--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:10:51 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/fecB/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1473.19 -1476.38 2 -1473.18 -1478.67 -------------------------------------- TOTAL -1473.18 -1478.07 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896183 0.090581 0.358954 1.463274 0.863699 1466.78 1483.89 1.000 r(A<->C){all} 0.166519 0.020179 0.000074 0.454364 0.125961 175.94 250.93 1.003 r(A<->G){all} 0.174946 0.022522 0.000051 0.487872 0.133970 156.26 164.44 1.002 r(A<->T){all} 0.162328 0.019128 0.000001 0.440624 0.121122 145.41 166.02 1.000 r(C<->G){all} 0.170744 0.020079 0.000147 0.456852 0.135239 199.02 286.70 1.001 r(C<->T){all} 0.159231 0.019069 0.000007 0.447086 0.122694 122.65 215.59 1.001 r(G<->T){all} 0.166233 0.020237 0.000002 0.451615 0.128933 166.81 190.42 1.000 pi(A){all} 0.208012 0.000153 0.184669 0.231759 0.207965 1214.49 1341.78 1.000 pi(C){all} 0.338176 0.000208 0.308408 0.364509 0.338049 1100.55 1167.54 1.000 pi(G){all} 0.291002 0.000188 0.266033 0.318653 0.291062 1285.12 1349.64 1.000 pi(T){all} 0.162809 0.000120 0.141047 0.183373 0.162642 1382.62 1388.82 1.002 alpha{1,2} 0.420505 0.230393 0.000131 1.372514 0.238354 1075.18 1288.09 1.000 alpha{3} 0.466506 0.250251 0.000727 1.455050 0.307653 1305.65 1341.51 1.000 pinvar{all} 0.998611 0.000003 0.995563 0.999999 0.999121 1116.18 1232.46 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1429.383628 Model 2: PositiveSelection -1429.383612 Model 0: one-ratio -1429.38361 Model 7: beta -1429.383628 Model 8: beta&w>1 -1429.383609 Model 0 vs 1 3.599999990910874E-5 Model 2 vs 1 3.199999991920777E-5 Model 8 vs 7 3.80000001314329E-5
>C1 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >C2 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >C3 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >C4 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >C5 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >C6 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=364 C1 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI C2 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI C3 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI C4 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI C5 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI C6 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI ************************************************** C1 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA C2 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA C3 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA C4 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA C5 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA C6 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA ************************************************** C1 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL C2 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL C3 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL C4 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL C5 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL C6 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL ************************************************** C1 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG C2 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG C3 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG C4 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG C5 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG C6 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG ************************************************** C1 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN C2 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN C3 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN C4 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN C5 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN C6 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN ************************************************** C1 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY C2 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY C3 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY C4 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY C5 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY C6 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY ************************************************** C1 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR C2 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR