2816.366) (-2820.033) (-2822.309) -- 0:01:17
850000 -- (-2821.589) (-2812.056) (-2815.416) [-2814.302] * (-2823.570) (-2816.970) (-2827.547) [-2820.940] -- 0:01:17
Average standard deviation of split frequencies: 0.001970
850500 -- (-2824.581) [-2815.485] (-2819.049) (-2815.245) * (-2814.224) (-2815.310) [-2822.010] (-2817.983) -- 0:01:17
851000 -- (-2808.703) (-2814.780) (-2817.615) [-2810.948] * (-2824.808) (-2822.354) [-2812.536] (-2815.370) -- 0:01:17
851500 -- (-2809.924) [-2811.507] (-2816.080) (-2813.758) * (-2820.731) [-2811.865] (-2809.091) (-2817.375) -- 0:01:16
852000 -- [-2814.580] (-2814.942) (-2821.367) (-2814.454) * [-2823.691] (-2816.918) (-2814.425) (-2816.800) -- 0:01:16
852500 -- (-2818.399) (-2816.731) [-2811.106] (-2814.111) * (-2818.346) (-2815.624) (-2823.409) [-2816.659] -- 0:01:16
853000 -- [-2812.811] (-2823.930) (-2817.434) (-2814.249) * (-2816.458) [-2811.526] (-2814.868) (-2816.559) -- 0:01:15
853500 -- (-2817.251) (-2813.069) (-2821.607) [-2817.327] * [-2815.333] (-2819.211) (-2812.002) (-2825.182) -- 0:01:15
854000 -- [-2816.879] (-2821.508) (-2819.318) (-2814.051) * (-2817.731) [-2814.278] (-2817.579) (-2816.875) -- 0:01:15
854500 -- (-2820.305) [-2818.432] (-2823.286) (-2819.337) * (-2816.856) [-2816.056] (-2809.573) (-2814.104) -- 0:01:15
855000 -- (-2824.712) (-2828.649) [-2812.987] (-2810.817) * (-2813.412) [-2809.012] (-2814.384) (-2822.313) -- 0:01:14
Average standard deviation of split frequencies: 0.002080
855500 -- (-2825.332) (-2826.559) (-2816.763) [-2817.286] * [-2816.081] (-2815.038) (-2820.675) (-2814.545) -- 0:01:14
856000 -- (-2830.402) (-2823.990) (-2813.179) [-2809.338] * (-2823.930) (-2819.110) [-2811.164] (-2822.661) -- 0:01:14
856500 -- [-2824.908] (-2812.507) (-2819.458) (-2823.003) * [-2813.215] (-2821.206) (-2821.344) (-2813.069) -- 0:01:14
857000 -- (-2818.878) (-2820.157) [-2815.905] (-2822.342) * (-2821.129) [-2819.620] (-2812.696) (-2821.759) -- 0:01:13
857500 -- (-2822.521) (-2816.260) [-2817.433] (-2821.829) * (-2814.577) (-2820.211) [-2823.930] (-2826.202) -- 0:01:13
858000 -- [-2818.920] (-2813.681) (-2818.735) (-2813.694) * (-2815.822) (-2817.344) (-2821.174) [-2817.691] -- 0:01:13
858500 -- (-2815.725) (-2818.576) [-2818.478] (-2811.017) * [-2817.041] (-2827.825) (-2816.917) (-2817.082) -- 0:01:13
859000 -- (-2812.502) (-2825.180) (-2812.115) [-2818.094] * (-2822.066) (-2817.588) [-2815.594] (-2810.321) -- 0:01:12
859500 -- (-2820.484) [-2817.122] (-2811.244) (-2817.151) * (-2815.885) (-2816.088) [-2810.178] (-2820.478) -- 0:01:12
860000 -- (-2813.628) [-2810.987] (-2824.742) (-2815.166) * (-2815.099) [-2815.401] (-2819.599) (-2813.751) -- 0:01:12
Average standard deviation of split frequencies: 0.001947
860500 -- (-2817.815) (-2814.125) [-2811.022] (-2813.801) * (-2821.977) [-2820.070] (-2812.973) (-2815.753) -- 0:01:12
861000 -- [-2813.561] (-2817.586) (-2821.317) (-2817.137) * (-2817.240) [-2813.200] (-2820.490) (-2816.627) -- 0:01:11
861500 -- (-2812.856) (-2825.376) [-2811.291] (-2811.710) * (-2813.623) (-2812.504) [-2816.223] (-2818.187) -- 0:01:11
862000 -- [-2809.920] (-2816.776) (-2822.578) (-2818.240) * (-2821.529) [-2819.184] (-2822.322) (-2817.652) -- 0:01:11
862500 -- (-2820.523) (-2816.264) (-2820.271) [-2814.812] * (-2826.691) (-2821.431) [-2813.729] (-2823.945) -- 0:01:11
863000 -- (-2810.602) [-2813.152] (-2820.574) (-2828.465) * (-2810.600) (-2820.833) (-2818.539) [-2809.206] -- 0:01:10
863500 -- (-2809.193) (-2814.381) (-2813.901) [-2817.901] * (-2810.925) [-2813.498] (-2825.663) (-2815.407) -- 0:01:10
864000 -- (-2822.104) (-2818.780) (-2819.584) [-2814.734] * (-2808.100) [-2816.845] (-2818.790) (-2815.369) -- 0:01:10
864500 -- [-2810.340] (-2816.942) (-2819.907) (-2822.242) * (-2817.745) (-2814.151) (-2813.375) [-2807.861] -- 0:01:10
865000 -- (-2822.326) [-2812.686] (-2814.292) (-2825.951) * [-2813.461] (-2812.566) (-2822.742) (-2818.191) -- 0:01:09
Average standard deviation of split frequencies: 0.001573
865500 -- (-2819.800) [-2817.670] (-2816.200) (-2822.651) * (-2821.744) [-2808.954] (-2818.473) (-2814.145) -- 0:01:09
866000 -- (-2828.953) [-2808.356] (-2826.717) (-2818.719) * (-2823.247) (-2812.649) (-2816.010) [-2815.559] -- 0:01:09
866500 -- (-2820.401) [-2817.186] (-2810.694) (-2818.545) * (-2827.590) (-2811.595) (-2807.779) [-2810.326] -- 0:01:09
867000 -- [-2806.823] (-2828.235) (-2815.038) (-2820.090) * (-2811.371) (-2814.967) [-2808.836] (-2823.759) -- 0:01:08
867500 -- (-2814.273) (-2821.413) [-2818.287] (-2834.272) * (-2818.666) (-2816.500) [-2808.771] (-2813.237) -- 0:01:08
868000 -- (-2814.057) (-2817.692) [-2814.562] (-2824.527) * (-2811.630) (-2821.633) (-2818.524) [-2813.877] -- 0:01:08
868500 -- (-2813.294) (-2829.950) (-2814.126) [-2813.193] * [-2815.013] (-2821.444) (-2818.781) (-2821.909) -- 0:01:07
869000 -- (-2822.242) (-2815.900) [-2817.315] (-2822.344) * (-2818.978) (-2818.845) (-2815.940) [-2810.249] -- 0:01:07
869500 -- (-2818.758) (-2816.859) [-2817.244] (-2810.664) * [-2811.194] (-2821.754) (-2821.557) (-2809.645) -- 0:01:07
870000 -- (-2821.126) (-2817.733) [-2815.929] (-2831.678) * (-2815.733) (-2818.898) (-2824.862) [-2815.034] -- 0:01:07
Average standard deviation of split frequencies: 0.001865
870500 -- (-2822.342) [-2818.362] (-2817.037) (-2821.356) * (-2810.357) (-2820.511) [-2817.437] (-2814.408) -- 0:01:06
871000 -- (-2823.760) (-2826.244) (-2817.830) [-2811.719] * (-2822.844) (-2821.475) (-2816.702) [-2817.936] -- 0:01:06
871500 -- (-2822.699) (-2818.896) (-2819.297) [-2815.360] * (-2823.028) (-2823.722) (-2826.718) [-2810.947] -- 0:01:06
872000 -- (-2813.904) (-2824.521) (-2815.217) [-2811.286] * (-2809.741) [-2813.995] (-2820.768) (-2823.923) -- 0:01:06
872500 -- (-2819.189) (-2816.231) (-2815.642) [-2816.221] * [-2819.382] (-2815.115) (-2813.329) (-2822.072) -- 0:01:05
873000 -- (-2828.636) [-2821.335] (-2813.513) (-2815.092) * (-2824.257) (-2813.733) (-2818.587) [-2817.412] -- 0:01:05
873500 -- (-2819.812) (-2822.931) (-2827.431) [-2820.237] * (-2820.086) [-2811.170] (-2820.059) (-2819.973) -- 0:01:05
874000 -- [-2816.291] (-2824.923) (-2816.973) (-2819.188) * (-2821.209) (-2809.116) (-2823.588) [-2811.095] -- 0:01:05
874500 -- (-2816.585) (-2820.900) [-2814.644] (-2834.271) * (-2815.116) (-2813.562) (-2817.391) [-2814.544] -- 0:01:04
875000 -- (-2820.366) [-2808.567] (-2819.450) (-2815.194) * (-2816.458) [-2822.022] (-2813.496) (-2814.581) -- 0:01:04
Average standard deviation of split frequencies: 0.001555
875500 -- (-2814.029) [-2816.899] (-2822.146) (-2812.997) * (-2817.354) [-2812.511] (-2816.763) (-2812.295) -- 0:01:04
876000 -- (-2819.317) [-2816.431] (-2820.027) (-2819.003) * [-2816.314] (-2815.614) (-2814.183) (-2807.966) -- 0:01:04
876500 -- (-2816.629) (-2815.869) [-2815.734] (-2811.750) * [-2811.706] (-2820.832) (-2818.251) (-2811.360) -- 0:01:03
877000 -- (-2814.735) (-2832.273) (-2821.893) [-2812.044] * [-2812.471] (-2827.786) (-2814.207) (-2816.415) -- 0:01:03
877500 -- (-2815.185) [-2810.933] (-2820.113) (-2817.343) * (-2819.894) (-2826.886) [-2808.877] (-2831.547) -- 0:01:03
878000 -- (-2824.372) (-2818.971) (-2814.576) [-2814.735] * (-2820.726) (-2819.983) [-2817.366] (-2822.284) -- 0:01:03
878500 -- (-2817.723) (-2822.111) [-2810.846] (-2813.316) * [-2813.406] (-2813.898) (-2815.802) (-2815.429) -- 0:01:02
879000 -- [-2812.963] (-2812.965) (-2826.188) (-2817.406) * (-2821.230) [-2822.241] (-2821.151) (-2814.884) -- 0:01:02
879500 -- (-2818.867) (-2809.819) [-2825.325] (-2830.606) * (-2825.496) [-2812.909] (-2814.337) (-2823.644) -- 0:01:02
880000 -- (-2829.341) (-2816.832) (-2821.382) [-2818.062] * (-2824.230) (-2824.279) [-2811.338] (-2815.074) -- 0:01:02
Average standard deviation of split frequencies: 0.001487
880500 -- (-2821.093) [-2818.004] (-2820.503) (-2815.164) * (-2821.602) (-2821.566) [-2818.380] (-2814.743) -- 0:01:01
881000 -- (-2817.623) (-2808.806) [-2815.638] (-2808.184) * (-2818.929) (-2821.750) [-2810.161] (-2818.208) -- 0:01:01
881500 -- (-2811.560) (-2807.414) [-2812.933] (-2813.636) * [-2818.460] (-2817.743) (-2812.528) (-2817.250) -- 0:01:01
882000 -- (-2817.062) (-2816.443) [-2810.884] (-2826.321) * (-2819.645) [-2807.192] (-2811.234) (-2816.532) -- 0:01:01
882500 -- (-2822.383) (-2812.518) [-2810.728] (-2821.999) * (-2818.045) [-2810.755] (-2819.863) (-2811.942) -- 0:01:00
883000 -- (-2813.247) [-2808.262] (-2818.973) (-2814.520) * (-2816.422) (-2820.431) (-2827.962) [-2817.132] -- 0:01:00
883500 -- (-2822.606) (-2825.540) [-2821.057] (-2817.567) * (-2808.658) [-2813.508] (-2818.425) (-2830.672) -- 0:01:00
884000 -- [-2813.952] (-2816.445) (-2818.169) (-2811.891) * (-2815.180) [-2816.998] (-2814.049) (-2824.300) -- 0:00:59
884500 -- (-2828.030) [-2813.483] (-2809.321) (-2824.285) * [-2820.572] (-2814.031) (-2818.009) (-2820.242) -- 0:00:59
885000 -- (-2818.604) (-2820.086) (-2814.598) [-2811.901] * [-2815.446] (-2823.828) (-2816.048) (-2818.612) -- 0:00:59
Average standard deviation of split frequencies: 0.001360
885500 -- (-2813.922) (-2826.259) (-2816.322) [-2810.207] * (-2820.919) (-2828.309) [-2816.996] (-2809.307) -- 0:00:59
886000 -- (-2814.105) (-2821.024) [-2810.867] (-2807.594) * (-2828.974) (-2821.065) (-2815.269) [-2817.953] -- 0:00:58
886500 -- (-2812.750) (-2820.168) (-2810.566) [-2811.558] * (-2816.049) (-2825.311) (-2813.438) [-2811.207] -- 0:00:58
887000 -- [-2815.258] (-2821.717) (-2826.727) (-2818.771) * [-2811.702] (-2823.457) (-2820.007) (-2828.572) -- 0:00:58
887500 -- [-2814.040] (-2820.709) (-2813.455) (-2824.476) * (-2826.276) (-2813.828) (-2813.868) [-2821.218] -- 0:00:58
888000 -- (-2808.381) [-2809.250] (-2824.521) (-2831.411) * (-2812.292) [-2806.550] (-2822.161) (-2831.044) -- 0:00:57
888500 -- (-2819.580) (-2814.487) (-2818.300) [-2814.265] * (-2811.235) [-2813.977] (-2821.394) (-2828.294) -- 0:00:57
889000 -- (-2816.094) (-2811.119) (-2814.904) [-2809.267] * [-2814.158] (-2814.799) (-2814.934) (-2820.401) -- 0:00:57
889500 -- (-2818.226) (-2819.929) [-2818.407] (-2815.088) * [-2809.241] (-2820.130) (-2808.095) (-2813.561) -- 0:00:57
890000 -- (-2819.588) (-2809.256) (-2826.143) [-2817.947] * (-2819.138) (-2817.051) (-2824.941) [-2807.405] -- 0:00:56
Average standard deviation of split frequencies: 0.001117
890500 -- (-2817.742) (-2819.289) [-2814.047] (-2815.907) * [-2814.371] (-2815.549) (-2818.447) (-2810.004) -- 0:00:56
891000 -- (-2821.433) (-2827.755) (-2817.534) [-2811.371] * (-2811.192) (-2813.833) (-2812.444) [-2812.579] -- 0:00:56
891500 -- (-2828.415) [-2809.844] (-2829.669) (-2810.898) * (-2813.625) [-2813.314] (-2827.797) (-2810.766) -- 0:00:56
892000 -- (-2817.281) (-2816.636) [-2818.666] (-2815.510) * (-2811.777) (-2827.856) [-2815.797] (-2810.396) -- 0:00:55
892500 -- (-2823.842) [-2827.865] (-2816.256) (-2824.640) * (-2815.592) [-2811.597] (-2812.460) (-2815.602) -- 0:00:55
893000 -- (-2822.732) [-2822.341] (-2813.518) (-2814.398) * [-2818.933] (-2815.619) (-2814.606) (-2814.971) -- 0:00:55
893500 -- (-2816.452) (-2826.909) (-2814.264) [-2807.077] * (-2806.464) (-2816.242) [-2814.456] (-2823.864) -- 0:00:55
894000 -- (-2826.733) (-2828.383) [-2814.618] (-2813.766) * (-2820.256) [-2814.570] (-2810.529) (-2820.466) -- 0:00:54
894500 -- (-2818.971) [-2820.160] (-2811.639) (-2825.093) * (-2810.433) [-2819.900] (-2815.745) (-2814.950) -- 0:00:54
895000 -- (-2813.003) (-2810.290) [-2816.209] (-2818.252) * (-2821.306) (-2809.816) (-2818.862) [-2816.297] -- 0:00:54
Average standard deviation of split frequencies: 0.001461
895500 -- [-2808.324] (-2812.033) (-2812.131) (-2816.072) * (-2814.938) [-2813.585] (-2816.537) (-2820.216) -- 0:00:54
896000 -- (-2823.768) (-2819.545) [-2810.306] (-2821.482) * [-2815.126] (-2820.649) (-2818.482) (-2815.902) -- 0:00:53
896500 -- (-2829.418) (-2809.805) (-2821.369) [-2814.656] * [-2814.231] (-2819.654) (-2816.410) (-2814.839) -- 0:00:53
897000 -- (-2820.740) [-2810.686] (-2822.076) (-2810.687) * (-2820.274) (-2819.381) [-2813.448] (-2828.216) -- 0:00:53
897500 -- (-2814.271) (-2819.682) (-2823.690) [-2810.284] * (-2812.519) [-2816.219] (-2816.713) (-2818.306) -- 0:00:52
898000 -- (-2812.716) [-2812.524] (-2817.831) (-2822.809) * [-2820.217] (-2813.651) (-2815.898) (-2824.730) -- 0:00:52
898500 -- (-2814.220) (-2822.382) (-2818.910) [-2815.960] * (-2823.352) (-2820.193) (-2817.423) [-2811.121] -- 0:00:52
899000 -- (-2822.605) [-2818.899] (-2824.121) (-2823.686) * [-2818.075] (-2810.841) (-2817.210) (-2825.433) -- 0:00:52
899500 -- (-2814.224) [-2808.379] (-2830.079) (-2812.923) * (-2821.465) [-2815.588] (-2829.039) (-2820.896) -- 0:00:51
900000 -- (-2821.846) (-2819.581) (-2820.349) [-2820.238] * [-2816.571] (-2821.013) (-2828.805) (-2813.616) -- 0:00:51
Average standard deviation of split frequencies: 0.001221
900500 -- (-2821.844) (-2824.792) [-2810.634] (-2821.373) * (-2817.395) [-2816.035] (-2823.852) (-2821.751) -- 0:00:51
901000 -- (-2822.777) [-2814.693] (-2810.431) (-2819.472) * [-2817.420] (-2823.093) (-2814.430) (-2820.683) -- 0:00:51
901500 -- (-2831.051) (-2809.771) (-2817.441) [-2817.849] * (-2811.299) (-2816.342) [-2814.297] (-2819.645) -- 0:00:50
902000 -- [-2818.877] (-2823.518) (-2820.747) (-2816.882) * (-2814.671) (-2832.462) (-2814.070) [-2818.667] -- 0:00:50
902500 -- [-2816.979] (-2808.566) (-2815.004) (-2816.577) * (-2810.642) (-2810.317) [-2815.252] (-2822.856) -- 0:00:50
903000 -- (-2815.148) [-2816.663] (-2830.251) (-2807.597) * (-2826.372) [-2813.087] (-2820.574) (-2817.819) -- 0:00:50
903500 -- (-2817.607) (-2825.298) (-2824.318) [-2815.862] * [-2818.267] (-2812.779) (-2817.775) (-2813.436) -- 0:00:49
904000 -- (-2810.939) (-2814.520) (-2834.325) [-2818.144] * [-2811.975] (-2817.483) (-2817.777) (-2817.903) -- 0:00:49
904500 -- [-2815.846] (-2818.650) (-2824.500) (-2810.679) * (-2813.670) (-2820.833) [-2817.390] (-2818.563) -- 0:00:49
905000 -- (-2820.002) (-2830.100) (-2819.847) [-2814.123] * (-2817.492) (-2821.633) (-2815.008) [-2824.461] -- 0:00:49
Average standard deviation of split frequencies: 0.001445
905500 -- (-2810.718) (-2813.674) [-2820.243] (-2808.665) * (-2819.647) (-2815.354) [-2819.313] (-2812.826) -- 0:00:48
906000 -- [-2812.198] (-2819.592) (-2818.452) (-2823.254) * (-2827.279) (-2823.528) [-2816.544] (-2811.410) -- 0:00:48
906500 -- (-2817.213) (-2820.356) (-2815.223) [-2816.057] * (-2817.224) (-2819.284) [-2814.324] (-2813.694) -- 0:00:48
907000 -- [-2815.699] (-2827.724) (-2820.450) (-2816.137) * [-2812.970] (-2815.630) (-2818.297) (-2812.842) -- 0:00:48
907500 -- (-2818.790) [-2817.134] (-2816.364) (-2817.388) * (-2815.659) [-2819.293] (-2811.146) (-2817.418) -- 0:00:47
908000 -- (-2819.415) (-2815.695) [-2813.290] (-2811.319) * (-2812.269) (-2822.451) [-2816.363] (-2822.545) -- 0:00:47
908500 -- (-2817.247) (-2830.627) [-2821.651] (-2827.789) * (-2821.031) [-2814.231] (-2814.743) (-2817.078) -- 0:00:47
909000 -- [-2819.515] (-2825.452) (-2815.147) (-2810.534) * [-2813.525] (-2830.190) (-2821.423) (-2820.197) -- 0:00:47
909500 -- (-2817.190) (-2824.225) (-2824.983) [-2813.736] * [-2811.750] (-2821.317) (-2810.899) (-2818.855) -- 0:00:46
910000 -- (-2834.209) [-2814.128] (-2835.131) (-2815.130) * [-2813.268] (-2822.695) (-2814.398) (-2820.354) -- 0:00:46