C3 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR C4 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR C5 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR C6 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR ************************************************** C1 GIVDDLRWINAPIN C2 GIVDDLRWINAPIN C3 GIVDDLRWINAPIN C4 GIVDDLRWINAPIN C5 GIVDDLRWINAPIN C6 GIVDDLRWINAPIN ************** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10920] Library Relaxation: Multi_proc [96] Relaxation Summary: [10920]--->[10920] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.503 Mb, Max= 30.917 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI C2 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI C3 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI C4 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI C5 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI C6 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI ************************************************** C1 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA C2 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA C3 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA C4 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA C5 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA C6 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA ************************************************** C1 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL C2 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL C3 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL C4 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL C5 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL C6 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL ************************************************** C1 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG C2 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG C3 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG C4 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG C5 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG C6 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG ************************************************** C1 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN C2 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN C3 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN C4 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN C5 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN C6 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN ************************************************** C1 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY C2 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY C3 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY C4 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY C5 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY C6 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY ************************************************** C1 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR C2 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR C3 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR C4 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR C5 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR C6 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR ************************************************** C1 GIVDDLRWINAPIN C2 GIVDDLRWINAPIN C3 GIVDDLRWINAPIN C4 GIVDDLRWINAPIN C5 GIVDDLRWINAPIN C6 GIVDDLRWINAPIN ************** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT C2 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT C3 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT C4 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT C5 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT C6 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT ************************************************** C1 GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA C2 GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA C3 GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA C4 GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA C5 GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA C6 GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA ************************************************** C1 CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC C2 CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC C3 CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC C4 CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC C5 CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC C6 CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC ************************************************** C1 GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT C2 GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT C3 GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT C4 GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT C5 GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT C6 GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT ************************************************** C1 TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC C2 TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC C3 TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC C4 TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC C5 TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC C6 TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC ************************************************** C1 CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC C2 CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC C3 CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC C4 CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC C5 CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC C6 CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC ************************************************** C1 GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC C2 GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC C3 GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC C4 GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC C5 GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC C6 GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC ************************************************** C1 CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA C2 CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA C3 CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA C4 CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA C5 CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA C6 CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA ************************************************** C1 AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG C2 AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG C3 AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG C4 AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG C5 AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG C6 AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG ************************************************** C1 AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT C2 AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT C3 AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT C4 AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT C5 AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT C6 AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT ************************************************** C1 GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA C2 GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA C3 GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA C4 GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA C5 GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA C6 GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA ************************************************** C1 CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC C2 CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC C3 CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC C4 CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC C5 CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC C6 CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC ************************************************** C1 GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC C2 GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC C3 GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC C4 GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC C5 GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC C6 GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC ************************************************** C1 CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG C2 CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG C3 CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG C4 CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG C5 CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG C6 CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG ************************************************** C1 TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT C2 TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT C3 TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT C4 TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT C5 TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT C6 TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT ************************************************** C1 AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC C2 AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC C3 AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC C4 AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC C5 AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC C6 AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ************************************************** C1 ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG C2 ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG C3 ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG C4 ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG C5 ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG C6 ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ************************************************** C1 ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC C2 ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC C3 ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC C4 ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC C5 ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC C6 ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC ************************************************** C1 GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA C2 GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA C3 GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA C4 GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA C5 GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA C6 GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA ************************************************** C1 CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA C2 CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA C3 CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA C4 CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA C5 CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA C6 CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA ************************************************** C1 TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC C2 TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC C3 TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC C4 TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC C5 TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC C6 TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC ************************************************** C1 GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT C2 GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT C3 GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT C4 GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT C5 GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT C6 GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT ****************************************** >C1 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT >C2 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT >C3 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT >C4 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT >C5 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT >C6 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT >C1 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >C2 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >C3 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >C4 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >C5 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >C6 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1092 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579788574 Setting output file names to "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 437280997 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0748271022 Seed = 1023575590 Swapseed = 1579788574 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2443.948359 -- -24.965149 Chain 2 -- -2443.947986 -- -24.965149 Chain 3 -- -2443.948359 -- -24.965149 Chain 4 -- -2443.948359 