Average standard deviation of split frequencies: 0.001725
910500 -- [-2829.954] (-2811.841) (-2814.254) (-2811.013) * (-2827.014) (-2816.987) [-2809.189] (-2815.107) -- 0:00:46
911000 -- (-2825.961) (-2817.678) (-2819.257) [-2806.244] * (-2826.186) (-2822.029) (-2821.906) [-2816.118] -- 0:00:46
911500 -- (-2814.592) [-2824.839] (-2822.690) (-2810.235) * (-2817.331) (-2814.290) (-2813.057) [-2806.695] -- 0:00:45
912000 -- (-2813.584) [-2814.884] (-2812.703) (-2822.154) * (-2822.145) (-2816.520) [-2817.624] (-2812.609) -- 0:00:45
912500 -- (-2820.116) [-2812.861] (-2816.210) (-2818.047) * (-2818.668) (-2820.269) (-2814.470) [-2819.632] -- 0:00:45
913000 -- (-2815.042) (-2814.463) (-2813.198) [-2815.040] * [-2817.032] (-2813.101) (-2811.917) (-2815.933) -- 0:00:44
913500 -- (-2815.399) [-2809.313] (-2830.391) (-2821.672) * (-2821.359) (-2807.581) [-2814.016] (-2821.557) -- 0:00:44
914000 -- [-2815.238] (-2821.846) (-2818.208) (-2825.576) * (-2815.717) (-2819.844) [-2812.388] (-2822.181) -- 0:00:44
914500 -- (-2809.621) (-2815.080) [-2820.551] (-2819.626) * (-2816.130) (-2817.628) (-2822.241) [-2816.208] -- 0:00:44
915000 -- (-2811.967) (-2818.408) (-2815.238) [-2816.598] * [-2811.809] (-2809.258) (-2825.017) (-2809.663) -- 0:00:43
Average standard deviation of split frequencies: 0.001830
915500 -- [-2815.350] (-2823.055) (-2817.696) (-2822.657) * (-2812.899) (-2810.313) [-2819.522] (-2806.505) -- 0:00:43
916000 -- [-2809.189] (-2810.757) (-2823.677) (-2819.191) * (-2821.829) (-2811.388) (-2814.437) [-2811.001] -- 0:00:43
916500 -- [-2820.813] (-2819.897) (-2811.617) (-2815.477) * [-2817.640] (-2817.252) (-2813.265) (-2823.332) -- 0:00:43
917000 -- (-2812.796) [-2819.539] (-2816.833) (-2818.159) * (-2819.765) (-2825.479) (-2822.252) [-2815.453] -- 0:00:42
917500 -- [-2813.602] (-2821.374) (-2809.767) (-2817.668) * (-2825.213) (-2813.032) (-2813.429) [-2815.462] -- 0:00:42
918000 -- (-2811.169) [-2810.275] (-2818.396) (-2823.056) * (-2827.988) (-2811.801) [-2813.544] (-2817.328) -- 0:00:42
918500 -- (-2823.157) (-2812.762) [-2813.169] (-2828.604) * (-2815.337) [-2814.084] (-2813.330) (-2822.067) -- 0:00:42
919000 -- (-2820.952) [-2814.178] (-2811.109) (-2824.465) * (-2824.378) [-2813.460] (-2813.281) (-2815.489) -- 0:00:41
919500 -- [-2816.685] (-2815.202) (-2824.662) (-2811.390) * (-2819.450) (-2815.860) [-2808.125] (-2811.847) -- 0:00:41
920000 -- (-2817.529) [-2814.341] (-2816.848) (-2813.930) * [-2809.613] (-2824.050) (-2817.173) (-2815.282) -- 0:00:41
Average standard deviation of split frequencies: 0.001934
920500 -- (-2812.722) [-2811.342] (-2818.329) (-2808.643) * (-2814.189) [-2823.365] (-2809.093) (-2823.262) -- 0:00:41
921000 -- (-2824.384) [-2810.066] (-2812.412) (-2815.064) * (-2813.463) (-2807.938) [-2816.629] (-2821.663) -- 0:00:40
921500 -- (-2823.431) [-2825.222] (-2816.420) (-2812.565) * (-2813.046) (-2825.925) [-2818.369] (-2816.909) -- 0:00:40
922000 -- (-2810.501) (-2816.829) (-2822.209) [-2816.199] * (-2815.306) (-2815.238) (-2829.289) [-2814.824] -- 0:00:40
922500 -- (-2819.491) [-2821.216] (-2822.871) (-2821.271) * [-2813.092] (-2821.652) (-2810.189) (-2820.637) -- 0:00:40
923000 -- (-2832.429) (-2818.743) (-2812.270) [-2820.501] * (-2829.716) [-2817.805] (-2811.950) (-2818.307) -- 0:00:39
923500 -- (-2817.883) (-2820.490) [-2813.622] (-2820.990) * (-2820.978) [-2823.041] (-2819.933) (-2813.254) -- 0:00:39
924000 -- [-2822.592] (-2816.133) (-2812.603) (-2807.958) * (-2818.154) (-2812.784) (-2814.955) [-2812.133] -- 0:00:39
924500 -- [-2811.723] (-2819.855) (-2815.509) (-2819.404) * (-2817.930) (-2822.684) [-2814.888] (-2813.773) -- 0:00:39
925000 -- [-2813.237] (-2810.705) (-2811.634) (-2820.902) * (-2812.170) (-2814.961) (-2825.747) [-2814.261] -- 0:00:38
Average standard deviation of split frequencies: 0.002489
925500 -- (-2820.246) (-2819.015) (-2822.882) [-2814.239] * (-2811.931) (-2812.524) (-2817.436) [-2810.286] -- 0:00:38
926000 -- (-2826.464) [-2816.040] (-2819.984) (-2813.149) * (-2810.428) (-2818.994) [-2817.322] (-2818.479) -- 0:00:38
926500 -- [-2815.309] (-2809.432) (-2811.745) (-2819.634) * (-2812.934) (-2819.843) (-2821.469) [-2816.226] -- 0:00:37
927000 -- (-2816.437) [-2816.417] (-2813.700) (-2810.003) * (-2826.246) [-2813.777] (-2813.424) (-2819.210) -- 0:00:37
927500 -- (-2813.289) [-2816.706] (-2816.852) (-2810.365) * (-2826.951) (-2818.486) [-2807.537] (-2826.984) -- 0:00:37
928000 -- (-2822.932) (-2817.447) (-2827.800) [-2818.031] * (-2823.391) (-2816.067) [-2815.519] (-2812.362) -- 0:00:37
928500 -- (-2832.680) (-2815.154) (-2812.744) [-2806.749] * (-2822.447) (-2819.501) [-2813.408] (-2816.688) -- 0:00:36
929000 -- (-2816.465) (-2806.979) [-2818.943] (-2813.949) * [-2817.262] (-2824.977) (-2811.471) (-2812.184) -- 0:00:36
929500 -- (-2815.820) (-2814.076) [-2813.747] (-2816.914) * [-2814.186] (-2817.582) (-2821.114) (-2808.537) -- 0:00:36
930000 -- (-2815.649) (-2821.062) [-2821.588] (-2818.598) * (-2823.276) [-2809.388] (-2822.023) (-2815.769) -- 0:00:36
Average standard deviation of split frequencies: 0.002758
930500 -- [-2807.198] (-2826.907) (-2812.893) (-2828.968) * (-2814.344) (-2814.177) (-2815.578) [-2811.053] -- 0:00:35
931000 -- [-2810.590] (-2810.862) (-2808.274) (-2810.854) * [-2820.364] (-2823.158) (-2816.491) (-2812.499) -- 0:00:35
931500 -- (-2805.882) [-2816.209] (-2818.024) (-2826.462) * (-2833.229) [-2811.951] (-2824.345) (-2815.023) -- 0:00:35
932000 -- (-2806.986) (-2820.271) [-2813.763] (-2813.892) * (-2823.378) [-2820.731] (-2824.827) (-2822.541) -- 0:00:35
932500 -- (-2808.844) (-2818.104) [-2811.518] (-2822.235) * (-2812.460) (-2818.395) (-2818.027) [-2818.672] -- 0:00:34
933000 -- [-2815.941] (-2806.392) (-2811.251) (-2814.549) * (-2813.646) (-2817.182) [-2824.977] (-2819.178) -- 0:00:34
933500 -- (-2815.336) (-2820.346) [-2821.337] (-2833.019) * (-2822.888) [-2819.390] (-2820.942) (-2821.831) -- 0:00:34
934000 -- [-2816.123] (-2814.510) (-2810.949) (-2823.251) * (-2813.767) (-2811.334) (-2818.573) [-2815.199] -- 0:00:34
934500 -- (-2814.854) [-2813.712] (-2817.377) (-2821.800) * (-2814.703) (-2816.011) (-2816.902) [-2813.232] -- 0:00:33
935000 -- (-2818.402) (-2822.864) [-2819.822] (-2816.446) * (-2823.641) (-2810.986) (-2818.390) [-2817.712] -- 0:00:33
Average standard deviation of split frequencies: 0.002462
935500 -- (-2813.522) (-2823.471) (-2819.357) [-2816.871] * [-2812.959] (-2815.045) (-2827.538) (-2810.847) -- 0:00:33
936000 -- [-2820.451] (-2819.782) (-2815.818) (-2819.550) * [-2814.015] (-2820.314) (-2814.081) (-2814.764) -- 0:00:33
936500 -- (-2825.965) (-2814.935) (-2818.122) [-2814.978] * (-2821.095) (-2824.291) [-2808.210] (-2815.146) -- 0:00:32
937000 -- (-2815.880) (-2813.045) [-2818.308] (-2818.132) * (-2824.125) [-2809.302] (-2818.555) (-2815.905) -- 0:00:32
937500 -- (-2815.906) (-2823.721) (-2812.846) [-2820.733] * (-2819.892) (-2827.440) (-2837.945) [-2811.841] -- 0:00:32
938000 -- (-2821.372) (-2818.238) (-2816.703) [-2809.444] * [-2814.735] (-2819.887) (-2818.478) (-2813.925) -- 0:00:32
938500 -- (-2819.118) (-2818.086) [-2814.308] (-2813.447) * [-2811.475] (-2828.444) (-2822.019) (-2810.543) -- 0:00:31
939000 -- (-2823.326) (-2824.352) [-2814.800] (-2817.338) * (-2817.379) (-2821.145) [-2815.540] (-2820.767) -- 0:00:31
939500 -- (-2820.725) (-2817.536) [-2814.378] (-2816.613) * (-2818.782) (-2812.371) [-2818.274] (-2815.126) -- 0:00:31
940000 -- (-2821.812) (-2833.759) [-2818.969] (-2815.446) * [-2816.777] (-2820.907) (-2811.189) (-2814.886) -- 0:00:31
Average standard deviation of split frequencies: 0.002172
940500 -- (-2820.360) (-2814.433) (-2818.262) [-2807.504] * (-2826.536) (-2821.011) (-2820.749) [-2813.951] -- 0:00:30
941000 -- (-2825.847) (-2811.534) [-2815.995] (-2818.338) * (-2821.026) (-2820.830) [-2823.016] (-2811.126) -- 0:00:30
941500 -- [-2811.684] (-2815.914) (-2822.855) (-2816.177) * [-2814.745] (-2815.307) (-2821.575) (-2814.961) -- 0:00:30
942000 -- [-2817.567] (-2823.884) (-2825.469) (-2818.575) * [-2817.248] (-2821.557) (-2818.099) (-2821.829) -- 0:00:29
942500 -- (-2813.704) (-2818.436) (-2819.164) [-2821.491] * (-2820.985) [-2826.603] (-2813.478) (-2813.030) -- 0:00:29
943000 -- (-2825.855) (-2822.444) [-2811.385] (-2809.145) * (-2820.553) (-2814.113) [-2809.657] (-2816.330) -- 0:00:29
943500 -- [-2819.169] (-2816.830) (-2815.968) (-2815.073) * (-2814.297) (-2815.799) (-2819.134) [-2814.882] -- 0:00:29
944000 -- (-2816.547) (-2824.499) (-2813.826) [-2808.194] * (-2817.391) (-2817.051) (-2811.957) [-2816.044] -- 0:00:28
944500 -- (-2819.620) (-2826.153) [-2815.711] (-2816.245) * (-2816.890) (-2816.687) [-2816.701] (-2814.091) -- 0:00:28
945000 -- (-2825.024) [-2811.820] (-2811.075) (-2818.668) * (-2821.279) [-2817.076] (-2814.300) (-2815.021) -- 0:00:28
Average standard deviation of split frequencies: 0.001827
945500 -- [-2812.236] (-2819.338) (-2813.393) (-2816.263) * (-2821.232) [-2815.786] (-2815.211) (-2814.026) -- 0:00:28
946000 -- (-2817.932) (-2808.214) [-2813.736] (-2820.951) * [-2813.525] (-2814.570) (-2814.541) (-2823.678) -- 0:00:27
946500 -- (-2819.152) (-2819.742) (-2822.853) [-2807.016] * (-2814.434) (-2817.017) [-2810.830] (-2814.646) -- 0:00:27
947000 -- (-2823.303) (-2816.427) (-2817.249) [-2807.257] * (-2815.338) (-2820.127) [-2816.694] (-2813.656) -- 0:00:27
947500 -- (-2831.142) (-2825.583) (-2813.684) [-2815.966] * (-2822.006) (-2820.836) (-2815.736) [-2811.900] -- 0:00:27
948000 -- (-2821.343) [-2818.779] (-2812.262) (-2813.739) * (-2824.191) (-2821.777) [-2817.230] (-2808.476) -- 0:00:26
948500 -- (-2828.230) [-2817.974] (-2806.291) (-2818.503) * (-2819.511) (-2826.739) [-2812.690] (-2819.480) -- 0:00:26
949000 -- (-2814.349) (-2815.849) [-2809.774] (-2821.817) * (-2816.826) (-2820.948) (-2819.332) [-2817.691] -- 0:00:26
949500 -- (-2812.007) (-2810.654) (-2813.613) [-2811.135] * (-2814.738) [-2816.605] (-2812.822) (-2812.613) -- 0:00:26
950000 -- [-2813.583] (-2823.265) (-2814.672) (-2818.024) * (-2815.350) [-2818.347] (-2810.695) (-2818.338) -- 0:00:25
Average standard deviation of split frequencies: 0.001873
950500 -- (-2816.022) (-2817.807) (-2812.566) [-2819.610] * (-2826.037) (-2818.739) [-2819.083] (-2821.508) -- 0:00:25
951000 -- (-2822.262) (-2818.626) [-2818.134] (-2821.127) * (-2812.696) (-2813.010) [-2816.382] (-2826.604) -- 0:00:25
951500 -- (-2823.507) (-2817.273) (-2811.683) [-2816.355] * [-2818.416] (-2817.237) (-2814.568) (-2818.629) -- 0:00:25
952000 -- (-2821.277) [-2819.118] (-2818.698) (-2825.852) * (-2814.217) (-2817.869) (-2828.656) [-2818.754] -- 0:00:24
952500 -- (-2818.815) [-2809.717] (-2807.848) (-2823.100) * [-2814.610] (-2812.210) (-2824.896) (-2816.285) -- 0:00:24
953000 -- [-2808.573] (-2815.991) (-2814.021) (-2817.843) * (-2816.279) (-2815.896) [-2812.639] (-2806.475) -- 0:00:24
953500 -- [-2820.849] (-2812.271) (-2824.123) (-2806.514) * (-2814.789) [-2809.796] (-2814.053) (-2816.776) -- 0:00:24
954000 -- [-2817.432] (-2821.673) (-2818.607) (-2816.360) * (-2813.919) (-2813.230) (-2816.391) [-2813.962] -- 0:00:23
954500 -- (-2826.417) (-2816.580) (-2822.576) [-2819.308] * (-2809.195) [-2813.580] (-2822.088) (-2804.685) -- 0:00:23
955000 -- (-2812.665) [-2814.870] (-2816.993) (-2816.899) * (-2824.721) (-2812.481) [-2819.764] (-2817.060) -- 0:00:23
Average standard deviation of split frequencies: 0.001753
955500 -- (-2811.128) (-2813.027) (-2822.577) [-2809.997] * (-2819.930) [-2809.410] (-2814.442) (-2818.023) -- 0:00:23
956000 -- (-2815.945) (-2817.744) (-2809.885) [-2813.112] * (-2814.021) [-2815.146] (-2817.589) (-2815.714) -- 0:00:22
956500 -- (-2808.377) [-2813.536] (-2806.929) (-2814.580) * (-2815.431) [-2808.368] (-2811.808) (-2812.069) -- 0:00:22
957000 -- (-2821.206) [-2817.876] (-2815.998) (-2820.833) * [-2814.225] (-2820.841) (-2813.761) (-2820.496) -- 0:00:22
957500 -- [-2818.507] (-2814.453) (-2821.769) (-2811.687) * (-2823.018) (-2820.766) [-2816.041] (-2813.029) -- 0:00:21
958000 -- (-2808.595) (-2823.383) (-2820.325) [-2816.598] * (-2818.971) (-2814.971) [-2813.332] (-2810.536) -- 0:00:21
958500 -- (-2815.956) [-2809.434] (-2814.778) (-2814.270) * (-2820.650) (-2812.594) (-2818.992) [-2823.111] -- 0:00:21
959000 -- [-2814.380] (-2818.116) (-2825.229) (-2817.779) * (-2819.119) [-2810.381] (-2820.424) (-2812.428) -- 0:00:21
959500 -- (-2816.828) (-2817.178) (-2816.098) [-2810.928] * (-2817.208) [-2818.311] (-2818.114) (-2812.690) -- 0:00:20
960000 -- (-2813.139) (-2821.740) [-2818.418] (-2822.922) * (-2830.120) [-2816.393] (-2815.236) (-2816.863) -- 0:00:20
Average standard deviation of split frequencies: 0.001854
960500 -- (-2809.909) (-2808.515) [-2820.955] (-2817.080) * (-2827.849) (-2823.230) [-2811.925] (-2815.865) -- 0:00:20
961000 -- (-2817.435) (-2819.625) [-2814.609] (-2818.422) * (-2825.151) [-2817.686] (-2812.397) (-2822.058) -- 0:00:20
961500 -- (-2818.291) [-2807.717] (-2814.287) (-2825.259) * (-2837.902) (-2809.281) [-2812.698] (-2815.743) -- 0:00:19
962000 -- (-2818.119) (-2819.067) [-2817.757] (-2822.703) * (-2825.054) (-2820.815) [-2816.331] (-2806.805) -- 0:00:19
962500 -- (-2814.593) (-2823.473) [-2821.615] (-2814.145) * (-2822.178) [-2818.922] (-2813.861) (-2815.813) -- 0:00:19
963000 -- [-2814.268] (-2816.288) (-2823.591) (-2817.309) * [-2816.813] (-2816.325) (-2818.925) (-2808.885) -- 0:00:19
963500 -- (-2812.869) (-2823.052) [-2810.902] (-2814.844) * (-2819.439) (-2817.328) [-2815.808] (-2815.798) -- 0:00:18
964000 -- [-2815.526] (-2822.727) (-2826.287) (-2820.282) * (-2819.906) (-2813.353) [-2815.703] (-2813.105) -- 0:00:18
964500 -- (-2815.217) [-2819.772] (-2822.882) (-2814.787) * (-2827.371) (-2817.175) [-2810.830] (-2812.141) -- 0:00:18
965000 -- (-2813.362) [-2812.906] (-2815.050) (-2824.737) * [-2819.263] (-2815.891) (-2821.365) (-2810.965) -- 0:00:18
Average standard deviation of split frequencies: 0.001518
965500 -- (-2820.503) (-2815.055) (-2815.695) [-2814.887] * (-2819.288) [-2808.701] (-2816.319) (-2824.634) -- 0:00:17
966000 -- (-2820.334) (-2812.345) [-2818.740] (-2820.433) * (-2815.651) (-2808.025) [-2816.419] (-2813.727) -- 0:00:17
966500 -- (-2814.102) [-2812.662] (-2819.087) (-2813.248) * (-2814.403) [-2809.172] (-2822.571) (-2817.217) -- 0:00:17
967000 -- (-2817.699) (-2813.714) (-2819.362) [-2815.057] * (-2819.294) (-2815.299) [-2811.317] (-2816.037) -- 0:00:17
967500 -- [-2821.069] (-2814.552) (-2819.007) (-2810.038) * (-2814.872) (-2825.352) (-2817.375) [-2814.098] -- 0:00:16
968000 -- [-2815.898] (-2816.818) (-2826.596) (-2820.673) * (-2821.182) (-2826.956) (-2813.655) [-2814.661] -- 0:00:16
968500 -- (-2823.207) [-2817.218] (-2822.554) (-2808.449) * (-2822.047) (-2820.085) [-2815.808] (-2815.860) -- 0:00:16
969000 -- (-2826.820) [-2819.182] (-2816.729) (-2814.977) * (-2808.672) (-2822.800) [-2820.441] (-2816.296) -- 0:00:16
969500 -- (-2812.669) (-2813.766) [-2808.948] (-2812.199) * [-2818.358] (-2817.594) (-2820.601) (-2811.916) -- 0:00:15
970000 -- (-2812.981) (-2812.784) [-2816.562] (-2818.373) * (-2809.772) (-2814.901) [-2815.096] (-2814.549) -- 0:00:15
Average standard deviation of split frequencies: 0.001511
970500 -- (-2815.001) [-2810.440] (-2821.051) (-2821.252) * (-2819.050) [-2809.546] (-2813.591) (-2820.765) -- 0:00:15