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2443.948359 -- -24.965149 Chain 2 -- -2443.948359 -- -24.965149 Chain 3 -- -2443.948359 -- -24.965149 Chain 4 -- -2443.948220 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2443.948] (-2443.948) (-2443.948) (-2443.948) * [-2443.948] (-2443.948) (-2443.948) (-2443.948) 500 -- [-1495.675] (-1507.151) (-1504.563) (-1491.256) * [-1484.080] (-1501.087) (-1482.779) (-1486.462) -- 0:00:00 1000 -- (-1481.303) (-1491.230) [-1482.591] (-1490.079) * (-1480.291) [-1484.736] (-1485.404) (-1480.402) -- 0:00:00 1500 -- [-1483.690] (-1480.918) (-1483.048) (-1497.765) * (-1479.733) (-1483.553) (-1481.863) [-1478.688] -- 0:00:00 2000 -- [-1479.412] (-1480.112) (-1484.248) (-1484.295) * (-1485.375) [-1486.199] (-1482.753) (-1482.511) -- 0:00:00 2500 -- (-1481.251) (-1480.627) (-1486.346) [-1478.278] * (-1487.450) (-1483.213) (-1479.644) [-1477.974] -- 0:00:00 3000 -- (-1482.526) (-1486.235) (-1486.261) [-1480.093] * [-1478.583] (-1477.698) (-1483.528) (-1480.488) -- 0:00:00 3500 -- (-1483.573) (-1478.288) [-1481.822] (-1479.134) * (-1481.136) [-1482.291] (-1486.101) (-1481.356) -- 0:00:00 4000 -- (-1497.498) (-1483.228) [-1488.024] (-1484.521) * (-1485.055) (-1480.569) [-1480.255] (-1486.251) -- 0:00:00 4500 -- (-1483.479) (-1477.499) (-1486.147) [-1481.644] * (-1482.726) [-1482.319] (-1480.209) (-1489.576) -- 0:00:00 5000 -- (-1492.272) [-1479.180] (-1487.350) (-1475.459) * (-1490.034) (-1482.133) (-1479.196) [-1485.594] -- 0:00:00 Average standard deviation of split frequencies: 0.091662 5500 -- [-1482.711] (-1484.838) (-1484.468) (-1484.961) * (-1480.471) [-1482.025] (-1478.291) (-1482.542) -- 0:00:00 6000 -- (-1480.961) (-1479.647) [-1491.089] (-1477.743) * (-1486.030) (-1491.876) [-1483.370] (-1478.329) -- 0:00:00 6500 -- (-1489.222) [-1477.297] (-1490.571) (-1484.236) * (-1484.209) [-1479.687] (-1480.293) (-1478.934) -- 0:00:00 7000 -- [-1481.023] (-1481.447) (-1473.398) (-1482.008) * (-1475.975) (-1493.798) [-1479.426] (-1483.632) -- 0:02:21 7500 -- [-1485.329] (-1478.869) (-1472.302) (-1479.954) * [-1479.572] (-1498.335) (-1478.987) (-1480.441) -- 0:02:12 8000 -- (-1490.926) (-1487.733) (-1474.268) [-1478.898] * (-1486.453) (-1485.552) [-1480.819] (-1480.303) -- 0:02:04 8500 -- (-1482.841) [-1485.032] (-1474.424) (-1483.084) * [-1480.889] (-1484.970) (-1479.614) (-1481.522) -- 0:01:56 9000 -- (-1483.469) [-1479.725] (-1473.161) (-1477.059) * [-1482.920] (-1486.217) (-1482.120) (-1478.771) -- 0:01:50 9500 -- [-1481.760] (-1489.167) (-1475.898) (-1478.929) * (-1484.803) [-1480.062] (-1490.156) (-1480.357) -- 0:01:44 10000 -- (-1480.238) [-1492.022] (-1472.784) (-1482.113) * (-1480.781) (-1483.103) (-1483.249) [-1485.944] -- 0:01:39 Average standard deviation of split frequencies: 0.067344 10500 -- [-1479.803] (-1483.213) (-1473.877) (-1482.346) * (-1477.798) [-1483.229] (-1484.600) (-1487.450) -- 0:01:34 11000 -- (-1478.732) [-1478.795] (-1472.431) (-1482.611) * (-1482.810) [-1480.549] (-1481.396) (-1489.681) -- 0:01:29 11500 -- [-1483.279] (-1481.996) (-1472.632) (-1482.262) * (-1481.391) [-1486.694] (-1485.620) (-1483.672) -- 0:01:25 12000 -- (-1481.264) [-1477.979] (-1472.649) (-1487.026) * (-1477.282) [-1484.416] (-1480.321) (-1483.742) -- 0:01:22 12500 -- (-1478.524) (-1478.478) (-1474.583) [-1481.080] * (-1484.415) (-1486.935) [-1476.658] (-1479.869) -- 0:01:19 13000 -- (-1479.852) (-1494.862) (-1473.038) [-1479.059] * (-1494.860) (-1483.610) [-1473.880] (-1486.438) -- 0:01:15 13500 -- (-1479.298) [-1489.115] (-1474.144) (-1490.002) * (-1487.442) (-1481.203) [-1473.999] (-1480.414) -- 0:01:13 14000 -- (-1477.903) (-1484.124) [-1472.229] (-1479.743) * [-1488.739] (-1487.018) (-1474.811) (-1479.322) -- 0:01:10 14500 -- (-1487.585) (-1487.020) (-1472.258) [-1482.158] * [-1483.063] (-1479.734) (-1474.727) (-1482.267) -- 0:01:07 15000 -- (-1494.001) (-1486.499) [-1472.441] (-1487.445) * [-1480.796] (-1484.732) (-1474.256) (-1484.080) -- 0:01:05 Average standard deviation of split frequencies: 0.049105 15500 -- [-1478.349] (-1479.729) (-1474.725) (-1486.553) * (-1482.516) (-1483.412) [-1475.244] (-1486.781) -- 0:01:03 16000 -- [-1481.791] (-1481.346) (-1475.105) (-1496.085) * (-1481.943) (-1486.820) [-1474.446] (-1487.559) -- 0:01:01 16500 -- [-1482.340] (-1484.364) (-1471.831) (-1486.182) * (-1485.353) [-1476.562] (-1475.299) (-1482.428) -- 0:00:59 17000 -- (-1486.458) (-1489.286) [-1473.242] (-1477.975) * [-1478.051] (-1483.743) (-1474.994) (-1482.459) -- 0:00:57 17500 -- [-1481.637] (-1491.063) (-1472.727) (-1488.237) * [-1482.021] (-1491.794) (-1473.332) (-1485.016) -- 0:00:56 18000 -- (-1482.728) (-1474.928) (-1473.018) [-1479.436] * [-1489.560] (-1481.290) (-1475.977) (-1482.738) -- 0:00:54 18500 -- [-1480.039] (-1473.505) (-1475.885) (-1483.313) * (-1483.633) (-1487.994) (-1472.351) [-1481.722] -- 0:00:53 19000 -- (-1488.258) (-1473.280) (-1474.944) [-1488.288] * (-1478.311) [-1481.979] (-1473.107) (-1483.039) -- 0:00:51 19500 -- (-1490.654) (-1472.717) [-1473.787] (-1482.225) * (-1491.354) (-1487.184) (-1475.978) [-1482.879] -- 0:00:50 20000 -- [-1482.086] (-1473.287) (-1476.560) (-1482.012) * (-1485.854) [-1484.051] (-1476.030) (-1483.556) -- 0:00:49 Average standard deviation of split frequencies: 0.053223 20500 -- (-1481.134) (-1472.838) (-1476.675) [-1481.077] * (-1488.017) (-1490.437) (-1472.663) [-1478.403] -- 0:00:47 21000 -- (-1486.932) (-1472.172) [-1479.049] (-1479.939) * (-1488.279) (-1472.595) [-1474.129] (-1481.940) -- 0:01:33 21500 -- [-1481.987] (-1472.808) (-1481.886) (-1485.684) * (-1478.971) (-1472.407) [-1475.183] (-1485.104) -- 0:01:31 22000 -- [-1478.442] (-1473.275) (-1474.945) (-1479.981) * [-1473.860] (-1472.131) (-1475.879) (-1480.648) -- 0:01:28 22500 -- [-1482.714] (-1475.760) (-1474.959) (-1484.211) * (-1474.849) (-1473.752) (-1477.475) [-1487.378] -- 0:01:26 23000 -- (-1481.450) [-1477.580] (-1472.867) (-1489.062) * [-1476.695] (-1472.921) (-1474.219) (-1485.344) -- 0:01:24 23500 -- (-1482.489) (-1472.171) (-1472.979) [-1478.834] * [-1473.824] (-1474.481) (-1474.818) (-1489.269) -- 0:01:23 24000 -- (-1488.665) (-1471.841) [-1473.334] (-1486.065) * [-1472.603] (-1473.425) (-1473.109) (-1488.005) -- 0:01:21 24500 -- [-1478.446] (-1476.886) (-1474.808) (-1482.197) * (-1475.140) [-1474.280] (-1477.870) (-1481.184) -- 0:01:19 25000 -- [-1489.781] (-1475.328) (-1476.371) (-1489.427) * [-1473.830] (-1476.091) (-1478.122) (-1479.991) -- 0:01:18 Average standard deviation of split frequencies: 0.044896 25500 -- [-1483.545] (-1472.199) (-1478.612) (-1485.619) * [-1477.590] (-1478.042) (-1477.040) (-1480.950) -- 0:01:16 26000 -- (-1479.124) (-1472.642) (-1475.066) [-1479.181] * [-1475.047] (-1473.026) (-1476.144) (-1483.428) -- 0:01:14 26500 -- [-1479.398] (-1472.906) (-1475.202) (-1481.447) * (-1474.560) (-1471.776) (-1474.963) [-1486.134] -- 0:01:13 27000 -- (-1483.230) (-1473.667) (-1475.909) [-1480.031] * (-1474.570) (-1475.200) [-1473.694] (-1479.487) -- 0:01:12 27500 -- (-1487.409) [-1473.050] (-1474.382) (-1481.061) * (-1474.469) (-1472.497) (-1474.108) [-1483.111] -- 0:01:10 28000 -- (-1479.267) (-1473.977) (-1474.071) [-1483.741] * [-1474.989] (-1474.472) (-1474.269) (-1481.612) -- 0:01:09 28500 -- [-1482.569] (-1472.607) (-1472.858) (-1480.303) * (-1479.201) (-1473.368) [-1473.260] (-1477.820) -- 0:01:08 29000 -- (-1485.446) (-1473.671) (-1471.874) [-1483.628] * [-1473.202] (-1474.202) (-1476.895) (-1482.641) -- 0:01:06 29500 -- (-1484.072) [-1472.752] (-1471.898) (-1483.558) * (-1472.592) (-1476.007) [-1476.595] (-1487.910) -- 0:01:05 30000 -- [-1481.810] (-1473.216) (-1473.555) (-1481.529) * (-1472.859) (-1474.346) [-1473.696] (-1480.586) -- 0:01:04 Average standard deviation of split frequencies: 0.051496 30500 -- [-1482.219] (-1476.758) (-1473.334) (-1486.094) * (-1472.540) (-1474.888) [-1474.610] (-1477.497) -- 0:01:03 31000 -- (-1482.060) (-1475.112) (-1472.867) [-1479.985] * (-1473.008) (-1474.681) [-1475.756] (-1483.911) -- 0:01:02 31500 -- (-1480.179) (-1477.178) (-1474.106) [-1475.496] * [-1472.896] (-1473.327) (-1477.567) (-1480.893) -- 0:01:01 32000 -- [-1481.147] (-1474.676) (-1473.952) (-1491.548) * [-1474.634] (-1474.086) (-1473.008) (-1484.704) -- 0:01:00 32500 -- [-1484.570] (-1474.109) (-1475.968) (-1484.505) * (-1473.902) [-1474.346] (-1475.057) (-1486.180) -- 0:00:59 33000 -- [-1483.771] (-1472.902) (-1473.185) (-1489.814) * (-1474.265) [-1472.184] (-1473.149) (-1481.421) -- 0:00:58 33500 -- (-1478.427) [-1475.747] (-1473.135) (-1490.264) * (-1472.685) [-1472.593] (-1472.825) (-1484.842) -- 0:00:57 34000 -- [-1483.343] (-1473.294) (-1472.573) (-1481.620) * (-1474.502) (-1472.326) [-1472.966] (-1481.776) -- 0:00:56 34500 -- (-1477.380) [-1473.366] (-1472.245) (-1480.107) * (-1474.994) [-1472.709] (-1473.562) (-1480.203) -- 0:00:55 35000 -- (-1485.681) (-1474.184) (-1472.522) [-1477.961] * (-1473.975) [-1472.547] (-1472.090) (-1480.027) -- 0:00:55 Average standard deviation of split frequencies: 0.040593 35500 -- (-1485.883) (-1477.747) (-1476.388) [-1480.476] * (-1476.776) [-1472.352] (-1473.925) (-1486.637) -- 