971000 -- [-2817.886] (-2834.111) (-2825.228) (-2816.480) * (-2815.971) (-2820.351) [-2812.083] (-2811.097) -- 0:00:14
971500 -- (-2808.672) (-2829.671) [-2812.835] (-2808.026) * [-2813.005] (-2816.965) (-2817.360) (-2815.185) -- 0:00:14
972000 -- (-2808.315) (-2819.474) (-2812.261) [-2820.929] * (-2813.306) [-2811.328] (-2812.541) (-2807.920) -- 0:00:14
972500 -- [-2810.762] (-2831.865) (-2823.210) (-2813.361) * [-2816.770] (-2821.404) (-2810.116) (-2821.497) -- 0:00:14
973000 -- [-2817.898] (-2818.998) (-2809.994) (-2812.654) * (-2827.925) (-2819.773) (-2821.507) [-2814.786] -- 0:00:13
973500 -- (-2822.700) (-2815.794) (-2814.997) [-2813.158] * (-2821.620) (-2815.550) [-2811.177] (-2816.435) -- 0:00:13
974000 -- (-2814.267) (-2811.519) (-2822.689) [-2808.478] * (-2819.806) (-2826.588) [-2809.516] (-2812.286) -- 0:00:13
974500 -- [-2809.750] (-2808.510) (-2816.887) (-2820.385) * (-2816.864) (-2814.483) (-2829.307) [-2809.697] -- 0:00:13
975000 -- (-2813.167) (-2810.499) [-2819.141] (-2817.448) * [-2816.353] (-2822.172) (-2811.398) (-2815.639) -- 0:00:12
Average standard deviation of split frequencies: 0.001556
975500 -- (-2816.757) (-2815.359) (-2816.618) [-2812.034] * (-2819.904) (-2813.237) [-2823.948] (-2811.177) -- 0:00:12
976000 -- (-2806.326) (-2823.307) (-2822.156) [-2813.396] * (-2806.587) [-2811.897] (-2822.699) (-2824.799) -- 0:00:12
976500 -- [-2814.588] (-2820.408) (-2829.046) (-2821.144) * (-2814.160) (-2831.071) (-2815.060) [-2812.767] -- 0:00:12
977000 -- (-2819.106) [-2812.040] (-2816.914) (-2817.250) * (-2810.431) (-2814.584) [-2813.159] (-2825.563) -- 0:00:11
977500 -- [-2809.766] (-2810.415) (-2828.973) (-2823.847) * (-2812.115) (-2815.042) [-2816.684] (-2824.424) -- 0:00:11
978000 -- (-2817.369) (-2805.872) (-2824.017) [-2818.525] * [-2814.627] (-2820.488) (-2826.221) (-2817.089) -- 0:00:11
978500 -- (-2811.688) (-2811.655) [-2815.700] (-2819.596) * (-2815.769) (-2821.430) [-2818.442] (-2815.370) -- 0:00:11
979000 -- (-2819.568) (-2818.508) (-2824.349) [-2813.988] * [-2818.166] (-2815.886) (-2814.052) (-2824.189) -- 0:00:10
979500 -- (-2815.435) (-2814.505) [-2817.072] (-2818.018) * (-2812.424) (-2820.689) [-2815.218] (-2820.551) -- 0:00:10
980000 -- (-2818.255) (-2810.243) [-2811.015] (-2806.765) * (-2810.374) [-2817.828] (-2821.110) (-2824.234) -- 0:00:10
Average standard deviation of split frequencies: 0.001709
980500 -- (-2812.193) (-2819.611) [-2812.949] (-2818.544) * (-2809.863) [-2821.758] (-2814.811) (-2813.685) -- 0:00:10
981000 -- (-2826.623) (-2833.861) [-2816.781] (-2816.470) * (-2816.386) [-2812.307] (-2815.946) (-2817.902) -- 0:00:09
981500 -- (-2818.174) (-2814.152) (-2815.394) [-2814.014] * [-2815.820] (-2819.153) (-2821.170) (-2817.011) -- 0:00:09
982000 -- (-2817.000) (-2813.374) (-2822.601) [-2810.147] * (-2816.621) [-2816.300] (-2824.897) (-2824.115) -- 0:00:09
982500 -- (-2825.539) (-2812.947) [-2815.215] (-2820.075) * [-2808.346] (-2818.044) (-2821.898) (-2809.884) -- 0:00:09
983000 -- [-2816.388] (-2820.431) (-2821.820) (-2814.192) * [-2812.273] (-2820.789) (-2809.982) (-2821.938) -- 0:00:08
983500 -- (-2812.587) (-2820.843) (-2829.116) [-2814.379] * [-2822.089] (-2820.198) (-2817.152) (-2827.149) -- 0:00:08
984000 -- (-2817.966) [-2816.252] (-2821.785) (-2812.461) * (-2817.201) (-2817.799) [-2819.906] (-2817.462) -- 0:00:08
984500 -- (-2822.587) (-2811.595) [-2814.435] (-2820.682) * (-2814.246) (-2816.910) (-2815.790) [-2813.381] -- 0:00:08
985000 -- (-2814.537) (-2817.328) (-2812.856) [-2816.382] * (-2817.003) (-2814.958) [-2819.955] (-2811.976) -- 0:00:07
Average standard deviation of split frequencies: 0.001434
985500 -- [-2818.086] (-2815.273) (-2818.287) (-2821.030) * [-2811.654] (-2817.942) (-2810.602) (-2810.855) -- 0:00:07
986000 -- [-2815.778] (-2822.704) (-2823.070) (-2811.212) * (-2822.482) [-2810.225] (-2810.467) (-2815.573) -- 0:00:07
986500 -- (-2810.714) (-2810.525) (-2813.767) [-2814.369] * (-2817.854) (-2814.193) [-2815.191] (-2812.473) -- 0:00:06
987000 -- (-2811.457) [-2811.430] (-2814.696) (-2819.889) * (-2824.321) (-2812.876) [-2833.123] (-2823.259) -- 0:00:06
987500 -- [-2805.083] (-2818.932) (-2818.311) (-2820.490) * [-2816.578] (-2820.080) (-2814.138) (-2820.477) -- 0:00:06
988000 -- [-2816.451] (-2826.846) (-2817.090) (-2814.054) * (-2813.412) [-2814.894] (-2820.232) (-2833.188) -- 0:00:06
988500 -- (-2815.796) [-2815.679] (-2819.757) (-2815.747) * (-2816.544) (-2819.094) [-2821.156] (-2818.483) -- 0:00:05
989000 -- [-2827.410] (-2822.246) (-2818.471) (-2819.479) * [-2814.930] (-2814.553) (-2813.402) (-2826.949) -- 0:00:05
989500 -- (-2809.272) (-2817.925) (-2812.708) [-2817.343] * [-2817.455] (-2815.815) (-2819.549) (-2833.251) -- 0:00:05
990000 -- (-2818.103) [-2807.877] (-2817.062) (-2833.694) * (-2819.901) (-2818.851) [-2818.595] (-2823.004) -- 0:00:05
Average standard deviation of split frequencies: 0.001480
990500 -- (-2817.902) [-2811.961] (-2828.308) (-2826.891) * (-2814.742) (-2819.932) (-2819.188) [-2811.054] -- 0:00:04
991000 -- (-2820.243) [-2811.771] (-2818.826) (-2822.763) * [-2811.228] (-2811.144) (-2814.797) (-2808.330) -- 0:00:04
991500 -- (-2812.701) [-2816.957] (-2807.380) (-2822.731) * (-2816.878) [-2817.699] (-2814.059) (-2812.638) -- 0:00:04
992000 -- (-2818.070) [-2814.910] (-2823.290) (-2819.481) * (-2814.105) [-2820.996] (-2809.795) (-2820.801) -- 0:00:04
992500 -- (-2816.246) (-2813.927) (-2813.029) [-2809.746] * (-2812.190) (-2824.347) [-2811.437] (-2813.220) -- 0:00:03
993000 -- (-2815.603) [-2808.059] (-2817.086) (-2821.255) * (-2816.107) (-2819.272) (-2817.721) [-2812.969] -- 0:00:03
993500 -- (-2817.788) (-2811.648) [-2808.205] (-2823.886) * [-2827.129] (-2812.661) (-2831.519) (-2817.217) -- 0:00:03
994000 -- (-2823.169) (-2816.151) (-2810.012) [-2814.828] * (-2820.566) (-2814.984) (-2818.310) [-2810.874] -- 0:00:03
994500 -- (-2821.712) (-2821.815) (-2815.150) [-2821.808] * (-2811.276) (-2830.640) (-2820.642) [-2813.597] -- 0:00:02
995000 -- (-2817.397) [-2814.751] (-2821.258) (-2816.483) * (-2821.654) [-2810.389] (-2810.007) (-2815.268) -- 0:00:02
Average standard deviation of split frequencies: 0.001630
995500 -- [-2819.395] (-2817.577) (-2817.895) (-2812.378) * [-2814.755] (-2820.354) (-2818.133) (-2817.674) -- 0:00:02
996000 -- (-2811.948) (-2811.798) (-2815.695) [-2812.107] * (-2812.973) [-2813.169] (-2820.377) (-2816.731) -- 0:00:02
996500 -- [-2812.447] (-2818.416) (-2812.697) (-2822.914) * (-2811.195) (-2824.507) [-2823.924] (-2820.045) -- 0:00:01
997000 -- (-2811.751) [-2815.123] (-2818.926) (-2820.764) * [-2820.018] (-2819.408) (-2819.916) (-2817.032) -- 0:00:01
997500 -- [-2818.037] (-2816.129) (-2810.586) (-2810.064) * (-2817.572) [-2819.201] (-2821.692) (-2816.927) -- 0:00:01
998000 -- (-2824.064) (-2809.565) (-2825.341) [-2817.214] * (-2810.035) (-2825.593) [-2815.469] (-2815.311) -- 0:00:01
998500 -- (-2829.973) (-2808.148) (-2820.543) [-2813.307] * (-2811.540) (-2828.250) [-2818.682] (-2815.717) -- 0:00:00
999000 -- [-2813.557] (-2821.958) (-2809.660) (-2814.524) * (-2817.671) (-2812.964) (-2819.331) [-2816.813] -- 0:00:00
999500 -- (-2819.750) (-2820.233) (-2817.651) [-2813.937] * (-2814.576) (-2810.202) (-2833.019) [-2822.902] -- 0:00:00
1000000 -- (-2816.727) (-2815.918) (-2807.625) [-2821.059] * (-2813.750) [-2812.083] (-2814.307) (-2828.821) -- 0:00:00
Average standard deviation of split frequencies: 0.001675
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2816.727081 -- 12.893608
Chain 1 -- -2816.727066 -- 12.893608
Chain 2 -- -2815.917995 -- 17.318677
Chain 2 -- -2815.917995 -- 17.318677
Chain 3 -- -2807.624591 -- 10.879777
Chain 3 -- -2807.624604 -- 10.879777
Chain 4 -- -2821.058922 -- 18.482428
Chain 4 -- -2821.058921 -- 18.482428
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2813.750430 -- 15.682569
Chain 1 -- -2813.750442 -- 15.682569
Chain 2 -- -2812.083045 -- 15.648663
Chain 2 -- -2812.083083 -- 15.648663
Chain 3 -- -2814.306843 -- 17.474291
Chain 3 -- -2814.306843 -- 17.474291
Chain 4 -- -2828.820643 -- 15.642094
Chain 4 -- -2828.820633 -- 15.642094
Analysis completed in 8 mins 37 seconds
Analysis used 516.98 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2802.24
Likelihood of best state for "cold" chain of run 2 was -2802.82
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
37.8 % ( 28 %) Dirichlet(Revmat{all})
54.1 % ( 29 %) Slider(Revmat{all})
25.4 % ( 29 %) Dirichlet(Pi{all})
27.7 % ( 24 %) Slider(Pi{all})
27.3 % ( 29 %) Multiplier(Alpha{1,2})
39.9 % ( 25 %) Multiplier(Alpha{3})
47.5 % ( 29 %) Slider(Pinvar{all})
6.0 % ( 4 %) ExtSPR(Tau{all},V{all})
0.7 % ( 0 %) ExtTBR(Tau{all},V{all})
7.1 % ( 12 %) NNI(Tau{all},V{all})
11.5 % ( 12 %) ParsSPR(Tau{all},V{all})
26.1 % ( 29 %) Multiplier(V{all})
32.0 % ( 25 %) Nodeslider(V{all})
25.0 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
38.4 % ( 26 %) Dirichlet(Revmat{all})
54.6 % ( 31 %) Slider(Revmat{all})
25.2 % ( 28 %) Dirichlet(Pi{all})
27.2 % ( 31 %) Slider(Pi{all})
27.4 % ( 31 %) Multiplier(Alpha{1,2})
40.0 % ( 23 %) Multiplier(Alpha{3})
47.3 % ( 26 %) Slider(Pinvar{all})
5.9 % ( 8 %) ExtSPR(Tau{all},V{all})
0.7 % ( 1 %) ExtTBR(Tau{all},V{all})
7.2 % ( 11 %) NNI(Tau{all},V{all})
11.6 % ( 11 %) ParsSPR(Tau{all},V{all})
26.2 % ( 28 %) Multiplier(V{all})
31.7 % ( 26 %) Nodeslider(V{all})
25.2 % ( 20 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.77 0.58 0.43
2 | 166692 0.79 0.61
3 | 166112 167124 0.81
4 | 166558 166774 166740
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.78 0.58 0.43
2 | 166492 0.79 0.61
3 | 166979 166548 0.80
4 | 166780 166868 166333
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2812.74
| 1 2 2 |
|2 2 2 1 |
| 1 1 11 1 1 2 1 1 2 1 1 |
| 2 12 12 1 1 12 2 1 2 |
| 2 2 2 1 22 11 * *22 2 2 11 22 2 11|
| 22 1 2 12 1 2 2 11 1 11 21 |
| * 1 2 22 1 1 1 1 *2 2 1 1 2 221 1 |
|1 **1 1 2 2 2 1 2 2 1 2 |
| 2 2 2 2 |
| 21 2 1 1 22|
| 1 1 |
| |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2818.77
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2809.02 -2825.15
2 -2809.21 -2825.99
--------------------------------------
TOTAL -2809.11 -2825.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.210236 0.010595 1.024679 1.420749 1.204523 1414.33 1457.67 1.000
r(A<->C){all} 0.110637 0.000407 0.072182 0.150517 0.109336 1146.84 1158.78 1.000
r(A<->G){all} 0.324980 0.001435 0.252437 0.398673 0.324466 764.44 876.09 1.000
r(A<->T){all} 0.073032 0.000427 0.034133 0.113933 0.071607 887.25 910.94 1.000
r(C<->G){all} 0.078661 0.000245 0.049255 0.109580 0.077504 1226.96 1235.74 1.000
r(C<->T){all} 0.344704 0.001333 0.277671 0.419486 0.344619 749.67 823.51 1.000
r(G<->T){all} 0.067986 0.000277 0.037146 0.100768 0.067005 1224.15 1260.00 1.001
pi(A){all} 0.234624 0.000212 0.205474 0.261198 0.233830 1009.49 1022.78 1.000
pi(C){all} 0.270069 0.000215 0.241585 0.298633 0.269992 1286.83 1291.67 1.000
pi(G){all} 0.281567 0.000219 0.254645 0.311200 0.281372 993.00 1160.08 1.000
pi(T){all} 0.213740 0.000182 0.187366 0.239303 0.213989 1044.51 1204.94 1.000
alpha{1,2} 0.129868 0.000227 0.100792 0.158588 0.128959 1425.12 1463.06 1.000
alpha{3} 3.466050 0.902013 1.786479 5.238749 3.344522 1078.06 1289.53 1.001
pinvar{all} 0.247450 0.002605 0.148051 0.350267 0.248377 1266.75 1287.19 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- .....******
13 -- ........**.
14 -- .**........
15 -- .....**...*
16 -- .....**....
17 -- ...********
18 -- ...**......
19 -- .......***.
20 -- .....**.***
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 3002 1.000000 0.000000 1.000000 1.000000 2
13 3002 1.000000 0.000000 1.000000 1.000000 2
14 3001 0.999667 0.000471 0.999334 1.000000 2
15 2994 0.997335 0.000942 0.996669 0.998001 2
16 2970 0.989340 0.003769 0.986676 0.992005 2
17 2865 0.954364 0.001413 0.953364 0.955363 2
18 2792 0.930047 0.003769 0.927382 0.932712 2
19 1829 0.609260 0.000471 0.608927 0.609594 2
20 1049 0.349434 0.004240 0.346436 0.352432 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.018871 0.000056 0.006415 0.034821 0.017966 1.001 2
length{all}[2] 0.004780 0.000012 0.000034 0.011444 0.004004 1.002 2
length{all}[3] 0.019493 0.000052 0.005917 0.033171 0.018769 1.000 2
length{all}[4] 0.093855 0.000375 0.059859 0.133873 0.091926 1.000 2
length{all}[5] 0.053516 0.000203 0.027418 0.082141 0.052397 1.000 2
length{all}[6] 0.084759 0.000392 0.048232 0.125576 0.082918 1.001 2
length{all}[7] 0.085546 0.000359 0.053004 0.124319 0.084013 1.000 2
length{all}[8] 0.192022 0.001127 0.128819 0.257614 0.189971 1.000 2
length{all}[9] 0.077925 0.000353 0.042890 0.115168 0.076413 1.000 2
length{all}[10] 0.074824 0.000352 0.038957 0.110665 0.073447 1.000 2
length{all}[11] 0.098429 0.000529 0.058239 0.145296 0.095954 1.000 2
length{all}[12] 0.133873 0.000802 0.084098 0.192967 0.131570 1.000 2
length{all}[13] 0.108657 0.000682 0.060890 0.160880 0.106983 1.000 2
length{all}[14] 0.026063 0.000084 0.009737 0.043746 0.025116 1.000 2
length{all}[15] 0.040455 0.000253 0.011068 0.070655 0.038483 1.000 2
length{all}[16] 0.035602 0.000251 0.006804 0.066088 0.034080 1.000 2
length{all}[17] 0.020102 0.000099 0.003618 0.040459 0.018707 1.000 2
length{all}[18] 0.020950 0.000133 0.000758 0.042363 0.019321 1.000 2
length{all}[19] 0.024452 0.000230 0.000079 0.052457 0.022556 1.000 2
length{all}[20] 0.020291 0.000189 0.000195 0.045745 0.017510 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.001675
Maximum standard deviation of split frequencies = 0.004240
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /-------------- C2 (2)
|--------------------------100--------------------------+
| \-------------- C3 (3)
|
+ /-------------- C4 (4)
| /--------------------93-------------------+
| | \-------------- C5 (5)
| |
| | /-------------- C6 (6)
| | /------99-----+
\------95-----+ | \-------------- C7 (7)
| /-----100-----+
| | \---------------------------- C11 (11)
| |
\-----100-----+ /---------------------------- C8 (8)
| |
\------61-----+ /-------------- C9 (9)
\-----100-----+
\-------------- C10 (10)
Phylogram (based on average branch lengths):
/---- C1 (1)
|
| /- C2 (2)
|----+
| \---- C3 (3)
|
+ /------------------ C4 (4)
| /---+
| | \---------- C5 (5)
| |
| | /----------------- C6 (6)
| | /------+
\---+ | \----------------- C7 (7)
| /------+
| | \------------------- C11 (11)
| |
\-------------------------+ /-------------------------------------- C8 (8)
| |
\---+ /---------------- C9 (9)
\--------------------+
\--------------- C10 (10)
|--------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (25 trees sampled):
90 % credible set contains 5 trees
95 % credible set contains 7 trees
99 % credible set contains 13 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 744
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sites with gaps or missing data are removed.
6 ambiguity characters in seq. 1
6 ambiguity characters in seq. 2
6 ambiguity characters in seq. 3
12 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
12 ambiguity characters in seq. 6
12 ambiguity characters in seq. 7
12 ambiguity characters in seq. 8
12 ambiguity characters in seq. 9
12 ambiguity characters in seq. 10
12 ambiguity characters in seq. 11
4 sites are removed. 157 158 247 248
Sequences read..
Counting site patterns.. 0:00
201 patterns at 244 / 244 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
196176 bytes for conP
27336 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
882792 bytes for conP, adjusted
0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 0.300000 1.300000
ntime & nrate & np: 19 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 21
lnL0 = -3252.099866
Iterating by ming2
Initial: fx= 3252.099866
x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 0.30000 1.30000
1 h-m-p 0.0000 0.0008 697.3806 +++YYCYCCC 3179.924978 6 0.0007 38 | 0/21
2 h-m-p 0.0003 0.0013 1454.7734 CYCCC 3158.516410 4 0.0002 69 | 0/21
3 h-m-p 0.0002 0.0009 551.0080 ++ 3018.079467 m 0.0009 93 | 0/21
4 h-m-p 0.0000 0.0000 39279.1873 +CCYC 3005.210187 3 0.0000 123 | 0/21
5 h-m-p 0.0000 0.0000 48463.1125 ++ 2962.495608 m 0.0000 147 | 0/21
6 h-m-p 0.0000 0.0000 21968.8801 +YCYCCC 2938.165532 5 0.0000 180 | 0/21
7 h-m-p 0.0000 0.0000 9678.0960 ++ 2844.632524 m 0.0000 204 | 0/21
8 h-m-p 0.0000 0.0000 693.6828
h-m-p: 6.24041792e-18 3.12020896e-17 6.93682768e+02 2844.632524
.. | 0/21
9 h-m-p 0.0000 0.0004 123448.4044 --YCYYCYC 2838.826687 6 0.0000 259 | 0/21
10 h-m-p 0.0000 0.0007 3188.1993 +YYYYCCC 2791.648706 6 0.0000 292 | 0/21
11 h-m-p 0.0001 0.0007 560.5621 +YCYCYCCC 2652.793423 7 0.0006 328 | 0/21
12 h-m-p 0.0000 0.0002 329.1770 YCCCCC 2650.677014 5 0.0000 361 | 0/21
13 h-m-p 0.0001 0.0007 117.7288 YCCCC 2648.815756 4 0.0003 392 | 0/21
14 h-m-p 0.0001 0.0005 197.8216 CCCC 2647.785573 3 0.0001 422 | 0/21
15 h-m-p 0.0004 0.0067 70.6452 CCC 2647.220770 2 0.0004 450 | 0/21
16 h-m-p 0.0004 0.0023 66.4788 CCCC 2646.731831 3 0.0004 480 | 0/21
17 h-m-p 0.0009 0.0045 26.6457 YC 2646.615574 1 0.0005 505 | 0/21
18 h-m-p 0.0003 0.0046 36.9291 +YCC 2646.377114 2 0.0009 533 | 0/21
19 h-m-p 0.0008 0.0040 35.8567 CCC 2646.184618 2 0.0009 561 | 0/21
20 h-m-p 0.0004 0.0137 82.0212 +CYC 2645.419145 2 0.0016 589 | 0/21
21 h-m-p 0.0015 0.0123 86.9080 CCC 2644.533945 2 0.0018 617 | 0/21
22 h-m-p 0.0015 0.0074 48.6907 CYC 2644.212543 2 0.0013 644 | 0/21
23 h-m-p 0.0057 0.0589 11.0818 CC 2644.164572 1 0.0012 670 | 0/21
24 h-m-p 0.0048 0.0866 2.8572 CC 2644.154709 1 0.0016 696 | 0/21
25 h-m-p 0.0038 0.1616 1.1666 YC 2644.115159 1 0.0079 721 | 0/21
26 h-m-p 0.0026 0.0642 3.5099 +CCCC 2643.510212 3 0.0160 752 | 0/21
27 h-m-p 0.0014 0.0068 37.0693 CCCC 2642.869925 3 0.0016 782 | 0/21
28 h-m-p 0.0044 0.0219 6.3367 CC 2642.850790 1 0.0010 808 | 0/21
29 h-m-p 0.0043 0.1617 1.4639 C 2642.849355 0 0.0011 832 | 0/21
30 h-m-p 0.0190 3.0315 0.0821 ++YCC 2642.745499 2 0.2315 861 | 0/21
31 h-m-p 0.0015 0.0458 12.4521 +YC 2642.392319 1 0.0042 908 | 0/21
32 h-m-p 1.6000 8.0000 0.0094 YCCC 2641.649040 3 3.7914 937 | 0/21
33 h-m-p 1.5700 7.9334 0.0226 CCCCC 2640.884678 4 2.0898 990 | 0/21
34 h-m-p 1.5911 7.9556 0.0264 YYC 2640.676147 2 1.2176 1037 | 0/21
35 h-m-p 1.6000 8.0000 0.0154 CYC 2640.596614 2 1.5097 1085 | 0/21
36 h-m-p 1.6000 8.0000 0.0127 YC 2640.582823 1 1.2583 1131 | 0/21
37 h-m-p 1.6000 8.0000 0.0013 YC 2640.581814 1 0.8872 1177 | 0/21
38 h-m-p 1.6000 8.0000 0.0007 YC 2640.580500 1 3.9744 1223 | 0/21
39 h-m-p 1.6000 8.0000 0.0003 ++ 2640.567100 m 8.0000 1268 | 0/21
40 h-m-p 0.8750 8.0000 0.0032 YC 2640.515464 1 2.0473 1314 | 0/21
41 h-m-p 1.6000 8.0000 0.0035 CCC 2640.465925 2 2.1535 1363 | 0/21
42 h-m-p 1.6000 8.0000 0.0037 YC 2640.459202 1 0.8393 1409 | 0/21
43 h-m-p 1.6000 8.0000 0.0002 YC 2640.459094 1 1.0446 1455 | 0/21
44 h-m-p 1.6000 8.0000 0.0001 Y 2640.459092 0 0.9669 1500 | 0/21
45 h-m-p 1.6000 8.0000 0.0000 Y 2640.459092 0 0.8497 1545 | 0/21
46 h-m-p 1.6000 8.0000 0.0000 ---Y 2640.459092 0 0.0120 1593
Out..
lnL = -2640.459092
1594 lfun, 1594 eigenQcodon, 30286 P(t)
Time used: 0:14
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 1.902702 0.822315 0.590611
ntime & nrate & np: 19 2 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.097438
np = 22
lnL0 = -2887.874481
Iterating by ming2
Initial: fx= 2887.874481
x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 1.90270 0.82232 0.59061
1 h-m-p 0.0000 0.0011 556.5500 ++++ 2864.433154 m 0.0011 29 | 0/22
2 h-m-p 0.0000 0.0000 54217.9490 ++ 2804.576416 m 0.0000 54 | 0/22
3 h-m-p 0.0000 0.0001 1447.5864 YCYCCC 2795.028277 5 0.0000 87 | 0/22
4 h-m-p 0.0001 0.0008 249.1477 YCCCC 2789.986506 4 0.0003 119 | 0/22
5 h-m-p 0.0005 0.0052 145.1931 CCCC 2786.744140 3 0.0005 150 | 0/22
6 h-m-p 0.0000 0.0002 145.2913 +YCCC 2786.053268 3 0.0001 181 | 0/22
7 h-m-p 0.0001 0.0003 95.1954 ++ 2785.170820 m 0.0003 206 | 0/22
8 h-m-p 0.0002 0.0032 120.9403 +CCCCC 2782.595475 4 0.0010 240 | 0/22
9 h-m-p 0.0003 0.0016 93.5541 +YCCC 2780.715041 3 0.0011 271 | 0/22
10 h-m-p 0.0004 0.0020 56.4653 CCC 2780.358600 2 0.0005 300 | 0/22
11 h-m-p 0.0016 0.0096 17.7299 YCC 2780.234986 2 0.0009 328 | 0/22
12 h-m-p 0.0023 0.0167 7.0930 CCC 2780.133360 2 0.0025 357 | 0/22
13 h-m-p 0.0009 0.0698 19.6989 ++YCC 2778.924400 2 0.0103 387 | 0/22
14 h-m-p 0.0017 0.0200 116.3924 +YCC 2775.448723 2 0.0050 416 | 0/22
15 h-m-p 0.0008 0.0038 239.9142 YCCC 2773.015570 3 0.0016 446 | 0/22
16 h-m-p 0.0022 0.0109 40.9618 YCC 2772.687253 2 0.0012 474 | 0/22
17 h-m-p 0.0026 0.0131 11.5145 CCC 2772.365807 2 0.0027 503 | 0/22
18 h-m-p 0.0032 0.0492 9.8499 +YYCC 2769.476222 3 0.0117 533 | 0/22
19 h-m-p 0.0020 0.0108 57.6641 YCCCC 2759.071838 4 0.0047 565 | 0/22
20 h-m-p 0.0007 0.0034 193.9067 ++ 2705.316410 m 0.0034 590 | 0/22
21 h-m-p 0.0010 0.0052 7.5702 YYYYC 2702.185490 4 0.0011 619 | 0/22
22 h-m-p 0.0000 0.0005 194.4260 +YYYYC 2699.375516 4 0.0002 649 | 0/22
23 h-m-p 0.0003 0.0025 105.4380 YCCC 2696.230760 3 0.0007 679 | 0/22
24 h-m-p 0.0041 0.0207 8.5508 YCCC 2695.897207 3 0.0028 709 | 0/22
25 h-m-p 0.0057 0.2077 4.2237 +++ 2665.063621 m 0.2077 735 | 0/22
26 h-m-p 0.4057 2.0286 1.4092 CYCCCC 2642.608230 5 0.8014 769 | 0/22
27 h-m-p 0.1798 0.8990 0.4142 +YYCCC 2635.459816 4 0.6265 801 | 0/22
28 h-m-p 0.5747 2.8734 0.0943 YCCC 2631.267689 3 1.2060 853 | 0/22
29 h-m-p 0.4388 2.4153 0.2593 CCCC 2629.900299 3 0.7129 906 | 0/22
30 h-m-p 0.5313 2.6566 0.0820 CCC 2628.839604 2 0.7408 957 | 0/22
31 h-m-p 1.6000 8.0000 0.0270 CYC 2627.828061 2 1.6719 1007 | 0/22
32 h-m-p 1.3604 8.0000 0.0332 CCC 2627.366872 2 1.2073 1058 | 0/22
33 h-m-p 1.6000 8.0000 0.0182 CCC 2627.021215 2 1.3659 1109 | 0/22
34 h-m-p 0.7054 8.0000 0.0352 YCC 2626.845287 2 1.3076 1159 | 0/22
35 h-m-p 1.6000 8.0000 0.0242 YC 2626.609015 1 2.9230 1207 | 0/22
36 h-m-p 1.6000 8.0000 0.0164 CYC 2626.324533 2 1.3799 1257 | 0/22
37 h-m-p 0.6688 8.0000 0.0339 YCC 2626.060804 2 1.2090 1307 | 0/22
38 h-m-p 1.6000 8.0000 0.0066 CC 2625.996498 1 1.5131 1356 | 0/22
39 h-m-p 1.6000 8.0000 0.0031 CC 2625.971359 1 2.3848 1405 | 0/22
40 h-m-p 1.6000 8.0000 0.0039 C 2625.959688 0 1.6000 1452 | 0/22
41 h-m-p 1.6000 8.0000 0.0021 YC 2625.942169 1 3.3691 1500 | 0/22
42 h-m-p 1.4440 8.0000 0.0048 +CC 2625.892085 1 6.0637 1550 | 0/22
43 h-m-p 1.6000 8.0000 0.0106 +YC 2625.728815 1 4.8451 1599 | 0/22
44 h-m-p 1.6000 8.0000 0.0138 CCC 2625.552439 2 2.3667 1650 | 0/22
45 h-m-p 1.6000 8.0000 0.0072 CCC 2625.457628 2 1.8602 1701 | 0/22
46 h-m-p 1.6000 8.0000 0.0050 CC 2625.439538 1 1.3575 1750 | 0/22
47 h-m-p 1.6000 8.0000 0.0012 C 2625.436010 0 1.6000 1797 | 0/22
48 h-m-p 1.6000 8.0000 0.0006 YC 2625.435724 1 1.0996 1845 | 0/22
49 h-m-p 1.6000 8.0000 0.0002 Y 2625.435697 0 1.0893 1892 | 0/22
50 h-m-p 1.6000 8.0000 0.0001 Y 2625.435695 0 1.2661 1939 | 0/22
51 h-m-p 1.6000 8.0000 0.0000 C 2625.435695 0 1.3616 1986 | 0/22
52 h-m-p 1.6000 8.0000 0.0000 Y 2625.435695 0 0.8762 2033 | 0/22
53 h-m-p 1.6000 8.0000 0.0000 C 2625.435695 0 0.4000 2080 | 0/22
54 h-m-p 0.5975 8.0000 0.0000 Y 2625.435695 0 0.5975 2127 | 0/22
55 h-m-p 1.1768 8.0000 0.0000 Y 2625.435695 0 0.2942 2174 | 0/22
56 h-m-p 0.1359 8.0000 0.0000 ---------------.. | 0/22
57 h-m-p 0.0160 8.0000 0.0006 ------------- | 0/22
58 h-m-p 0.0160 8.0000 0.0006 -------------
Out..
lnL = -2625.435695
2351 lfun, 7053 eigenQcodon, 89338 P(t)
Time used: 0:53
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
initial w for M2:NSpselection reset.
0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 1.970157 0.862503 0.107410 0.336572 2.818396
ntime & nrate & np: 19 3 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.264708
np = 24
lnL0 = -2902.012301
Iterating by ming2
Initial: fx= 2902.012301
x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 1.97016 0.86250 0.10741 0.33657 2.81840
1 h-m-p 0.0000 0.0015 677.8268 ++++ 2813.897363 m 0.0015 55 | 0/24
2 h-m-p 0.0006 0.0029 666.1148 -YYYYC 2805.758069 4 0.0000 111 | 0/24
3 h-m-p 0.0001 0.0046 191.3570 ++YCCCC 2764.856740 4 0.0028 171 | 0/24
4 h-m-p 0.0020 0.0102 66.3848 CCCC 2761.630936 3 0.0020 228 | 0/24
5 h-m-p 0.0022 0.0124 60.1812 +YCCCC 2753.803844 4 0.0065 287 | 0/24
6 h-m-p 0.0015 0.0073 42.1649 YCCC 2751.790406 3 0.0036 343 | 0/24
7 h-m-p 0.0016 0.0080 73.4323 YCCCC 2749.179092 4 0.0033 401 | 0/24
8 h-m-p 0.0027 0.0288 88.7507 CCCC 2747.251672 3 0.0026 458 | 0/24
9 h-m-p 0.0014 0.0070 73.3102 +YYCCC 2744.031079 4 0.0046 516 | 0/24
10 h-m-p 0.0027 0.0138 125.5571 CYCC 2740.658470 3 0.0037 572 | 0/24
11 h-m-p 0.0052 0.0659 90.1975 +CYCC 2725.691903 3 0.0246 629 | 0/24
12 h-m-p 0.0121 0.0603 130.1794 CYCCC 2713.210190 4 0.0162 687 | 0/24
13 h-m-p 0.0122 0.0610 54.1429 +YYCCCC 2699.319497 5 0.0386 747 | 0/24
14 h-m-p 0.0139 0.0693 65.0761 YCC 2689.834161 2 0.0249 801 | 0/24
15 h-m-p 0.0140 0.0699 25.8545 CCCC 2687.648378 3 0.0177 858 | 0/24
16 h-m-p 0.0321 0.1606 8.3094 CC 2686.719339 1 0.0321 911 | 0/24
17 h-m-p 0.0439 0.5851 6.0646 +YCC 2683.804680 2 0.1325 966 | 0/24
18 h-m-p 0.0538 0.3352 14.9400 +YCCC 2675.135553 3 0.1418 1023 | 0/24
19 h-m-p 0.0138 0.0691 29.0974 +YYCYYCCC 2666.691198 7 0.0599 1085 | 0/24
20 h-m-p 0.0181 0.0906 10.0898 YCCC 2665.424867 3 0.0384 1141 | 0/24
21 h-m-p 0.2155 1.0777 1.7573 CYC 2664.451659 2 0.1897 1195 | 0/24
22 h-m-p 0.1067 0.7568 3.1229 CCC 2662.431134 2 0.1651 1250 | 0/24
23 h-m-p 0.1170 0.6405 4.4061 YCC 2661.653136 2 0.0741 1304 | 0/24
24 h-m-p 0.1028 0.5948 3.1762 CCC 2660.980093 2 0.1266 1359 | 0/24
25 h-m-p 0.0635 0.3173 4.3241 +YYCCC 2659.286046 4 0.2103 1417 | 0/24
26 h-m-p 0.0233 0.1165 11.0775 YCCC 2658.211567 3 0.0604 1473 | 0/24
27 h-m-p 0.1046 0.5231 2.6997 YC 2658.013132 1 0.0535 1525 | 0/24
28 h-m-p 0.1214 1.6407 1.1905 YCCC 2657.277451 3 0.2923 1581 | 0/24
29 h-m-p 1.0302 6.1926 0.3378 CCCC 2655.421568 3 1.4146 1638 | 0/24
30 h-m-p 0.9316 4.6578 0.4146 CYCCC 2653.358995 4 1.8098 1696 | 0/24
31 h-m-p 1.3250 6.7166 0.5662 CCCCC 2651.516507 4 1.9401 1755 | 0/24
32 h-m-p 0.9391 4.6955 0.3568 YCYCCC 2649.066824 5 2.2051 1814 | 0/24
33 h-m-p 0.4756 2.3782 0.4233 YCCCC 2646.470371 4 1.2325 1872 | 0/24
34 h-m-p 0.2857 1.4284 0.8053 YCCCCC 2644.373332 5 0.5990 1932 | 0/24
35 h-m-p 0.2175 1.0877 0.9579 +YCYCCC 2640.755978 5 0.6024 1992 | 0/24
36 h-m-p 0.1979 0.9897 1.9947 YCCCCC 2638.798810 5 0.2233 2052 | 0/24
37 h-m-p 0.2141 1.3051 2.0808 CCC 2636.331622 2 0.3304 2107 | 0/24
38 h-m-p 0.2000 1.0002 1.0670 CCCCC 2635.264629 4 0.2580 2166 | 0/24
39 h-m-p 0.1479 1.6004 1.8615 +YCC 2633.881716 2 0.4108 2221 | 0/24
40 h-m-p 0.2519 1.2595 2.3513 CCCCC 2632.713387 4 0.3374 2280 | 0/24
41 h-m-p 0.2632 1.3269 3.0142 CYCCCC 2631.159391 5 0.3867 2340 | 0/24
42 h-m-p 0.1902 0.9512 3.5527 CCCC 2630.361005 3 0.1956 2397 | 0/24
43 h-m-p 0.2585 1.7098 2.6872 CCYC 2629.673512 3 0.2555 2453 | 0/24
44 h-m-p 0.1863 1.4821 3.6860 CYC 2629.169670 2 0.1621 2507 | 0/24
45 h-m-p 0.2199 1.4802 2.7174 CCCC 2628.740754 3 0.2647 2564 | 0/24
46 h-m-p 0.1478 0.9021 4.8684 CCCC 2628.227251 3 0.2138 2621 | 0/24
47 h-m-p 0.2618 1.3458 3.9764 YYCC 2627.905857 3 0.1950 2676 | 0/24
48 h-m-p 0.1799 1.4345 4.3104 YYC 2627.661799 2 0.1512 2729 | 0/24
49 h-m-p 0.1296 1.7792 5.0278 CC 2627.333109 1 0.1855 2782 | 0/24
50 h-m-p 0.1911 1.4323 4.8793 YCCC 2627.064162 3 0.1934 2838 | 0/24
51 h-m-p 0.3064 2.4915 3.0808 CCC 2626.762799 2 0.3314 2893 | 0/24
52 h-m-p 0.1988 1.2943 5.1353 YCC 2626.617472 2 0.1085 2947 | 0/24
53 h-m-p 0.1509 2.3807 3.6918 CCC 2626.435924 2 0.2120 3002 | 0/24
54 h-m-p 0.3742 5.5029 2.0911 YCC 2626.322261 2 0.2555 3056 | 0/24
55 h-m-p 0.1231 0.9028 4.3394 CCC 2626.206692 2 0.1744 3111 | 0/24
56 h-m-p 0.2690 1.6667 2.8135 YYC 2626.129929 2 0.2251 3164 | 0/24
57 h-m-p 0.1857 1.2569 3.4103 CCC 2626.038665 2 0.2362 3219 | 0/24
58 h-m-p 0.3323 4.5716 2.4236 YCCC 2625.932653 3 0.5968 3275 | 0/24
59 h-m-p 0.5267 5.7861 2.7462 YCC 2625.852568 2 0.4321 3329 | 0/24
60 h-m-p 0.5254 8.0000 2.2588 CYC 2625.770448 2 0.6063 3383 | 0/24
61 h-m-p 0.3035 5.1749 4.5124 CCCC 2625.691379 3 0.4141 3440 | 0/24
62 h-m-p 0.8099 7.5848 2.3072 YC 2625.634825 1 0.4755 3492 | 0/24
63 h-m-p 0.2790 5.2377 3.9330 CCC 2625.600062 2 0.3316 3547 | 0/24
64 h-m-p 0.4844 8.0000 2.6925 CC 2625.574586 1 0.4183 3600 | 0/24
65 h-m-p 0.4647 8.0000 2.4234 CC 2625.547595 1 0.5784 3653 | 0/24
66 h-m-p 0.7386 8.0000 1.8977 CC 2625.524073 1 0.8184 3706 | 0/24
67 h-m-p 0.5284 8.0000 2.9393 CC 2625.503221 1 0.5888 3759 | 0/24
68 h-m-p 0.5175 8.0000 3.3443 CCC 2625.488231 2 0.5394 3814 | 0/24
69 h-m-p 0.4868 8.0000 3.7061 CC 2625.475000 1 0.4367 3867 | 0/24
70 h-m-p 0.6974 8.0000 2.3209 C 2625.464690 0 0.6974 3918 | 0/24
71 h-m-p 0.4591 8.0000 3.5251 CC 2625.456972 1 0.6665 3971 | 0/24
72 h-m-p 1.0272 8.0000 2.2871 C 2625.450213 0 1.0272 4022 | 0/24
73 h-m-p 0.5576 8.0000 4.2134 C 2625.446236 0 0.5576 4073 | 0/24
74 h-m-p 0.8503 8.0000 2.7631 CC 2625.443320 1 0.7130 4126 | 0/24
75 h-m-p 0.3968 8.0000 4.9658 CC 2625.440644 1 0.5503 4179 | 0/24
76 h-m-p 1.1721 8.0000 2.3315 CY 2625.438741 1 1.3570 4232 | 0/24
77 h-m-p 1.0746 8.0000 2.9442 C 2625.437680 0 0.9648 4283 | 0/24
78 h-m-p 1.0505 8.0000 2.7039 C 2625.436874 0 1.2508 4334 | 0/24
79 h-m-p 0.9317 8.0000 3.6301 YC 2625.436444 1 0.7346 4386 | 0/24
80 h-m-p 0.9972 8.0000 2.6740 C 2625.436106 0 1.4565 4437 | 0/24
81 h-m-p 1.3972 8.0000 2.7876 C 2625.435912 0 1.5288 4488 | 0/24
82 h-m-p 1.6000 8.0000 2.4392 C 2625.435808 0 1.6000 4539 | 0/24
83 h-m-p 1.3489 8.0000 2.8933 C 2625.435755 0 1.3489 4590 | 0/24
84 h-m-p 1.3953 8.0000 2.7972 C 2625.435724 0 1.8349 4641 | 0/24
85 h-m-p 1.6000 8.0000 2.5339 C 2625.435708 0 1.8580 4692 | 0/24
86 h-m-p 1.6000 8.0000 2.5063 C 2625.435701 0 2.0776 4743 | 0/24
87 h-m-p 1.6000 8.0000 2.2320 C 2625.435698 0 1.7825 4794 | 0/24
88 h-m-p 1.6000 8.0000 2.3841 C 2625.435696 0 2.0826 4845 | 0/24
89 h-m-p 1.6000 8.0000 2.5205 C 2625.435695 0 1.7970 4896 | 0/24
90 h-m-p 1.6000 8.0000 2.4436 C 2625.435695 0 1.9394 4947 | 0/24
91 h-m-p 0.7542 8.0000 6.2836 Y 2625.435695 0 1.6113 4998 | 0/24
92 h-m-p 1.6000 8.0000 1.1563 Y 2625.435695 0 1.2735 5049 | 0/24
93 h-m-p 0.9951 8.0000 1.4797 Y 2625.435695 0 1.7740 5100 | 0/24
94 h-m-p 1.6000 8.0000 0.0995 Y 2625.435695 0 1.1884 5151 | 0/24
95 h-m-p 1.6000 8.0000 0.0176 C 2625.435695 0 1.6000 5202 | 0/24
96 h-m-p 0.3523 8.0000 0.0797 --C 2625.435695 0 0.0055 5255 | 0/24
97 h-m-p 1.6000 8.0000 0.0002 ----------------.. | 0/24
98 h-m-p 0.0103 5.1647 0.0011 --Y 2625.435695 0 0.0002 5373 | 0/24
99 h-m-p 0.0160 8.0000 0.0009 ------------Y 2625.435695 0 0.0000 5436 | 0/24
100 h-m-p 0.0000 0.0000 1255.7341 -------.. | 0/24
101 h-m-p 0.0160 8.0000 0.0061 -----C 2625.435695 0 0.0000 5548 | 0/24
102 h-m-p 0.0160 8.0000 0.0002 ---------C 2625.435695 0 0.0000 5608
Out..