0:01:21 36000 -- (-1480.058) (-1479.425) (-1474.731) [-1481.799] * (-1476.002) (-1472.622) [-1475.356] (-1485.542) -- 0:01:20 36500 -- [-1481.498] (-1474.742) (-1471.964) (-1489.815) * (-1476.081) (-1472.406) [-1472.558] (-1484.995) -- 0:01:19 37000 -- (-1483.608) (-1475.432) [-1472.980] (-1479.495) * [-1478.066] (-1474.114) (-1473.276) (-1485.766) -- 0:01:18 37500 -- [-1477.878] (-1473.216) (-1475.667) (-1487.590) * [-1478.528] (-1473.217) (-1472.738) (-1484.299) -- 0:01:17 38000 -- (-1481.156) [-1474.518] (-1473.741) (-1482.859) * [-1474.431] (-1474.875) (-1478.037) (-1476.300) -- 0:01:15 38500 -- [-1485.884] (-1475.071) (-1473.213) (-1481.716) * (-1472.190) (-1473.201) (-1482.797) [-1473.407] -- 0:01:14 39000 -- (-1484.275) [-1473.683] (-1473.115) (-1481.405) * (-1473.180) (-1478.736) (-1477.994) [-1472.650] -- 0:01:13 39500 -- [-1479.515] (-1473.031) (-1472.906) (-1484.690) * (-1478.332) (-1478.948) (-1478.502) [-1473.476] -- 0:01:12 40000 -- [-1476.587] (-1473.948) (-1474.492) (-1479.110) * (-1477.144) (-1474.150) (-1474.177) [-1474.707] -- 0:01:12 Average standard deviation of split frequencies: 0.038436 40500 -- (-1489.805) [-1475.867] (-1473.061) (-1476.635) * [-1474.595] (-1473.328) (-1472.758) (-1472.984) -- 0:01:11 41000 -- (-1486.023) [-1476.424] (-1473.711) (-1480.460) * (-1474.021) (-1474.722) [-1472.877] (-1472.413) -- 0:01:10 41500 -- (-1480.787) (-1471.711) [-1473.024] (-1491.057) * (-1473.403) (-1475.951) [-1473.207] (-1472.249) -- 0:01:09 42000 -- (-1490.274) (-1475.339) (-1473.540) [-1476.927] * (-1475.224) (-1478.819) [-1472.780] (-1471.804) -- 0:01:08 42500 -- (-1481.310) [-1476.175] (-1473.261) (-1487.285) * (-1476.047) [-1472.677] (-1475.370) (-1474.158) -- 0:01:07 43000 -- (-1479.657) (-1475.388) (-1476.107) [-1481.521] * (-1476.054) (-1472.573) (-1473.179) [-1473.373] -- 0:01:06 43500 -- (-1480.460) [-1474.583] (-1475.752) (-1480.588) * (-1473.529) (-1474.928) (-1475.356) [-1473.341] -- 0:01:05 44000 -- (-1490.587) (-1472.465) (-1474.627) [-1487.586] * (-1472.128) [-1474.905] (-1477.420) (-1473.411) -- 0:01:05 44500 -- (-1478.835) [-1472.440] (-1475.437) (-1480.308) * (-1475.243) (-1475.450) (-1474.376) [-1472.258] -- 0:01:04 45000 -- (-1483.837) (-1472.478) (-1475.385) [-1483.843] * (-1472.002) [-1473.178] (-1474.963) (-1472.294) -- 0:01:03 Average standard deviation of split frequencies: 0.031769 45500 -- (-1477.810) [-1474.687] (-1476.271) (-1492.163) * (-1472.795) (-1473.981) (-1475.833) [-1473.126] -- 0:01:02 46000 -- (-1488.597) (-1478.255) [-1475.540] (-1494.580) * (-1473.097) (-1472.605) (-1475.122) [-1472.338] -- 0:01:02 46500 -- [-1482.730] (-1473.779) (-1476.760) (-1486.180) * (-1473.144) [-1472.553] (-1472.800) (-1471.872) -- 0:01:01 47000 -- (-1480.857) [-1473.655] (-1475.623) (-1485.423) * (-1472.728) [-1472.677] (-1472.540) (-1474.017) -- 0:01:00 47500 -- (-1480.550) (-1473.880) (-1474.404) [-1478.431] * (-1473.669) [-1472.803] (-1473.061) (-1473.906) -- 0:01:00 48000 -- (-1489.260) (-1475.943) (-1473.504) [-1480.733] * [-1474.274] (-1475.476) (-1472.827) (-1471.892) -- 0:00:59 48500 -- [-1485.007] (-1474.398) (-1474.104) (-1483.686) * (-1472.579) [-1473.136] (-1472.710) (-1472.189) -- 0:00:58 49000 -- (-1488.825) (-1472.618) [-1473.572] (-1486.880) * [-1472.359] (-1473.251) (-1475.082) (-1472.536) -- 0:00:58 49500 -- [-1480.053] (-1473.529) (-1474.391) (-1480.412) * (-1473.692) (-1472.873) [-1473.931] (-1472.707) -- 0:00:57 50000 -- (-1481.668) (-1476.086) (-1473.029) [-1482.597] * (-1475.512) (-1473.401) [-1473.499] (-1473.223) -- 0:01:16 Average standard deviation of split frequencies: 0.027422 50500 -- (-1493.144) [-1475.905] (-1472.776) (-1480.573) * (-1472.229) [-1474.120] (-1473.632) (-1472.841) -- 0:01:15 51000 -- (-1492.065) (-1472.743) [-1472.505] (-1487.251) * (-1474.843) [-1471.919] (-1474.717) (-1473.814) -- 0:01:14 51500 -- (-1485.331) [-1472.730] (-1473.026) (-1485.080) * (-1473.998) (-1472.215) [-1474.265] (-1472.969) -- 0:01:13 52000 -- (-1483.975) (-1472.908) (-1471.947) [-1480.507] * (-1478.956) [-1473.257] (-1473.946) (-1476.043) -- 0:01:12 52500 -- [-1480.465] (-1473.754) (-1472.367) (-1480.592) * (-1478.819) (-1477.958) (-1476.365) [-1475.144] -- 0:01:12 53000 -- (-1484.906) (-1472.770) (-1473.951) [-1482.676] * [-1475.540] (-1474.351) (-1476.033) (-1473.843) -- 0:01:11 53500 -- (-1482.361) (-1473.500) (-1473.056) [-1471.953] * (-1471.909) (-1473.643) (-1473.629) [-1474.694] -- 0:01:10 54000 -- (-1486.917) (-1474.104) [-1472.638] (-1476.432) * (-1471.949) (-1473.681) [-1474.129] (-1474.646) -- 