lnL = -2625.435695
5609 lfun, 22436 eigenQcodon, 319713 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2642.963476 S = -2561.867776 -72.148597
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 201 patterns 3:15
did 20 / 201 patterns 3:15
did 30 / 201 patterns 3:15
did 40 / 201 patterns 3:15
did 50 / 201 patterns 3:15
did 60 / 201 patterns 3:15
did 70 / 201 patterns 3:15
did 80 / 201 patterns 3:15
did 90 / 201 patterns 3:15
did 100 / 201 patterns 3:15
did 110 / 201 patterns 3:15
did 120 / 201 patterns 3:15
did 130 / 201 patterns 3:15
did 140 / 201 patterns 3:15
did 150 / 201 patterns 3:15
did 160 / 201 patterns 3:15
did 170 / 201 patterns 3:15
did 180 / 201 patterns 3:15
did 190 / 201 patterns 3:16
did 200 / 201 patterns 3:16
did 201 / 201 patterns 3:16
Time used: 3:16
Model 3: discrete
TREE # 1
(1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 1.970157 0.335590 0.845675 0.023866 0.061129 0.086153
ntime & nrate & np: 19 4 25
Bounds (np=25):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 16.066008
np = 25
lnL0 = -2641.188783
Iterating by ming2
Initial: fx= 2641.188783
x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 1.97016 0.33559 0.84567 0.02387 0.06113 0.08615
1 h-m-p 0.0000 0.0001 517.9526 YCYCC 2640.100538 4 0.0000 61 | 0/25
2 h-m-p 0.0000 0.0001 305.9409 ++ 2633.670805 m 0.0001 114 | 1/25
3 h-m-p 0.0000 0.0003 406.7371 ++ 2621.091854 m 0.0003 167 | 2/25
4 h-m-p 0.0008 0.0041 81.6679 CCC 2620.574921 2 0.0002 223 | 1/25
5 h-m-p 0.0000 0.0004 704.5305 YCC 2620.501888 2 0.0000 277 | 1/25
6 h-m-p 0.0001 0.0018 45.4317 +YCCC 2620.028573 3 0.0004 335 | 0/25
7 h-m-p 0.0003 0.0018 68.0523 YCCC 2619.674523 3 0.0002 392 | 0/25
8 h-m-p 0.0003 0.0013 36.0371 YC 2619.273142 1 0.0006 446 | 0/25
9 h-m-p 0.0005 0.0034 41.9467 CC 2618.828987 1 0.0006 501 | 0/25
10 h-m-p 0.0006 0.0033 39.5562 YCC 2618.523096 2 0.0005 557 | 0/25
11 h-m-p 0.0008 0.0039 23.2028 CCC 2618.465252 2 0.0002 614 | 0/25
12 h-m-p 0.0003 0.0109 17.0596 YC 2618.393292 1 0.0007 668 | 0/25
13 h-m-p 0.0005 0.0072 20.3297 CC 2618.342933 1 0.0005 723 | 0/25
14 h-m-p 0.0016 0.0254 6.5316 YC 2618.324401 1 0.0010 777 | 0/25
15 h-m-p 0.0017 0.0259 4.0804 CC 2618.305633 1 0.0024 832 | 0/25
16 h-m-p 0.0010 0.1043 9.3297 +CC 2618.225638 1 0.0048 888 | 0/25
17 h-m-p 0.0010 0.0220 42.8881 +YCC 2618.000436 2 0.0029 945 | 0/25
18 h-m-p 0.0018 0.0143 66.5735 CC 2617.776985 1 0.0019 1000 | 0/25
19 h-m-p 0.0077 0.0384 9.8898 YC 2617.759018 1 0.0011 1054 | 0/25
20 h-m-p 0.0040 0.1769 2.6094 CC 2617.735077 1 0.0054 1109 | 0/25
21 h-m-p 0.0009 0.0284 14.9248 +YCCC 2617.494888 3 0.0090 1168 | 0/25
22 h-m-p 0.0057 0.0286 10.5810 YC 2617.475676 1 0.0011 1222 | 0/25
23 h-m-p 0.0192 0.3146 0.6174 +YCC 2617.430270 2 0.0560 1279 | 0/25
24 h-m-p 0.0024 0.0122 13.7836 YCC 2617.403686 2 0.0016 1335 | 0/25
25 h-m-p 0.0115 0.1487 1.8684 YC 2617.401788 1 0.0015 1389 | 0/25
26 h-m-p 0.0198 2.2663 0.1405 CC 2617.399843 1 0.0258 1444 | 0/25
27 h-m-p 0.0010 0.1695 3.4981 ++YC 2617.340577 1 0.0283 1500 | 0/25
28 h-m-p 1.6000 8.0000 0.0571 CCC 2617.312026 2 2.1568 1557 | 0/25
29 h-m-p 1.6000 8.0000 0.0685 CC 2617.296938 1 1.7230 1612 | 0/25
30 h-m-p 1.5836 8.0000 0.0745 C 2617.293082 0 0.3622 1665 | 0/25
31 h-m-p 0.8003 8.0000 0.0337 YC 2617.289195 1 1.6382 1719 | 0/25
32 h-m-p 1.6000 8.0000 0.0133 YC 2617.286661 1 3.1908 1773 | 0/25
33 h-m-p 1.6000 8.0000 0.0223 +YCYC 2617.277100 3 4.7623 1831 | 0/25
34 h-m-p 0.1239 0.6195 0.0762 ++ 2617.266505 m 0.6195 1884 | 1/25
35 h-m-p 0.0291 5.1690 1.6210 +YCCC 2617.251375 3 0.0826 1943 | 0/25
36 h-m-p 0.0000 0.0002 33248.7973 --C 2617.251345 0 0.0000 1997 | 0/25
37 h-m-p 0.0923 0.6960 0.0606 ----------Y 2617.251345 0 0.0000 2060 | 0/25
38 h-m-p 0.0034 1.7157 2.1835 +YC 2617.248722 1 0.0088 2115 | 0/25
39 h-m-p 0.3561 8.0000 0.0541 ++YYC 2617.187123 2 5.1908 2172 | 0/25
40 h-m-p 1.4277 8.0000 0.1966 YYC 2617.128052 2 1.2865 2227 | 0/25
41 h-m-p 0.6576 8.0000 0.3846 YCC 2617.097427 2 0.6678 2283 | 0/25
42 h-m-p 1.6000 8.0000 0.0515 YC 2617.087819 1 1.1214 2337 | 0/25
43 h-m-p 1.6000 8.0000 0.0203 CC 2617.085269 1 2.1873 2392 | 0/25
44 h-m-p 0.3866 1.9329 0.0749 YC 2617.083965 1 0.9065 2446 | 0/25
45 h-m-p 0.0713 0.3563 0.1786 YC 2617.083810 1 0.1743 2500 | 0/25
46 h-m-p 0.0066 0.0332 0.8518 Y 2617.083791 0 0.0137 2553 | 0/25
47 h-m-p 0.0002 0.0011 14.9754 C 2617.083790 0 0.0002 2606 | 0/25
48 h-m-p 0.0018 0.0091 1.6904 ------------.. | 0/25
49 h-m-p 0.0000 0.0000 459.7470 ++ 2617.083771 m 0.0000 2722 | 1/25
50 h-m-p 0.0000 0.0047 74.9107 YC 2617.083072 1 0.0000 2776 | 1/25
51 h-m-p 0.0000 0.0048 19.2621 +CC 2617.079198 1 0.0002 2831 | 1/25
52 h-m-p 0.0002 0.0278 15.8431 +CC 2617.063033 1 0.0009 2886 | 1/25
53 h-m-p 0.0004 0.0083 34.1380 CC 2617.043080 1 0.0005 2940 | 1/25
54 h-m-p 0.0007 0.0243 24.7164 YC 2617.033537 1 0.0004 2993 | 1/25
55 h-m-p 0.0007 0.0192 13.0621 CC 2617.025959 1 0.0006 3047 | 1/25
56 h-m-p 0.0010 0.0931 7.7114 YC 2617.021579 1 0.0007 3100 | 1/25
57 h-m-p 0.0003 0.0197 15.0630 CC 2617.016838 1 0.0004 3154 | 1/25
58 h-m-p 0.0008 0.0463 7.2504 YC 2617.008425 1 0.0016 3207 | 1/25
59 h-m-p 0.0008 0.0757 14.1168 C 2617.000901 0 0.0008 3259 | 1/25
60 h-m-p 0.0006 0.0418 17.4466 CC 2616.992030 1 0.0008 3313 | 1/25
61 h-m-p 0.0026 0.0361 5.1686 CC 2616.989578 1 0.0008 3367 | 1/25
62 h-m-p 0.0037 0.3232 1.1161 C 2616.989210 0 0.0009 3419 | 1/25
63 h-m-p 0.0028 1.0928 0.3662 YC 2616.989121 1 0.0016 3472 | 1/25
64 h-m-p 0.0015 0.3697 0.3991 C 2616.989042 0 0.0019 3524 | 1/25
65 h-m-p 0.0020 0.9989 0.6682 +YC 2616.988680 1 0.0061 3578 | 1/25
66 h-m-p 0.0023 1.1568 3.0066 +YC 2616.983704 1 0.0193 3632 | 1/25
67 h-m-p 0.0012 0.2517 48.0767 +CC 2616.961127 1 0.0055 3687 | 1/25
68 h-m-p 0.0018 0.1104 144.7836 CCC 2616.933708 2 0.0022 3743 | 1/25
69 h-m-p 0.0067 0.1136 46.2974 CC 2616.925421 1 0.0021 3797 | 1/25
70 h-m-p 0.0019 0.8912 50.0841 +CCCC 2616.885824 3 0.0080 3856 | 1/25
71 h-m-p 0.0112 0.1008 35.6341 -CC 2616.882832 1 0.0010 3911 | 1/25
72 h-m-p 0.2196 2.5418 0.1562 -YC 2616.882567 1 0.0082 3965 | 1/25
73 h-m-p 0.0033 1.6566 1.4550 ++YC 2616.854107 1 0.1200 4020 | 1/25
74 h-m-p 1.6000 8.0000 0.0655 YC 2616.851566 1 1.2105 4073 | 1/25
75 h-m-p 1.6000 8.0000 0.0093 CC 2616.850989 1 1.3179 4127 | 1/25
76 h-m-p 1.6000 8.0000 0.0044 Y 2616.850975 0 0.8280 4179 | 1/25
77 h-m-p 1.6000 8.0000 0.0001 ----------------.. | 1/25
78 h-m-p 0.0001 0.0450 4.6542 +YC 2616.847818 1 0.0003 4299 | 1/25
79 h-m-p 0.0000 0.0010 37.8415 CC 2616.842929 1 0.0001 4353 | 1/25
80 h-m-p 0.0003 0.0142 8.1607 C 2616.839247 0 0.0003 4405 | 1/25
81 h-m-p 0.0006 0.0410 3.4280 YC 2616.837493 1 0.0005 4458 | 1/25
82 h-m-p 0.0004 0.0525 3.8381 C 2616.836096 0 0.0005 4510 | 1/25
83 h-m-p 0.0004 0.0614 4.5864 +C 2616.831429 0 0.0015 4563 | 1/25
84 h-m-p 0.0004 0.0400 15.9275 YC 2616.822292 1 0.0009 4616 | 1/25
85 h-m-p 0.0005 0.0196 27.8551 CC 2616.811474 1 0.0006 4670 | 1/25
86 h-m-p 0.0004 0.0168 48.7697 C 2616.800619 0 0.0004 4722 | 1/25
87 h-m-p 0.0025 0.0444 7.0730 CC 2616.798625 1 0.0005 4776 | 1/25
88 h-m-p 0.0012 0.0599 2.8047 YC 2616.797906 1 0.0006 4829 | 1/25
89 h-m-p 0.0021 0.5088 0.7432 YC 2616.797712 1 0.0010 4882 | 1/25
90 h-m-p 0.0022 1.0886 0.6040 C 2616.797443 0 0.0026 4934 | 1/25
91 h-m-p 0.0018 0.9101 1.3813 +CC 2616.795408 1 0.0098 4989 | 1/25
92 h-m-p 0.0028 0.2625 4.8738 CC 2616.793822 1 0.0022 5043 | 1/25
93 h-m-p 0.0105 0.2689 1.0294 YC 2616.793610 1 0.0016 5096 | 1/25
94 h-m-p 0.0023 0.7013 0.7312 C 2616.793404 0 0.0026 5148 | 1/25
95 h-m-p 0.0017 0.3718 1.1563 +YC 2616.792897 1 0.0045 5202 | 1/25
96 h-m-p 0.0011 0.5375 5.4213 +YC 2616.787641 1 0.0101 5256 | 1/25
97 h-m-p 0.0009 0.1822 60.5224 +CCC 2616.762087 2 0.0044 5313 | 1/25
98 h-m-p 0.0013 0.1266 208.6232 +YC 2616.687683 1 0.0032 5367 | 1/25
99 h-m-p 0.0222 0.1108 28.3268 -C 2616.683921 0 0.0014 5420 | 1/25
100 h-m-p 0.0107 5.3347 11.7751 +YCC 2616.645440 2 0.0326 5476 | 1/25
101 h-m-p 0.0438 0.2455 8.7729 --YC 2616.644466 1 0.0011 5531 | 1/25
102 h-m-p 0.0323 8.0000 0.2977 +++YCC 2616.499618 2 1.6633 5589 | 1/25
103 h-m-p 1.1465 8.0000 0.4319 CC 2616.440922 1 1.5803 5643 | 1/25
104 h-m-p 1.6000 8.0000 0.1174 YC 2616.422665 1 0.8532 5696 | 1/25
105 h-m-p 1.4014 8.0000 0.0715 YC 2616.396678 1 3.1267 5749 | 0/25
106 h-m-p 0.0002 0.0346 1388.5918 YC 2616.394868 1 0.0000 5802 | 0/25
107 h-m-p 0.2304 1.1518 0.1211 ++ 2616.382842 m 1.1518 5855 | 1/25
108 h-m-p 1.6000 8.0000 0.0385 CC 2616.380423 1 0.4940 5910 | 1/25
109 h-m-p 0.2896 8.0000 0.0657 +YC 2616.379087 1 0.9354 5964 | 1/25
110 h-m-p 1.6000 8.0000 0.0062 Y 2616.379039 0 1.0840 6016 | 1/25
111 h-m-p 1.6000 8.0000 0.0004 Y 2616.379039 0 1.0032 6068 | 1/25
112 h-m-p 1.6000 8.0000 0.0001 Y 2616.379039 0 1.2010 6120 | 1/25
113 h-m-p 1.6000 8.0000 0.0000 --Y 2616.379039 0 0.0250 6174 | 1/25
114 h-m-p 0.0160 8.0000 0.0003 -------------.. | 1/25
115 h-m-p 0.0160 8.0000 0.0002 ------------C 2616.379039 0 0.0000 6301
Out..
lnL = -2616.379039
6302 lfun, 25208 eigenQcodon, 359214 P(t)
Time used: 5:53
Model 7: beta
TREE # 1
(1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 1.881034 0.637551 1.244267
ntime & nrate & np: 19 1 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.250535
np = 22
lnL0 = -2729.389111
Iterating by ming2
Initial: fx= 2729.389111
x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 1.88103 0.63755 1.24427
1 h-m-p 0.0000 0.0037 562.8337 +YYCCC 2726.543894 4 0.0001 56 | 0/22
2 h-m-p 0.0001 0.0012 329.6735 ++ 2682.294300 m 0.0012 103 | 0/22
3 h-m-p 0.0002 0.0008 466.6226 +YCYCCC 2653.101905 5 0.0005 159 | 0/22
4 h-m-p 0.0001 0.0007 102.6965 +YYYCC 2650.232003 4 0.0005 212 | 0/22
5 h-m-p 0.0004 0.0020 65.3014 YCCC 2649.362376 3 0.0006 264 | 0/22
6 h-m-p 0.0004 0.0029 91.7463 +YCCC 2647.101976 3 0.0013 317 | 0/22
7 h-m-p 0.0005 0.0024 106.4777 +YCCC 2644.597219 3 0.0014 370 | 0/22
8 h-m-p 0.0005 0.0027 254.2976 CCCC 2641.703269 3 0.0008 423 | 0/22
9 h-m-p 0.0002 0.0009 316.0759 +YCCC 2639.466331 3 0.0005 476 | 0/22
10 h-m-p 0.0005 0.0025 141.6633 YCCC 2637.308956 3 0.0011 528 | 0/22
11 h-m-p 0.0003 0.0017 77.8526 CCC 2636.854213 2 0.0005 579 | 0/22
12 h-m-p 0.0010 0.0051 28.7632 YCC 2636.675890 2 0.0007 629 | 0/22
13 h-m-p 0.0016 0.0253 13.1973 YC 2636.598211 1 0.0010 677 | 0/22
14 h-m-p 0.0038 0.0428 3.4149 CCC 2636.415420 2 0.0057 728 | 0/22
15 h-m-p 0.0015 0.0171 12.6186 +YC 2635.550050 1 0.0042 777 | 0/22
16 h-m-p 0.0011 0.0059 47.1607 YCCCC 2632.672623 4 0.0028 831 | 0/22
17 h-m-p 0.0006 0.0029 109.4606 YCCC 2630.363735 3 0.0010 883 | 0/22
18 h-m-p 0.0018 0.0088 48.9107 YCCC 2629.460151 3 0.0011 935 | 0/22
19 h-m-p 0.0040 0.0198 12.9132 CCC 2629.324760 2 0.0012 986 | 0/22
20 h-m-p 0.0034 0.1637 4.4684 ++YCC 2626.680618 2 0.0415 1038 | 0/22
21 h-m-p 0.0007 0.0033 162.4978 YCCCC 2622.760104 4 0.0015 1092 | 0/22
22 h-m-p 0.0006 0.0028 103.8494 YCCCC 2620.965912 4 0.0011 1146 | 0/22
23 h-m-p 0.0132 0.0661 6.5326 YC 2620.896961 1 0.0022 1194 | 0/22
24 h-m-p 0.0026 0.1302 5.7156 ++CCCC 2619.941037 3 0.0460 1249 | 0/22
25 h-m-p 0.4503 2.2517 0.5760 CCC 2618.046615 2 0.4022 1300 | 0/22
26 h-m-p 0.9128 4.5638 0.1182 YCC 2617.679183 2 0.7178 1350 | 0/22
27 h-m-p 1.6000 8.0000 0.0354 YCC 2617.597930 2 1.3338 1400 | 0/22
28 h-m-p 0.7185 8.0000 0.0658 +YC 2617.471596 1 2.2689 1449 | 0/22
29 h-m-p 1.0828 8.0000 0.1378 YCC 2617.276833 2 1.9977 1499 | 0/22
30 h-m-p 1.6000 8.0000 0.1323 YCC 2617.194286 2 0.9347 1549 | 0/22
31 h-m-p 1.6000 8.0000 0.0262 YC 2617.181520 1 0.7391 1597 | 0/22
32 h-m-p 1.6000 8.0000 0.0044 YC 2617.180101 1 0.6848 1645 | 0/22
33 h-m-p 1.5811 8.0000 0.0019 YC 2617.179852 1 0.8726 1693 | 0/22
34 h-m-p 1.6000 8.0000 0.0006 C 2617.179817 0 1.3340 1740 | 0/22
35 h-m-p 1.6000 8.0000 0.0003 +Y 2617.179713 0 4.4324 1788 | 0/22
36 h-m-p 0.5638 8.0000 0.0027 +C 2617.179541 0 2.1016 1836 | 0/22
37 h-m-p 1.6000 8.0000 0.0010 Y 2617.179515 0 0.9656 1883 | 0/22
38 h-m-p 1.6000 8.0000 0.0002 Y 2617.179514 0 0.8704 1930 | 0/22
39 h-m-p 1.6000 8.0000 0.0000 Y 2617.179514 0 0.7657 1977 | 0/22
40 h-m-p 1.6000 8.0000 0.0000 Y 2617.179514 0 0.9022 2024 | 0/22
41 h-m-p 1.6000 8.0000 0.0000 Y 2617.179514 0 0.7882 2071 | 0/22
42 h-m-p 0.2273 8.0000 0.0000 ---------------.. | 0/22
43 h-m-p 0.0160 8.0000 0.0000 Y 2617.179514 0 0.0126 2178 | 0/22
44 h-m-p 0.0160 8.0000 0.0002 -------------.. | 0/22
45 h-m-p 0.0160 8.0000 0.0094 -------------
Out..
lnL = -2617.179514
2295 lfun, 25245 eigenQcodon, 436050 P(t)
Time used: 9:05
Model 8: beta&w>1
TREE # 1
(1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
initial w for M8:NSbetaw>1 reset.
0.031746 0.039010 0.001442 0.032148 0.022539 0.036423 0.149935 0.067160 0.191709 0.019841 0.060733 0.116928 0.146551 0.134998 0.039617 0.308786 0.151006 0.123587 0.109494 1.892537 0.900000 0.681712 1.353905 2.843187
ntime & nrate & np: 19 2 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.656957
np = 24
lnL0 = -2776.043793
Iterating by ming2
Initial: fx= 2776.043793
x= 0.03175 0.03901 0.00144 0.03215 0.02254 0.03642 0.14993 0.06716 0.19171 0.01984 0.06073 0.11693 0.14655 0.13500 0.03962 0.30879 0.15101 0.12359 0.10949 1.89254 0.90000 0.68171 1.35390 2.84319
1 h-m-p 0.0000 0.0002 826.2393 +++ 2730.839566 m 0.0002 54 | 1/24
2 h-m-p 0.0005 0.0030 229.6758 +CYCCCC 2666.650579 5 0.0023 115 | 0/24
3 h-m-p 0.0000 0.0001 2114.7639 +CYYYYCCCC 2651.793891 8 0.0001 178 | 0/24
4 h-m-p 0.0001 0.0003 344.2322 CCCC 2650.037846 3 0.0001 235 | 0/24
5 h-m-p 0.0003 0.0014 84.2899 YCCC 2649.525450 3 0.0002 291 | 0/24
6 h-m-p 0.0002 0.0025 76.3449 +YYC 2648.524303 2 0.0006 345 | 0/24
7 h-m-p 0.0003 0.0013 150.9427 CCCC 2647.333871 3 0.0004 402 | 0/24
8 h-m-p 0.0001 0.0005 621.4755 +YC 2644.623043 1 0.0003 455 | 0/24
9 h-m-p 0.0016 0.0081 92.0638 CYCCC 2643.175594 4 0.0012 513 | 0/24
10 h-m-p 0.0018 0.0261 59.5996 YCCC 2640.798750 3 0.0038 569 | 0/24
11 h-m-p 0.0045 0.0253 50.0070 CYC 2638.764931 2 0.0043 623 | 0/24
12 h-m-p 0.0022 0.0108 38.2676 CCCC 2637.702014 3 0.0036 680 | 0/24
13 h-m-p 0.0021 0.0107 37.2462 CCC 2637.301883 2 0.0018 735 | 0/24
14 h-m-p 0.0045 0.0454 14.5978 YCC 2637.065133 2 0.0038 789 | 0/24
15 h-m-p 0.0094 0.1299 5.8542 YC 2636.999007 1 0.0042 841 | 0/24
16 h-m-p 0.0066 0.3235 3.7615 YC 2636.875111 1 0.0137 893 | 0/24
17 h-m-p 0.0042 0.1404 12.3155 +YCC 2636.412715 2 0.0144 948 | 0/24
18 h-m-p 0.0087 0.0693 20.4249 YC 2636.110520 1 0.0056 1000 | 0/24
19 h-m-p 0.0251 0.1868 4.5201 CCC 2635.992459 2 0.0078 1055 | 0/24
20 h-m-p 0.0049 0.1403 7.2290 +CC 2635.403686 1 0.0184 1109 | 0/24
21 h-m-p 0.0040 0.0426 33.4594 +YCC 2633.310897 2 0.0129 1164 | 0/24
22 h-m-p 0.0035 0.0173 20.5020 CYC 2632.969270 2 0.0031 1218 | 0/24
23 h-m-p 0.0132 0.0661 3.7254 YCCC 2632.067201 3 0.0249 1274 | 0/24
24 h-m-p 0.0043 0.0311 21.7438 +CYCCC 2625.486955 4 0.0225 1334 | 0/24
25 h-m-p 0.0014 0.0068 25.0576 CCCC 2625.189986 3 0.0016 1391 | 0/24
26 h-m-p 0.0264 0.1538 1.4734 +CYCC 2623.651902 3 0.1123 1448 | 0/24
27 h-m-p 0.0595 0.2976 0.6583 ++ 2621.962096 m 0.2976 1499 | 0/24
28 h-m-p 0.2290 1.4297 0.8556 YCCCC 2620.995742 4 0.1213 1557 | 0/24
29 h-m-p 0.3799 2.2714 0.2732 YCCC 2619.195723 3 0.9705 1613 | 0/24
30 h-m-p 0.1762 0.8812 0.4341 +YCYCC 2617.923627 4 0.5263 1671 | 0/24
31 h-m-p 0.2452 1.2259 0.2111 CCCC 2617.561925 3 0.4100 1728 | 0/24
32 h-m-p 0.4235 2.9540 0.2043 CCC 2617.361790 2 0.3476 1783 | 0/24
33 h-m-p 0.8158 4.7500 0.0870 YC 2617.298213 1 0.5903 1835 | 0/24
34 h-m-p 0.4611 7.7656 0.1114 +YCC 2617.227906 2 1.4074 1890 | 0/24
35 h-m-p 0.3867 3.7171 0.4055 YC 2617.100009 1 0.8337 1942 | 0/24
36 h-m-p 0.6281 3.1405 0.3745 CC 2617.017156 1 0.7131 1995 | 0/24
37 h-m-p 0.5161 2.5805 0.3520 YC 2616.906341 1 1.1096 2047 | 0/24
38 h-m-p 0.5628 2.8141 0.1878 CC 2616.849299 1 0.7255 2100 | 0/24
39 h-m-p 1.6000 8.0000 0.0176 YC 2616.830622 1 0.7254 2152 | 0/24
40 h-m-p 0.8929 8.0000 0.0143 YC 2616.828698 1 0.5911 2204 | 0/24
41 h-m-p 0.6062 8.0000 0.0139 YC 2616.827470 1 0.9879 2256 | 0/24
42 h-m-p 1.6000 8.0000 0.0066 YC 2616.827140 1 0.8118 2308 | 0/24
43 h-m-p 1.1182 8.0000 0.0048 Y 2616.826962 0 0.8141 2359 | 0/24
44 h-m-p 0.7327 8.0000 0.0053 YC 2616.826840 1 1.6275 2411 | 0/24
45 h-m-p 1.3841 8.0000 0.0063 C 2616.826624 0 1.8512 2462 | 0/24
46 h-m-p 0.7235 8.0000 0.0161 CC 2616.826306 1 1.1428 2515 | 0/24
47 h-m-p 1.6000 8.0000 0.0085 Y 2616.826193 0 1.1627 2566 | 0/24
48 h-m-p 1.6000 8.0000 0.0055 Y 2616.826134 0 0.7769 2617 | 0/24
49 h-m-p 1.6000 8.0000 0.0017 Y 2616.826108 0 0.9432 2668 | 0/24
50 h-m-p 0.7870 8.0000 0.0020 Y 2616.826104 0 0.5951 2719 | 0/24
51 h-m-p 1.6000 8.0000 0.0005 C 2616.826104 0 0.4732 2770 | 0/24
52 h-m-p 1.6000 8.0000 0.0001 Y 2616.826104 0 0.7592 2821 | 0/24
53 h-m-p 1.6000 8.0000 0.0000 C 2616.826104 0 0.3595 2872 | 0/24
54 h-m-p 1.6000 8.0000 0.0000 -Y 2616.826104 0 0.1000 2924 | 0/24
55 h-m-p 0.0188 8.0000 0.0000 Y 2616.826104 0 0.0188 2975 | 0/24
56 h-m-p 0.1200 8.0000 0.0000 C 2616.826104 0 0.1200 3026 | 0/24
57 h-m-p 0.0907 8.0000 0.0000 -Y 2616.826104 0 0.0057 3078 | 0/24
58 h-m-p 0.0160 8.0000 0.0002 -------------.. | 0/24
59 h-m-p 0.0058 2.8860 0.0029 ------------
Out..
lnL = -2616.826104
3202 lfun, 38424 eigenQcodon, 669218 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2649.437393 S = -2564.445767 -76.392455
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 201 patterns 14:04
did 20 / 201 patterns 14:04
did 30 / 201 patterns 14:04
did 40 / 201 patterns 14:04
did 50 / 201 patterns 14:04
did 60 / 201 patterns 14:05
did 70 / 201 patterns 14:05
did 80 / 201 patterns 14:05
did 90 / 201 patterns 14:05
did 100 / 201 patterns 14:05
did 110 / 201 patterns 14:06
did 120 / 201 patterns 14:06
did 130 / 201 patterns 14:06
did 140 / 201 patterns 14:06
did 150 / 201 patterns 14:06
did 160 / 201 patterns 14:07
did 170 / 201 patterns 14:07
did 180 / 201 patterns 14:07
did 190 / 201 patterns 14:07
did 200 / 201 patterns 14:07
did 201 / 201 patterns 14:07
Time used: 14:07
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=248
D_melanogaster_RPA2-PA MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
D_sechellia_RPA2-PA MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
D_simulans_RPA2-PA MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
D_yakuba_RPA2-PA MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY
D_erecta_RPA2-PA MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
D_biarmipes_RPA2-PA MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY
D_suzukii_RPA2-PA MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
D_eugracilis_RPA2-PA MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY
D_rhopaloa_RPA2-PA MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
D_elegans_RPA2-PA MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY
D_takahashii_RPA2-PA MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY
********** ***.:****.******.***:**:*********:*****
D_melanogaster_RPA2-PA AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
D_sechellia_RPA2-PA AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
D_simulans_RPA2-PA AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
D_yakuba_RPA2-PA AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN
D_erecta_RPA2-PA AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
D_biarmipes_RPA2-PA AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN
D_suzukii_RPA2-PA AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
D_eugracilis_RPA2-PA AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN
D_rhopaloa_RPA2-PA AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN
D_elegans_RPA2-PA AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
D_takahashii_RPA2-PA GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN
.*.***.****:*********::******:******************:*
D_melanogaster_RPA2-PA NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
D_sechellia_RPA2-PA NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
D_simulans_RPA2-PA NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
D_yakuba_RPA2-PA NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
D_erecta_RPA2-PA NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
D_biarmipes_RPA2-PA NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK
D_suzukii_RPA2-PA NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ
D_eugracilis_RPA2-PA NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ
D_rhopaloa_RPA2-PA NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ
D_elegans_RPA2-PA NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ
D_takahashii_RPA2-PA NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ
************.*.****:*****:*****:******.**********:
D_melanogaster_RPA2-PA SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
D_sechellia_RPA2-PA SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
D_simulans_RPA2-PA SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
D_yakuba_RPA2-PA SKGGAG--AGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE
D_erecta_RPA2-PA SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE
D_biarmipes_RPA2-PA NKGGSG--AVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE
D_suzukii_RPA2-PA NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
D_eugracilis_RPA2-PA SKGGSG--AGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE
D_rhopaloa_RPA2-PA NKGGSS--GVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
D_elegans_RPA2-PA NKGGSS--AVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
D_takahashii_RPA2-PA NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE
.***:. . *.** *.*:***:***:******:*********** ****
D_melanogaster_RPA2-PA EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
D_sechellia_RPA2-PA EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
D_simulans_RPA2-PA EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
D_yakuba_RPA2-PA EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
D_erecta_RPA2-PA EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM--
D_biarmipes_RPA2-PA EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
D_suzukii_RPA2-PA EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
D_eugracilis_RPA2-PA EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
D_rhopaloa_RPA2-PA EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo
D_elegans_RPA2-PA EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTMoo
D_takahashii_RPA2-PA EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTMoo
******:****************:**********************
>D_melanogaster_RPA2-PA ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCAACTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATTGTGGACGCCCCAGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC GCCATGGCATGTGTTGTGGCCATAGTGCGGAACGTGGAGACTTCCTCGAC GAAGATCACCTACACCCTGGAGGATCATAGCGGCAGGATCGATGCGCACT ACTGGCTTGAGGAGGGCGACGCTCTCAAGGCACCCGAAGTAATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC CCTAATGATCTTCAAGCTACTGCCCGTTTTGGATCCCAACGAGGTGTGCA CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTGG AGCCCAAGCAGCAGGCCGTATTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >D_sechellia_RPA2-PA ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCGAC GAAGATCACCTATACACTGGAGGATCATAGCGGCAGGATCGATGCGCACT ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA CCCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGAGCTGGTGCAGGGGCTTCTTCCGGCTCAGGCTC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGGCTAG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA GAGGGCATCTCCCGCAAGCAACTGAAAGCCAAATTCTCCCACATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >D_simulans_RPA2-PA ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATTGTGGACGCCCCGGAGGGAAACATCGAGTTGTTCGGCATGCAGTAC GCCATGGCCTGTGTTGTGGCCATAGTGCGAAACGTGGAGACTTCCTCAAC GAAGATCACCTATACACTGGAGGACCATAGCGGCAGGATCGATGCGCACT ACTGGCTGGAGGAGGGCGACGCTCTCAAGGCACCCGAGGTCATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCCGGTCGCAAGGCGGTTCCAAAAC CCTAATGATATTCAAGCTACTGCCCGTCTTGGATCCCAACGAGGTGTGCA CGCACCTGCTGGAAGTACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGAGCTGGTGCAGGCGCTTCTTCCGGCTCAGGCTC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTTAGTGGGCTAG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAA GAGGGCATCTCTCGCAAGGAACTGAAAGCCAAATTCTCCCACATCAGCGA TTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >D_yakuba_RPA2-PA ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCAGTGG AGCCGCCAGTTCTCAAAAGGGAGAAGGAATAGCGCCCCTGGTGGTGAAAC AGATTGTGGACGCCCCGGAGGGAAACATCGAGATGTTCGGCATGCAGTAC GCAATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC AAAGATTACCTACGCCCTGGAGGATCATAGCGGCAGAATCGATGCGCACT ACTGGTTGGAGGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGATCAAC AACTACGTAAAGGTCTACGGCACCACCCGATCGCAAGGAGGTTCTAAAAC CCTAATGATCTTCAAGTTACTGCCTGTTTTGGATCCCAACGAGGTCTGCA CCCACCTGCTGGAAGTACTCAATGCCCGTTACAGGGCCGAGGACTACCAG AGTAAGGGTGGAGCTGGT------GCAGGCGCTTCCTCCGGCTCCGGCTC CATAGCTGATTTCACAGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG AGCCCAAGCAGCAGGCCGTTTTCCAGGCTATCAAGATCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTTTCCCATATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATATCTGAGGGACACATTT ATTCCAGCATTGACGCAGATCACTTTATTTGCACAATG------ >D_erecta_RPA2-PA ATGAATGACTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCGCTGG AGCCGCCAGCAATCAAAAGGGAGAAGGAATAGTGCCCCTGGTGGTGAAGC AGATCGTGGACGCCCCGGAGGGCAACATCGAGTTGTTCGGCATGCAGTAC GCGATGGCCTGTGTTGTGGCCATAGTGCGGAACATCGAGACTTCCTCGAC CAAGATCACCTACACGCTGGAGGATCATAGCGGCAGAATCGATGCGCACT ACTGGCTGGAAGAGGGCGACGCTCTGAAGGCACCCGAAGTCATGGTCAAC AACTACGTGAAGGTCTACGGCACCACCAGATCGCAAGGCGGCTCTAAGAC CCTGATGATCTTCAAGCTGCTGCCTGTTCTCGATCCCAACGAGGTGTGCA CCCACCTGCTGGAAGCACTCAATGCCCGCTACAGGGCCGAGGACTACCAG AGCAAGGGTGGAGCTGGTGGTGGTGCAGGGGCTTCTTCCGGCTCAGGCCC CATAGCTGATTTCACCGCCTCCCAGAGCTCGGCCATTGTCAGTGGACTGG AGCCCAAGCAGCAGGCCGTGTTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAGCTGAAAGCCAAATTCTCCCACATCAGCGA CTCTGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT ATTCCAGCATTGACGCAGACCACTTTATTTGCACAATG------ >D_biarmipes_RPA2-PA ATGAACGATTCATTTGGAGATTTCAATGCCACACAAACGGCGCCCACTGG AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTTCCACTGGTGATAAAGC AAGTTGTGGATGCCCCCGAGGGCAACATCGAGCTGTTCGGCATGCAATAT GCCATGGTCTGTGTGGTGGGCATAGTGCGCAACGTCGAGACCTCCTCGAC GAAGATTACCTACACCGTGGAGGATCACAGTGGCAGGATCGATGCGCACT ACTGGCTGGAGGAGGGCGACGCGCTGAAGGCCCCCGAGGTCATGGTCAAC AACTATGTTAAGGTCTACGGCACCACGCGATCGCAGGGGGGTCAGAAAAC CCTGATGGTCTTCAAGCTGCTGCCCGTGCTGGACCCCAACGAGGTGTGCA CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGACTACAAG AACAAGGGGGGATCTGGT------GCAGTGGCTTCATCCGGCTCTGGCTC CATAGCCGACTTCACCACCTCCCAGAGCTCGGCCATTGTGAGTGGGCTGG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG GAGGGCATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA TTCGGAACTGACCAACATTCTGGACTTCATGATTTCCGAGGGGCACATTT ATTCCAGCATTGATGCTGATCACTTTATCTGCACCATG------ >D_suzukii_RPA2-PA ATGAACGATTCATTTGGAGATTTTAATGCCACACAAACTGCGCCCGCTGG AGCGGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCGCTGGTGATTAAGC AGATTGTGGATGCCCCCGAGGGCAACATCGAGTTGTTTGGCATGCAATAT GCGATGGCCTGTGTGGTGGGCATAGTGCGAAATGTCGAGACTTCCTCAAC GAAGATTACTTACACCCTGGAGGATCACAGTGGCAGGATCGATGCGCACT ATTGGCTAGAAGAAGGCGACGCCCTGAAGGCCCCCGAAGTCATGGTCAAC AACTATGTGAAGGTCTATGGCACCACACGATCGCAGGGGGGGCAGAAAAC ACTGATGGTCTTCAAGCTGCTGCCCGTTTTGGACCCCAACGAGGTGTGCA CCCATCTCCTGGAGGTGCTCAATGCCCGCTACAGGGCCGAGGATTACCAG AACAAGGGGGGATCTGGT------GCAGTGGCTTCTTCAGGCTCCGGCTC CATAGCCGATTTTACCGCCTCCCAGAGCTCAGCCATTGTGAGTGGGCTGG ATCCCAAGCAGCAGGCTGTCTTCCAAGCCATTAAGAGCAATGTCTCCGAG GAGGGTATCTCGCGCAAGGAGCTGAAAGCCAAGTTCTCACACATCAGCGA CTCGGAGTTGACCAACATTCTGGACTTCATGATTTCCGAGGGACACATTT ATTCCAGCATTGATGCAGATCATTTCATATGCACCATG------ >D_eugracilis_RPA2-PA ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGCCCACTGG AGCCGCCAGCAATCAAAAGGGAGAGGGAATAGTACCATTGGTGGTAAAGC AAATTGTGGATGCCCCAGAGGGAAACATTGAGCTGTTCGGCATGCAATAT GCCATGGCCTGTGTGGTGGGCATTGTGCGAAACATCGAGACTTCCTCGAC AAAGATTACCTACACCCTAGAGGATCACAGTGGTAGGATCGATGCACACT ATTGGCTGGAGGAGGGCGACGCCCTGAAGGCGCCCGAAGTGATGGTCAAT AACTATGTAAAGGTCTATGGCACTACGCGTTCACAAGCGGGCCAGAAAAC CCTGATGGTCTTTAAACTCCTGCCCATTCTGGATCCCAATGAGGTGTGCA CCCATCTTCTTGAAGTTCTAAATGCCCGCTACAGGGCCGAGGATTACCAG AGCAAAGGTGGATCTGGC------GCTGGAGCTTCTTCTGGAGGTGGCTC CATATCCGATTTCACCGCCTCCCAGAGCACGGCTATTGTTAGTGGGCTTG ATCCCAAGCAGCAGGCCGTTTTCCAGGCCATTAAGAGCAATGTTTCCGAG GAGGGTATTTCCCGTAAGGAGCTAAAAGCGAAGTTCTCTCATATTAGCGA TTCTGAGTTGACCAACATTTTGGACTTTATGATTTCCGAGGGACACATTT ACTCCAGCATTGATGCGGATCATTTTATTTGCACAATG------ >D_rhopaloa_RPA2-PA ATGAATGATTCATTTGGAGATTTCAATGCCACACAAACTGCGACCGCTGG AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTCATTAAGC AGATTGTGGATGCGCCAGAGGGAAACATCGAGTTGTTTGGCATGCAATAT GCAATGGCCTGTGTGGTGGCCATAGTGCGAAATATCGAGACTTCCTCGAC CAAGATTACTTACACCCTGGAGGATCACAGTGGCCGGATGGATGCCCATT ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAAGTCATGCTCAAT AACTATGTGAAAGTGTATGGAACCACGCGATCGCAGGGAGGTCAGAAAAC CCTGATGGTGTTCAAACTGCTGCCCGTTTTGGATCCCAACGAGGTGTGCA CACATCTCCTAGAAGCTCTCAATGCCCGCTATAGGGCAGAGGATTACCAG AACAAGGGAGGATCTTCG------GGAGTGGCTCCTTCTGGCACCGGCTC CATATCCGATTTCACCGCCTCTCAGAGCTCGGCCATCGTCAGTGGGCTGG ATCCCAAGCAGCAGGCAGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCTCGCAAGGAACTAAAGGCCAAGTTCTCCCACATCAGCGA CTCGGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGTCATATAT ACTCCAGCATTGATGCCGATCACTTTATTTGCACTATG------ >D_elegans_RPA2-PA ATGAATGATTCGTTTGGAGATTTCAATGCCATACAAACTGCGACCGCTGG AGCCGCCAGCAATCAAAAGGGAGAGGGAATTGTGCCATTGGTAATAAAGC AGATTGTGGATGCGCCGGAGGGAAACATCGAGTTGTTCGGCATGCAATAT GCCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACCTCATCGAC CAAGATCACTTACACCCTGGAGGATCACAGTGGCCGAATCGATGCACATT ATTGGCTGGAGGAGGGCGATGCTCTGAAGGCCCCCGAGGTCATGCTCAAT AACTATGTGAAGGTCTATGGCACAACGCGATCTCAGGCAGGTCAGAAAAC GCTGATGGTCTTCAAATTGCTACCCATTTTGGATCCCAACGAGGTGTGCA CCCATCTCCTGGAAGCTCTCAATGCCCGCTATAGGGCAGAGGACTACCAG AACAAGGGAGGATCCTCA------GCAGTTGCTCCGTCGGGCTCCGGCTC CATATCCGATTTCACAGCCTCCCAGAGCTCGGCCATCGTCAGTGGGCTGG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTTTCCGAG GAGGGCATCTCCCGCAAGGAACTCAAAGCCAAATTCTCTCACATCAGCGA CTCCGAGTTGACCAATATTGTGGACTTCATGATTTCCGAGGGACATATTT ACTCCAGCATTGATGCCGATCACTTCATTTGCACTATG------ >D_takahashii_RPA2-PA ATGAACGATTCATTTGGAGATTTCAACGCCACACAAACGGCGCCCACGGG AGCAGCCAGCAATCAGAAGGGAGAGGGAATAGTGCCACTGGTGGTGAAGC AGATTGTGGATGCCCCGGAGGGCAACATCGAGATGTTCGGCATGCAATAC GGCATGGCCTGTGTGGTGGCCATAGTGCGAAACATCGAGACTTCCTCGAC GAAGATTACCTACACCCTGGAGGACCACAGCGGCAGGATCGATGCGCACT ATTGGTTGGAGGAGGGCGACGCCCTCAAGGCCCCCGAGGTCATGCTGAAC AACTACGTGAAGGTCTATGGCACCACGCGATCGCAGGCGGGCCAGAAGAC CCTAATGGTCTTCAAACTGCTGCCCGTTTTGGACCCAAACGAGCTGTGCA CCCATCTCCTAGAAGTGCTCAATGCGCGCTACAGGGCCGAGGATTACCAG AACAAGGGCGGATCTGGC------GCAGTGGCTTCTTCCGGCTCCGGCTC CATAGCTGACTTCACCGCCTCCCAGAGCTCGGCCATTGTAAGTGGGCTGG ATCCCAAGCAGCAGGCCGTCTTCCAGGCCATCAAGAGCAATGTCTCCGAG GAGGGCATCTCCCGCAAGGAACTGAAAGCCAAGTTCTCGCACATCAGTGA CTCGGAGTTGACCAACATTCTGGACTTTATGATTTCCGAAGGACACATTT ACTCCAGCATTGATGCTGATCATTTTATTTGCACAATG------
>D_melanogaster_RPA2-PA MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_sechellia_RPA2-PA MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKQLKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_simulans_RPA2-PA MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAGAGAGASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_yakuba_RPA2-PA MNDSFGDFNATQTAPSGAASSQKGEGIAPLVVKQIVDAPEGNIEMFGMQY AMACVVAIVRNIETSSTKITYALEDHSGRIDAHYWLEEGDALKAPEVMIN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ SKGGAG--AGASSGSGSIADFTASQSSAIVSGLEPKQQAVFQAIKINVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_erecta_RPA2-PA MNDSFGDFNATQTAPAGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGSKTLMIFKLLPVLDPNEVCTHLLEALNARYRAEDYQ SKGGAGGGAGASSGSGPIADFTASQSSAIVSGLEPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_biarmipes_RPA2-PA MNDSFGDFNATQTAPTGAASNQKGEGIVPLVIKQVVDAPEGNIELFGMQY AMVCVVGIVRNVETSSTKITYTVEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYK NKGGSG--AVASSGSGSIADFTTSQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_suzukii_RPA2-PA MNDSFGDFNATQTAPAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVGIVRNVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEVLNARYRAEDYQ NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_eugracilis_RPA2-PA MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQY AMACVVGIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEVLNARYRAEDYQ SKGGSG--AGASSGGGSISDFTASQSTAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM >D_rhopaloa_RPA2-PA MNDSFGDFNATQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRMDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQGGQKTLMVFKLLPVLDPNEVCTHLLEALNARYRAEDYQ NKGGSS--GVAPSGTGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTM >D_elegans_RPA2-PA MNDSFGDFNAIQTATAGAASNQKGEGIVPLVIKQIVDAPEGNIELFGMQY AMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPILDPNEVCTHLLEALNARYRAEDYQ NKGGSS--AVAPSGSGSISDFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNIVDFMISEGHIYSSIDADHFICTM >D_takahashii_RPA2-PA MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIEMFGMQY GMACVVAIVRNIETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMLN NYVKVYGTTRSQAGQKTLMVFKLLPVLDPNELCTHLLEVLNARYRAEDYQ NKGGSG--AVASSGSGSIADFTASQSSAIVSGLDPKQQAVFQAIKSNVSE EGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDADHFICTM
#NEXUS
[ID: 3161018450]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_RPA2-PA
D_sechellia_RPA2-PA
D_simulans_RPA2-PA
D_yakuba_RPA2-PA
D_erecta_RPA2-PA
D_biarmipes_RPA2-PA
D_suzukii_RPA2-PA
D_eugracilis_RPA2-PA
D_rhopaloa_RPA2-PA
D_elegans_RPA2-PA
D_takahashii_RPA2-PA
;
end;
begin trees;
translate
1 D_melanogaster_RPA2-PA,
2 D_sechellia_RPA2-PA,
3 D_simulans_RPA2-PA,
4 D_yakuba_RPA2-PA,
5 D_erecta_RPA2-PA,
6 D_biarmipes_RPA2-PA,
7 D_suzukii_RPA2-PA,
8 D_eugracilis_RPA2-PA,
9 D_rhopaloa_RPA2-PA,
10 D_elegans_RPA2-PA,
11 D_takahashii_RPA2-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01796583,(2:0.004004033,3:0.01876948)1.000:0.02511638,((4:0.09192618,5:0.05239711)0.930:0.01932069,(((6:0.08291827,7:0.08401263)0.989:0.03408019,11:0.09595351)0.997:0.03848283,(8:0.1899712,(9:0.07641254,10:0.07344668)1.000:0.1069829)0.609:0.02255635)1.000:0.1315696)0.954:0.01870744);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01796583,(2:0.004004033,3:0.01876948):0.02511638,((4:0.09192618,5:0.05239711):0.01932069,(((6:0.08291827,7:0.08401263):0.03408019,11:0.09595351):0.03848283,(8:0.1899712,(9:0.07641254,10:0.07344668):0.1069829):0.02255635):0.1315696):0.01870744);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2809.02 -2825.15
2 -2809.21 -2825.99
--------------------------------------
TOTAL -2809.11 -2825.65
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/373/RPA2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.210236 0.010595 1.024679 1.420749 1.204523 1414.33 1457.67 1.000
r(A<->C){all} 0.110637 0.000407 0.072182 0.150517 0.109336 1146.84 1158.78 1.000
r(A<->G){all} 0.324980 0.001435 0.252437 0.398673 0.324466 764.44 876.09 1.000
r(A<->T){all} 0.073032 0.000427 0.034133 0.113933 0.071607 887.25 910.94 1.000
r(C<->G){all} 0.078661 0.000245 0.049255 0.109580 0.077504 1226.96 1235.74 1.000
r(C<->T){all} 0.344704 0.001333 0.277671 0.419486 0.344619 749.67 823.51 1.000
r(G<->T){all} 0.067986 0.000277 0.037146 0.100768 0.067005 1224.15 1260.00 1.001
pi(A){all} 0.234624 0.000212 0.205474 0.261198 0.233830 1009.49 1022.78 1.000
pi(C){all} 0.270069 0.000215 0.241585 0.298633 0.269992 1286.83 1291.67 1.000
pi(G){all} 0.281567 0.000219 0.254645 0.311200 0.281372 993.00 1160.08 1.000
pi(T){all} 0.213740 0.000182 0.187366 0.239303 0.213989 1044.51 1204.94 1.000
alpha{1,2} 0.129868 0.000227 0.100792 0.158588 0.128959 1425.12 1463.06 1.000
alpha{3} 3.466050 0.902013 1.786479 5.238749 3.344522 1078.06 1289.53 1.001
pinvar{all} 0.247450 0.002605 0.148051 0.350267 0.248377 1266.75 1287.19 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/373/RPA2-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 244
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 4 3 2 | Ser TCT 2 2 3 4 3 2 | Tyr TAT 1 2 2 1 1 3 | Cys TGT 1 1 1 1 1 1
TTC 6 6 6 5 6 7 | TCC 10 10 9 10 8 7 | TAC 7 6 6 7 7 5 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 1 0 0 | TCA 2 2 3 1 2 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 2 0 | TCG 3 3 2 3 3 5 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 0 0 0 0 0 | Pro CCT 0 0 0 1 1 0 | His CAT 1 1 1 2 1 1 | Arg CGT 0 0 0 1 0 0
CTC 2 2 2 1 2 2 | CCC 5 6 6 5 6 6 | CAC 5 5 5 4 5 5 | CGC 2 2 2 1 2 3
CTA 2 3 3 1 0 0 | CCA 2 0 0 0 0 1 | Gln CAA 3 4 3 3 3 3 | CGA 0 1 1 1 0 1
CTG 8 8 8 9 12 13 | CCG 0 1 1 1 1 0 | CAG 7 7 7 7 7 7 | CGG 2 1 1 1 1 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 7 7 7 7 6 6 | Thr ACT 3 2 2 1 2 1 | Asn AAT 5 5 5 4 5 4 | Ser AGT 1 1 1 4 1 2
ATC 7 6 6 9 9 6 | ACC 8 7 6 6 8 10 | AAC 6 6 6 6 6 8 | AGC 7 7 7 4 7 5
ATA 3 4 4 4 3 4 | ACA 2 3 3 4 2 1 | Lys AAA 3 3 3 4 2 2 | Arg AGA 0 0 0 1 2 0
Met ATG 7 7 7 8 7 7 | ACG 1 1 2 1 1 3 | AAG 10 10 10 9 11 12 | AGG 2 2 2 1 1 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 2 3 4 3 3 | Ala GCT 4 5 5 5 5 2 | Asp GAT 7 8 8 6 5 9 | Gly GGT 2 2 2 3 2 2
GTC 3 6 5 4 4 8 | GCC 13 14 14 13 13 12 | GAC 6 6 6 7 8 5 | GGC 8 8 9 8 10 9
GTA 3 1 1 2 0 0 | GCA 4 3 3 4 4 2 | Glu GAA 4 3 4 3 5 1 | GGA 8 8 8 9 7 5
GTG 9 9 9 5 9 11 | GCG 2 2 2 3 3 3 | GAG 13 12 12 14 12 15 | GGG 2 2 1 0 1 4
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 3 1 3 | Ser TCT 2 5 4 2 2 | Tyr TAT 5 4 5 5 2 | Cys TGT 1 1 1 1 1
TTC 5 5 6 8 6 | TCC 7 8 7 10 9 | TAC 3 4 3 3 6 | TGC 2 2 2 2 2
Leu TTA 0 0 0 0 0 | TCA 5 2 1 2 1 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 3 3 4 5 3 | TCG 3 1 5 4 5 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 3 0 0 0 | Pro CCT 0 0 1 0 0 | His CAT 2 3 3 3 2 | Arg CGT 0 2 0 0 0
CTC 2 1 3 4 3 | CCC 6 5 4 4 4 | CAC 4 3 3 3 4 | CGC 2 1 2 2 2
CTA 1 3 2 1 2 | CCA 0 2 2 1 2 | Gln CAA 3 5 3 3 2 | CGA 2 1 2 3 2
CTG 10 6 7 6 9 | CCG 1 0 0 2 1 | CAG 8 6 8 8 9 | CGG 0 0 1 0 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 9 14 8 8 8 | Thr ACT 3 4 4 3 1 | Asn AAT 5 7 8 7 3 | Ser AGT 2 2 2 2 2
ATC 4 2 6 8 6 | ACC 6 6 8 6 7 | AAC 7 4 4 5 9 | AGC 5 6 5 5 5
ATA 4 2 3 4 3 | ACA 3 3 2 2 2 | Lys AAA 2 4 3 4 2 | Arg AGA 0 0 0 0 0
Met ATG 7 7 8 7 8 | ACG 1 2 1 2 4 | AAG 11 9 10 9 11 | AGG 2 2 1 1 2
----------------------------------------------------------------------------------------------------------------------
Val GTT 1 4 2 2 1 | Ala GCT 3 3 4 4 3 | Asp GAT 10 12 12 11 8 | Gly GGT 2 4 2 1 0
GTC 7 3 4 5 5 | GCC 13 12 13 14 13 | GAC 4 2 2 3 6 | GGC 8 7 6 7 12
GTA 0 3 0 1 1 | GCA 2 1 3 4 2 | Glu GAA 3 2 3 2 3 | GGA 6 9 10 8 6
GTG 11 7 11 8 10 | GCG 4 5 2 2 4 | GAG 13 14 13 14 13 | GGG 4 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_RPA2-PA
position 1: T:0.16803 C:0.16393 A:0.29508 G:0.37295
position 2: T:0.27459 C:0.25000 A:0.31967 G:0.15574
position 3: T:0.16803 C:0.39754 A:0.14754 G:0.28689
Average T:0.20355 C:0.27049 A:0.25410 G:0.27186
#2: D_sechellia_RPA2-PA
position 1: T:0.16803 C:0.16803 A:0.29098 G:0.37295
position 2: T:0.27459 C:0.25000 A:0.31967 G:0.15574
position 3: T:0.16803 C:0.40574 A:0.14344 G:0.28279
Average T:0.20355 C:0.27459 A:0.25137 G:0.27049
#3: D_simulans_RPA2-PA
position 1: T:0.16803 C:0.16393 A:0.29098 G:0.37705
position 2: T:0.27459 C:0.25000 A:0.31967 G:0.15574
position 3: T:0.17623 C:0.39754 A:0.14754 G:0.27869
Average T:0.20628 C:0.27049 A:0.25273 G:0.27049
#4: D_yakuba_RPA2-PA
position 1: T:0.17623 C:0.15574 A:0.29918 G:0.36885
position 2: T:0.27459 C:0.25410 A:0.31557 G:0.15574
position 3: T:0.19672 C:0.37705 A:0.15574 G:0.27049
Average T:0.21585 C:0.26230 A:0.25683 G:0.26503
#5: D_erecta_RPA2-PA
position 1: T:0.15984 C:0.16803 A:0.29918 G:0.37295
position 2: T:0.27049 C:0.25410 A:0.31967 G:0.15574
position 3: T:0.15984 C:0.42213 A:0.12295 G:0.29508
Average T:0.19672 C:0.28142 A:0.24727 G:0.27459
#6: D_biarmipes_RPA2-PA
position 1: T:0.15574 C:0.17213 A:0.29918 G:0.37295
position 2: T:0.28279 C:0.23770 A:0.32787 G:0.15164
position 3: T:0.15574 C:0.40984 A:0.09426 G:0.34016
Average T:0.19809 C:0.27322 A:0.24044 G:0.28825
#7: D_suzukii_RPA2-PA
position 1: T:0.16803 C:0.16803 A:0.29098 G:0.37295
position 2: T:0.27869 C:0.24180 A:0.32787 G:0.15164
position 3: T:0.20082 C:0.34836 A:0.12705 G:0.32377
Average T:0.21585 C:0.25273 A:0.24863 G:0.28279
#8: D_eugracilis_RPA2-PA
position 1: T:0.16393 C:0.16803 A:0.30328 G:0.36475
position 2: T:0.27459 C:0.24180 A:0.32377 G:0.15984
position 3: T:0.29508 C:0.29098 A:0.15164 G:0.26230
Average T:0.24454 C:0.23361 A:0.25956 G:0.26230
#9: D_rhopaloa_RPA2-PA
position 1: T:0.17213 C:0.16803 A:0.29918 G:0.36066
position 2: T:0.27459 C:0.25000 A:0.32787 G:0.14754
position 3: T:0.24180 C:0.31967 A:0.13934 G:0.29918
Average T:0.22951 C:0.24590 A:0.25546 G:0.26913
#10: D_elegans_RPA2-PA
position 1: T:0.18033 C:0.16393 A:0.29918 G:0.35656
position 2: T:0.27869 C:0.25410 A:0.32787 G:0.13934
position 3: T:0.20492 C:0.36475 A:0.14344 G:0.28689
Average T:0.22131 C:0.26093 A:0.25683 G:0.26093
#11: D_takahashii_RPA2-PA
position 1: T:0.16803 C:0.17213 A:0.29918 G:0.36066
position 2: T:0.27869 C:0.24590 A:0.32787 G:0.14754
position 3: T:0.14754 C:0.40574 A:0.11475 G:0.33197
Average T:0.19809 C:0.27459 A:0.24727 G:0.28005
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 33 | Ser S TCT 31 | Tyr Y TAT 31 | Cys C TGT 11
TTC 66 | TCC 95 | TAC 57 | TGC 22
Leu L TTA 1 | TCA 24 | *** * TAA 0 | *** * TGA 0
TTG 32 | TCG 37 | TAG 0 | Trp W TGG 11
------------------------------------------------------------------------------
Leu L CTT 4 | Pro P CCT 3 | His H CAT 20 | Arg R CGT 3
CTC 24 | CCC 57 | CAC 46 | CGC 21
CTA 18 | CCA 10 | Gln Q CAA 35 | CGA 14
CTG 96 | CCG 8 | CAG 81 | CGG 7
------------------------------------------------------------------------------
Ile I ATT 87 | Thr T ACT 26 | Asn N AAT 58 | Ser S AGT 20
ATC 69 | ACC 78 | AAC 67 | AGC 63
ATA 38 | ACA 27 | Lys K AAA 32 | Arg R AGA 3
Met M ATG 80 | ACG 19 | AAG 112 | AGG 18
------------------------------------------------------------------------------
Val V GTT 28 | Ala A GCT 43 | Asp D GAT 96 | Gly G GGT 22
GTC 54 | GCC 144 | GAC 55 | GGC 92
GTA 12 | GCA 32 | Glu E GAA 33 | GGA 84
GTG 99 | GCG 32 | GAG 145 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16803 C:0.16654 A:0.29694 G:0.36848
position 2: T:0.27608 C:0.24814 A:0.32340 G:0.15238
position 3: T:0.19225 C:0.37630 A:0.13525 G:0.29620
Average T:0.21212 C:0.26366 A:0.25186 G:0.27235
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_RPA2-PA
D_sechellia_RPA2-PA 0.0633 (0.0054 0.0852)
D_simulans_RPA2-PA 0.0273 (0.0036 0.1318) 0.0434 (0.0018 0.0414)
D_yakuba_RPA2-PA 0.0767 (0.0190 0.2480) 0.0809 (0.0227 0.2806) 0.0644 (0.0209 0.3237)
D_erecta_RPA2-PA 0.0514 (0.0099 0.1927) 0.0565 (0.0117 0.2075) 0.0378 (0.0099 0.2626) 0.0922 (0.0218 0.2360)
D_biarmipes_RPA2-PA 0.0497 (0.0274 0.5511) 0.0543 (0.0293 0.5384) 0.0477 (0.0274 0.5744) 0.0673 (0.0443 0.6580) 0.0606 (0.0349 0.5754)
D_suzukii_RPA2-PA 0.0317 (0.0200 0.6298) 0.0276 (0.0181 0.6559) 0.0233 (0.0163 0.6982) 0.0449 (0.0367 0.8161) 0.0414 (0.0255 0.6166) 0.0324 (0.0108 0.3342)
D_eugracilis_RPA2-PA 0.0346 (0.0255 0.7362) 0.0349 (0.0273 0.7827) 0.0312 (0.0255 0.8160) 0.0453 (0.0394 0.8692) 0.0364 (0.0301 0.8265) 0.0434 (0.0283 0.6518) 0.0265 (0.0199 0.7513)
D_rhopaloa_RPA2-PA 0.0640 (0.0423 0.6615) 0.0599 (0.0404 0.6745) 0.0526 (0.0385 0.7332) 0.0614 (0.0530 0.8642) 0.0527 (0.0398 0.7556) 0.0559 (0.0351 0.6281) 0.0441 (0.0239 0.5429) 0.0495 (0.0350 0.7080)
D_elegans_RPA2-PA 0.0642 (0.0413 0.6436) 0.0641 (0.0395 0.6158) 0.0538 (0.0376 0.6990) 0.0681 (0.0517 0.7596) 0.0544 (0.0385 0.7078) 0.0595 (0.0357 0.6002) 0.0355 (0.0236 0.6640) 0.0434 (0.0310 0.7138) 0.0365 (0.0108 0.2959)
D_takahashii_RPA2-PA 0.0586 (0.0273 0.4659) 0.0601 (0.0273 0.4546) 0.0512 (0.0255 0.4981) 0.0547 (0.0338 0.6184) 0.0583 (0.0301 0.5160) 0.0685 (0.0246 0.3589) 0.0401 (0.0172 0.4289) 0.0319 (0.0217 0.6813) 0.0515 (0.0304 0.5898) 0.0415 (0.0263 0.6340)
Model 0: one-ratio
TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
lnL(ntime: 19 np: 21): -2640.459092 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10
0.026019 0.045105 0.004417 0.029945 0.029542 0.025425 0.148980 0.086420 0.203904 0.043226 0.067776 0.140349 0.126994 0.156812 0.035084 0.280186 0.165793 0.109110 0.125448 1.902702 0.047733
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.85053
(1: 0.026019, (2: 0.004417, 3: 0.029945): 0.045105, ((4: 0.148980, 5: 0.086420): 0.025425, (((6: 0.140349, 7: 0.126994): 0.067776, 11: 0.156812): 0.043226, (8: 0.280186, (9: 0.109110, 10: 0.125448): 0.165793): 0.035084): 0.203904): 0.029542);
(D_melanogaster_RPA2-PA: 0.026019, (D_sechellia_RPA2-PA: 0.004417, D_simulans_RPA2-PA: 0.029945): 0.045105, ((D_yakuba_RPA2-PA: 0.148980, D_erecta_RPA2-PA: 0.086420): 0.025425, (((D_biarmipes_RPA2-PA: 0.140349, D_suzukii_RPA2-PA: 0.126994): 0.067776, D_takahashii_RPA2-PA: 0.156812): 0.043226, (D_eugracilis_RPA2-PA: 0.280186, (D_rhopaloa_RPA2-PA: 0.109110, D_elegans_RPA2-PA: 0.125448): 0.165793): 0.035084): 0.203904): 0.029542);
Detailed output identifying parameters
kappa (ts/tv) = 1.90270
omega (dN/dS) = 0.04773
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.026 561.4 170.6 0.0477 0.0015 0.0322 0.9 5.5
12..13 0.045 561.4 170.6 0.0477 0.0027 0.0557 1.5 9.5
13..2 0.004 561.4 170.6 0.0477 0.0003 0.0055 0.1 0.9
13..3 0.030 561.4 170.6 0.0477 0.0018 0.0370 1.0 6.3
12..14 0.030 561.4 170.6 0.0477 0.0017 0.0365 1.0 6.2
14..15 0.025 561.4 170.6 0.0477 0.0015 0.0314 0.8 5.4
15..4 0.149 561.4 170.6 0.0477 0.0088 0.1841 4.9 31.4
15..5 0.086 561.4 170.6 0.0477 0.0051 0.1068 2.9 18.2
14..16 0.204 561.4 170.6 0.0477 0.0120 0.2520 6.8 43.0
16..17 0.043 561.4 170.6 0.0477 0.0026 0.0534 1.4 9.1
17..18 0.068 561.4 170.6 0.0477 0.0040 0.0838 2.2 14.3
18..6 0.140 561.4 170.6 0.0477 0.0083 0.1735 4.6 29.6
18..7 0.127 561.4 170.6 0.0477 0.0075 0.1570 4.2 26.8
17..11 0.157 561.4 170.6 0.0477 0.0093 0.1938 5.2 33.1
16..19 0.035 561.4 170.6 0.0477 0.0021 0.0434 1.2 7.4
19..8 0.280 561.4 170.6 0.0477 0.0165 0.3463 9.3 59.1
19..20 0.166 561.4 170.6 0.0477 0.0098 0.2049 5.5 35.0
20..9 0.109 561.4 170.6 0.0477 0.0064 0.1348 3.6 23.0
20..10 0.125 561.4 170.6 0.0477 0.0074 0.1550 4.2 26.5
tree length for dN: 0.1092
tree length for dS: 2.2871
Time used: 0:14
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
check convergence..
lnL(ntime: 19 np: 22): -2625.435695 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10
0.027399 0.044871 0.004478 0.030370 0.028495 0.027897 0.152839 0.087461 0.211751 0.045860 0.064143 0.144019 0.129677 0.160089 0.038768 0.293699 0.162046 0.112772 0.128823 1.970157 0.951225 0.027909
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.89546
(1: 0.027399, (2: 0.004478, 3: 0.030370): 0.044871, ((4: 0.152839, 5: 0.087461): 0.027897, (((6: 0.144019, 7: 0.129677): 0.064143, 11: 0.160089): 0.045860, (8: 0.293699, (9: 0.112772, 10: 0.128823): 0.162046): 0.038768): 0.211751): 0.028495);
(D_melanogaster_RPA2-PA: 0.027399, (D_sechellia_RPA2-PA: 0.004478, D_simulans_RPA2-PA: 0.030370): 0.044871, ((D_yakuba_RPA2-PA: 0.152839, D_erecta_RPA2-PA: 0.087461): 0.027897, (((D_biarmipes_RPA2-PA: 0.144019, D_suzukii_RPA2-PA: 0.129677): 0.064143, D_takahashii_RPA2-PA: 0.160089): 0.045860, (D_eugracilis_RPA2-PA: 0.293699, (D_rhopaloa_RPA2-PA: 0.112772, D_elegans_RPA2-PA: 0.128823): 0.162046): 0.038768): 0.211751): 0.028495);
Detailed output identifying parameters
kappa (ts/tv) = 1.97016
dN/dS (w) for site classes (K=2)
p: 0.95122 0.04878
w: 0.02791 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.027 560.6 171.4 0.0753 0.0024 0.0313 1.3 5.4
12..13 0.045 560.6 171.4 0.0753 0.0039 0.0512 2.2 8.8
13..2 0.004 560.6 171.4 0.0753 0.0004 0.0051 0.2 0.9
13..3 0.030 560.6 171.4 0.0753 0.0026 0.0347 1.5 5.9
12..14 0.028 560.6 171.4 0.0753 0.0025 0.0325 1.4 5.6
14..15 0.028 560.6 171.4 0.0753 0.0024 0.0319 1.3 5.5
15..4 0.153 560.6 171.4 0.0753 0.0131 0.1745 7.4 29.9
15..5 0.087 560.6 171.4 0.0753 0.0075 0.0999 4.2 17.1
14..16 0.212 560.6 171.4 0.0753 0.0182 0.2418 10.2 41.5
16..17 0.046 560.6 171.4 0.0753 0.0039 0.0524 2.2 9.0
17..18 0.064 560.6 171.4 0.0753 0.0055 0.0732 3.1 12.6
18..6 0.144 560.6 171.4 0.0753 0.0124 0.1645 6.9 28.2
18..7 0.130 560.6 171.4 0.0753 0.0112 0.1481 6.3 25.4
17..11 0.160 560.6 171.4 0.0753 0.0138 0.1828 7.7 31.3
16..19 0.039 560.6 171.4 0.0753 0.0033 0.0443 1.9 7.6
19..8 0.294 560.6 171.4 0.0753 0.0253 0.3354 14.2 57.5
19..20 0.162 560.6 171.4 0.0753 0.0139 0.1851 7.8 31.7
20..9 0.113 560.6 171.4 0.0753 0.0097 0.1288 5.4 22.1
20..10 0.129 560.6 171.4 0.0753 0.0111 0.1471 6.2 25.2
Time used: 0:53
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
lnL(ntime: 19 np: 24): -2625.435695 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10
0.027399 0.044871 0.004478 0.030370 0.028495 0.027897 0.152839 0.087461 0.211751 0.045860 0.064143 0.144019 0.129677 0.160089 0.038768 0.293699 0.162046 0.112772 0.128823 1.970157 0.951225 0.048775 0.027909 135.778812
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.89546
(1: 0.027399, (2: 0.004478, 3: 0.030370): 0.044871, ((4: 0.152839, 5: 0.087461): 0.027897, (((6: 0.144019, 7: 0.129677): 0.064143, 11: 0.160089): 0.045860, (8: 0.293699, (9: 0.112772, 10: 0.128823): 0.162046): 0.038768): 0.211751): 0.028495);
(D_melanogaster_RPA2-PA: 0.027399, (D_sechellia_RPA2-PA: 0.004478, D_simulans_RPA2-PA: 0.030370): 0.044871, ((D_yakuba_RPA2-PA: 0.152839, D_erecta_RPA2-PA: 0.087461): 0.027897, (((D_biarmipes_RPA2-PA: 0.144019, D_suzukii_RPA2-PA: 0.129677): 0.064143, D_takahashii_RPA2-PA: 0.160089): 0.045860, (D_eugracilis_RPA2-PA: 0.293699, (D_rhopaloa_RPA2-PA: 0.112772, D_elegans_RPA2-PA: 0.128823): 0.162046): 0.038768): 0.211751): 0.028495);
Detailed output identifying parameters
kappa (ts/tv) = 1.97016
dN/dS (w) for site classes (K=3)
p: 0.95122 0.04878 0.00000
w: 0.02791 1.00000 135.77881
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.027 560.6 171.4 0.0753 0.0024 0.0313 1.3 5.4
12..13 0.045 560.6 171.4 0.0753 0.0039 0.0512 2.2 8.8
13..2 0.004 560.6 171.4 0.0753 0.0004 0.0051 0.2 0.9
13..3 0.030 560.6 171.4 0.0753 0.0026 0.0347 1.5 5.9
12..14 0.028 560.6 171.4 0.0753 0.0025 0.0325 1.4 5.6
14..15 0.028 560.6 171.4 0.0753 0.0024 0.0319 1.3 5.5
15..4 0.153 560.6 171.4 0.0753 0.0131 0.1745 7.4 29.9
15..5 0.087 560.6 171.4 0.0753 0.0075 0.0999 4.2 17.1
14..16 0.212 560.6 171.4 0.0753 0.0182 0.2418 10.2 41.5
16..17 0.046 560.6 171.4 0.0753 0.0039 0.0524 2.2 9.0
17..18 0.064 560.6 171.4 0.0753 0.0055 0.0732 3.1 12.6
18..6 0.144 560.6 171.4 0.0753 0.0124 0.1645 6.9 28.2
18..7 0.130 560.6 171.4 0.0753 0.0112 0.1481 6.3 25.4
17..11 0.160 560.6 171.4 0.0753 0.0138 0.1828 7.7 31.3
16..19 0.039 560.6 171.4 0.0753 0.0033 0.0443 1.9 7.6
19..8 0.294 560.6 171.4 0.0753 0.0253 0.3354 14.2 57.5
19..20 0.162 560.6 171.4 0.0753 0.0139 0.1851 7.8 31.7
20..9 0.113 560.6 171.4 0.0753 0.0097 0.1288 5.4 22.1
20..10 0.129 560.6 171.4 0.0753 0.0111 0.1471 6.2 25.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_RPA2-PA)
Pr(w>1) post mean +- SE for w
16 T 0.588 1.433 +- 0.677
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.769 0.081 0.033 0.022 0.018 0.016 0.016 0.015 0.015 0.015
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 3:16
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
lnL(ntime: 19 np: 25): -2616.379039 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10
0.027375 0.045032 0.004443 0.030547 0.029001 0.027395 0.152833 0.086892 0.209243 0.044447 0.067453 0.143634 0.128910 0.160273 0.035977 0.288431 0.166971 0.110988 0.127916 1.881034 0.757508 0.236748 0.000001 0.200426 1.369527
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.88776
(1: 0.027375, (2: 0.004443, 3: 0.030547): 0.045032, ((4: 0.152833, 5: 0.086892): 0.027395, (((6: 0.143634, 7: 0.128910): 0.067453, 11: 0.160273): 0.044447, (8: 0.288431, (9: 0.110988, 10: 0.127916): 0.166971): 0.035977): 0.209243): 0.029001);
(D_melanogaster_RPA2-PA: 0.027375, (D_sechellia_RPA2-PA: 0.004443, D_simulans_RPA2-PA: 0.030547): 0.045032, ((D_yakuba_RPA2-PA: 0.152833, D_erecta_RPA2-PA: 0.086892): 0.027395, (((D_biarmipes_RPA2-PA: 0.143634, D_suzukii_RPA2-PA: 0.128910): 0.067453, D_takahashii_RPA2-PA: 0.160273): 0.044447, (D_eugracilis_RPA2-PA: 0.288431, (D_rhopaloa_RPA2-PA: 0.110988, D_elegans_RPA2-PA: 0.127916): 0.166971): 0.035977): 0.209243): 0.029001);
Detailed output identifying parameters
kappa (ts/tv) = 1.88103
dN/dS (w) for site classes (K=3)
p: 0.75751 0.23675 0.00574
w: 0.00000 0.20043 1.36953
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.027 561.6 170.4 0.0553 0.0018 0.0332 1.0 5.6
12..13 0.045 561.6 170.4 0.0553 0.0030 0.0545 1.7 9.3
13..2 0.004 561.6 170.4 0.0553 0.0003 0.0054 0.2 0.9
13..3 0.031 561.6 170.4 0.0553 0.0020 0.0370 1.1 6.3
12..14 0.029 561.6 170.4 0.0553 0.0019 0.0351 1.1 6.0
14..15 0.027 561.6 170.4 0.0553 0.0018 0.0332 1.0 5.7
15..4 0.153 561.6 170.4 0.0553 0.0102 0.1851 5.8 31.5
15..5 0.087 561.6 170.4 0.0553 0.0058 0.1053 3.3 17.9
14..16 0.209 561.6 170.4 0.0553 0.0140 0.2535 7.9 43.2
16..17 0.044 561.6 170.4 0.0553 0.0030 0.0538 1.7 9.2
17..18 0.067 561.6 170.4 0.0553 0.0045 0.0817 2.5 13.9
18..6 0.144 561.6 170.4 0.0553 0.0096 0.1740 5.4 29.6
18..7 0.129 561.6 170.4 0.0553 0.0086 0.1562 4.9 26.6
17..11 0.160 561.6 170.4 0.0553 0.0107 0.1941 6.0 33.1
16..19 0.036 561.6 170.4 0.0553 0.0024 0.0436 1.4 7.4
19..8 0.288 561.6 170.4 0.0553 0.0193 0.3494 10.9 59.5
19..20 0.167 561.6 170.4 0.0553 0.0112 0.2023 6.3 34.5
20..9 0.111 561.6 170.4 0.0553 0.0074 0.1344 4.2 22.9
20..10 0.128 561.6 170.4 0.0553 0.0086 0.1549 4.8 26.4
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_RPA2-PA)
Pr(w>1) post mean +- SE for w
16 T 0.917 1.272
Time used: 5:53
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
check convergence..
lnL(ntime: 19 np: 22): -2617.179514 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10
0.026793 0.045430 0.004436 0.030436 0.028586 0.027464 0.151716 0.087338 0.209091 0.044644 0.066217 0.143044 0.129468 0.160237 0.036035 0.287795 0.167468 0.110889 0.127566 1.892537 0.120782 1.874184
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.88465
(1: 0.026793, (2: 0.004436, 3: 0.030436): 0.045430, ((4: 0.151716, 5: 0.087338): 0.027464, (((6: 0.143044, 7: 0.129468): 0.066217, 11: 0.160237): 0.044644, (8: 0.287795, (9: 0.110889, 10: 0.127566): 0.167468): 0.036035): 0.209091): 0.028586);
(D_melanogaster_RPA2-PA: 0.026793, (D_sechellia_RPA2-PA: 0.004436, D_simulans_RPA2-PA: 0.030436): 0.045430, ((D_yakuba_RPA2-PA: 0.151716, D_erecta_RPA2-PA: 0.087338): 0.027464, (((D_biarmipes_RPA2-PA: 0.143044, D_suzukii_RPA2-PA: 0.129468): 0.066217, D_takahashii_RPA2-PA: 0.160237): 0.044644, (D_eugracilis_RPA2-PA: 0.287795, (D_rhopaloa_RPA2-PA: 0.110889, D_elegans_RPA2-PA: 0.127566): 0.167468): 0.036035): 0.209091): 0.028586);
Detailed output identifying parameters
kappa (ts/tv) = 1.89254
Parameters in M7 (beta):
p = 0.12078 q = 1.87418
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00007 0.00057 0.00300 0.01204 0.04023 0.12087 0.37252
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.027 561.5 170.5 0.0549 0.0018 0.0325 1.0 5.5
12..13 0.045 561.5 170.5 0.0549 0.0030 0.0551 1.7 9.4
13..2 0.004 561.5 170.5 0.0549 0.0003 0.0054 0.2 0.9
13..3 0.030 561.5 170.5 0.0549 0.0020 0.0369 1.1 6.3
12..14 0.029 561.5 170.5 0.0549 0.0019 0.0346 1.1 5.9
14..15 0.027 561.5 170.5 0.0549 0.0018 0.0333 1.0 5.7
15..4 0.152 561.5 170.5 0.0549 0.0101 0.1839 5.7 31.3
15..5 0.087 561.5 170.5 0.0549 0.0058 0.1058 3.3 18.0
14..16 0.209 561.5 170.5 0.0549 0.0139 0.2534 7.8 43.2
16..17 0.045 561.5 170.5 0.0549 0.0030 0.0541 1.7 9.2
17..18 0.066 561.5 170.5 0.0549 0.0044 0.0802 2.5 13.7
18..6 0.143 561.5 170.5 0.0549 0.0095 0.1733 5.3 29.6
18..7 0.129 561.5 170.5 0.0549 0.0086 0.1569 4.8 26.8
17..11 0.160 561.5 170.5 0.0549 0.0107 0.1942 6.0 33.1
16..19 0.036 561.5 170.5 0.0549 0.0024 0.0437 1.3 7.4
19..8 0.288 561.5 170.5 0.0549 0.0192 0.3488 10.8 59.5
19..20 0.167 561.5 170.5 0.0549 0.0111 0.2029 6.3 34.6
20..9 0.111 561.5 170.5 0.0549 0.0074 0.1344 4.1 22.9
20..10 0.128 561.5 170.5 0.0549 0.0085 0.1546 4.8 26.4
Time used: 9:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), ((4, 5), (((6, 7), 11), (8, (9, 10))))); MP score: 356
check convergence..
lnL(ntime: 19 np: 24): -2616.826104 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..18 18..6 18..7 17..11 16..19 19..8 19..20 20..9 20..10
0.027237 0.045002 0.004446 0.030442 0.028745 0.027516 0.152484 0.086898 0.209403 0.044544 0.066594 0.143534 0.129001 0.160267 0.036307 0.288506 0.166586 0.111051 0.127806 1.888808 0.995511 0.134717 2.329188 1.382117
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.88637
(1: 0.027237, (2: 0.004446, 3: 0.030442): 0.045002, ((4: 0.152484, 5: 0.086898): 0.027516, (((6: 0.143534, 7: 0.129001): 0.066594, 11: 0.160267): 0.044544, (8: 0.288506, (9: 0.111051, 10: 0.127806): 0.166586): 0.036307): 0.209403): 0.028745);
(D_melanogaster_RPA2-PA: 0.027237, (D_sechellia_RPA2-PA: 0.004446, D_simulans_RPA2-PA: 0.030442): 0.045002, ((D_yakuba_RPA2-PA: 0.152484, D_erecta_RPA2-PA: 0.086898): 0.027516, (((D_biarmipes_RPA2-PA: 0.143534, D_suzukii_RPA2-PA: 0.129001): 0.066594, D_takahashii_RPA2-PA: 0.160267): 0.044544, (D_eugracilis_RPA2-PA: 0.288506, (D_rhopaloa_RPA2-PA: 0.111051, D_elegans_RPA2-PA: 0.127806): 0.166586): 0.036307): 0.209403): 0.028745);
Detailed output identifying parameters
kappa (ts/tv) = 1.88881
Parameters in M8 (beta&w>1):
p0 = 0.99551 p = 0.13472 q = 2.32919
(p1 = 0.00449) w = 1.38212
dN/dS (w) for site classes (K=11)
p: 0.09955 0.09955 0.09955 0.09955 0.09955 0.09955 0.09955 0.09955 0.09955 0.09955 0.00449
w: 0.00000 0.00000 0.00001 0.00013 0.00087 0.00386 0.01349 0.04026 0.11071 0.32393 1.38212
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.027 561.5 170.5 0.0553 0.0018 0.0330 1.0 5.6
12..13 0.045 561.5 170.5 0.0553 0.0030 0.0545 1.7 9.3
13..2 0.004 561.5 170.5 0.0553 0.0003 0.0054 0.2 0.9
13..3 0.030 561.5 170.5 0.0553 0.0020 0.0369 1.1 6.3
12..14 0.029 561.5 170.5 0.0553 0.0019 0.0348 1.1 5.9
14..15 0.028 561.5 170.5 0.0553 0.0018 0.0333 1.0 5.7
15..4 0.152 561.5 170.5 0.0553 0.0102 0.1846 5.7 31.5
15..5 0.087 561.5 170.5 0.0553 0.0058 0.1052 3.3 17.9
14..16 0.209 561.5 170.5 0.0553 0.0140 0.2535 7.9 43.2
16..17 0.045 561.5 170.5 0.0553 0.0030 0.0539 1.7 9.2
17..18 0.067 561.5 170.5 0.0553 0.0045 0.0806 2.5 13.7
18..6 0.144 561.5 170.5 0.0553 0.0096 0.1738 5.4 29.6
18..7 0.129 561.5 170.5 0.0553 0.0086 0.1562 4.9 26.6
17..11 0.160 561.5 170.5 0.0553 0.0107 0.1941 6.0 33.1
16..19 0.036 561.5 170.5 0.0553 0.0024 0.0440 1.4 7.5
19..8 0.289 561.5 170.5 0.0553 0.0193 0.3493 10.8 59.5
19..20 0.167 561.5 170.5 0.0553 0.0112 0.2017 6.3 34.4
20..9 0.111 561.5 170.5 0.0553 0.0074 0.1345 4.2 22.9
20..10 0.128 561.5 170.5 0.0553 0.0086 0.1547 4.8 26.4
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_RPA2-PA)
Pr(w>1) post mean +- SE for w
16 T 0.732 1.098
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_RPA2-PA)
Pr(w>1) post mean +- SE for w
16 T 0.836 1.601 +- 0.852
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.001 0.010 0.063 0.242 0.684
ws: 0.778 0.104 0.038 0.020 0.013 0.011 0.010 0.009 0.009 0.009
Time used: 14:07
Model 1: NearlyNeutral -2625.435695 Model 2: PositiveSelection -2625.435695 Model 0: one-ratio -2640.459092 Model 3: discrete -2616.379039 Model 7: beta -2617.179514 Model 8: beta&w>1 -2616.826104 Model 0 vs 1 30.046793999999863 Model 2 vs 1 0.0 Model 8 vs 7 0.7068199999994249
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