0:01:10 54500 -- (-1485.887) (-1473.600) (-1472.470) [-1475.328] * [-1474.792] (-1474.397) (-1474.138) (-1474.783) -- 0:01:09 55000 -- [-1478.814] (-1474.708) (-1473.635) (-1474.712) * (-1473.832) [-1473.978] (-1472.791) (-1478.070) -- 0:01:08 Average standard deviation of split frequencies: 0.023851 55500 -- (-1481.927) (-1476.736) (-1473.606) [-1474.706] * (-1474.022) (-1475.213) (-1475.311) [-1474.746] -- 0:01:08 56000 -- [-1477.385] (-1476.374) (-1473.871) (-1473.918) * [-1475.076] (-1473.798) (-1473.829) (-1473.184) -- 0:01:07 56500 -- (-1482.941) [-1472.283] (-1473.059) (-1473.763) * (-1475.186) [-1475.368] (-1474.632) (-1473.218) -- 0:01:06 57000 -- (-1479.584) [-1471.986] (-1473.827) (-1471.989) * (-1477.583) [-1473.224] (-1471.873) (-1475.911) -- 0:01:06 57500 -- (-1483.374) (-1472.304) (-1472.241) [-1474.576] * [-1472.357] (-1472.442) (-1472.595) (-1476.463) -- 0:01:05 58000 -- [-1481.968] (-1475.170) (-1473.564) (-1475.467) * (-1473.055) (-1473.024) (-1472.405) [-1473.443] -- 0:01:04 58500 -- (-1479.547) (-1473.720) (-1473.512) [-1473.010] * (-1473.163) (-1474.966) [-1472.204] (-1473.629) -- 0:01:04 59000 -- (-1480.073) (-1473.375) (-1472.767) [-1474.911] * [-1473.571] (-1472.453) (-1476.039) (-1477.825) -- 0:01:03 59500 -- [-1482.923] (-1473.172) (-1473.370) (-1472.832) * (-1474.778) (-1474.007) (-1474.319) [-1476.160] -- 0:01:03 60000 -- (-1482.547) (-1473.817) [-1474.680] (-1475.797) * (-1473.015) (-1475.653) (-1473.479) [-1474.314] -- 0:01:02 Average standard deviation of split frequencies: 0.031539 60500 -- (-1479.307) (-1476.621) (-1472.897) [-1475.652] * (-1475.786) [-1477.591] (-1477.580) (-1473.190) -- 0:01:02 61000 -- (-1488.658) (-1473.707) [-1473.642] (-1473.262) * [-1473.307] (-1475.461) (-1472.387) (-1471.791) -- 0:01:01 61500 -- (-1487.473) (-1477.119) [-1473.550] (-1477.656) * [-1472.283] (-1473.232) (-1473.166) (-1472.985) -- 0:01:01 62000 -- [-1480.679] (-1476.606) (-1472.604) (-1473.160) * [-1473.621] (-1473.544) (-1472.424) (-1472.668) -- 0:01:00 62500 -- (-1490.242) [-1476.090] (-1474.190) (-1473.152) * [-1472.682] (-1475.855) (-1473.387) (-1473.313) -- 0:01:00 63000 -- (-1481.708) (-1476.971) [-1472.116] (-1474.432) * (-1473.030) (-1472.968) [-1472.656] (-1474.970) -- 0:00:59 63500 -- (-1484.727) [-1473.711] (-1472.569) (-1474.307) * [-1473.112] (-1471.901) (-1473.487) (-1474.733) -- 0:00:58 64000 -- (-1480.370) (-1473.926) [-1474.033] (-1477.752) * (-1475.980) [-1473.298] (-1473.695) (-1473.132) -- 0:00:58 64500 -- [-1476.855] (-1476.136) (-1473.316) (-1475.211) * [-1472.513] (-1476.500) (-1473.285) (-1474.510) -- 0:01:12 65000 -- [-1485.325] (-1473.933) (-1474.829) (-1476.332) * (-1474.630) (-1476.904) (-1471.670) [-1474.183] -- 0:01:11 Average standard deviation of split frequencies: 0.030074 65500 -- (-1480.815) (-1472.960) [-1474.122] (-1472.274) * (-1476.839) (-1475.162) [-1473.809] (-1473.170) -- 0:01:11 66000 -- (-1481.655) (-1472.971) [-1474.645] (-1473.272) * (-1473.483) (-1480.136) [-1472.830] (-1474.222) -- 0:01:10 66500 -- (-1479.204) (-1473.253) (-1477.316) [-1472.825] * (-1473.201) [-1481.881] (-1475.621) (-1473.770) -- 0:01:10 67000 -- (-1482.164) (-1474.784) (-1475.913) [-1473.040] * (-1473.834) (-1484.038) [-1472.297] (-1473.299) -- 0:01:09 67500 -- (-1483.774) (-1474.183) [-1473.356] (-1472.914) * [-1473.567] (-1473.914) (-1471.588) (-1472.845) -- 0:01:09 68000 -- (-1487.781) [-1472.548] (-1474.045) (-1474.205) * (-1473.201) (-1474.081) (-1472.787) [-1472.844] -- 0:01:08 68500 -- (-1481.850) (-1473.409) (-1474.932) [-1473.470] * [-1472.886] (-1473.430) (-1473.399) (-1474.731) -- 0:01:07 69000 -- (-1482.421) (-1471.879) [-1474.982] (-1473.174) * (-1472.917) [-1474.090] (-1474.496) (-1473.922) -- 0:01:07 69500 -- (-1486.096) [-1473.127] (-1477.764) (-1473.548) * [-1472.521] (-1477.379) (-1475.350) (-1472.788) -- 0:01:06 70000 -- [-1483.148] (-1473.145) (-1479.058) (-1474.780) * [-1474.941] (-1474.943) (-1476.329) (-1473.480) -- 0:01:06 Average standard deviation of split frequencies: 0.021974 70500 -- (-1494.985) [-1471.898] (-1474.677) (-1473.819) * (-1472.573) (-1474.049) [-1478.027] (-1474.952) -- 0:01:05 71000 -- [-1482.155] (-1474.873) (-1476.072) (-1472.868) * (-1474.339) (-1474.672) [-1475.120] (-1480.499) -- 0:01:05 71500 -- [-1481.159] (-1473.905) (-1477.851) (-1472.121) * (-1478.695) (-1474.945) (-1477.099) [-1477.866] -- 0:01:04 72000 -- [-1488.402] (-1472.017) (-1477.467) (-1473.429) * (-1482.207) (-1475.088) [-1472.472] (-1476.410) -- 0:01:04 72500 -- (-1478.674) (-1472.567) (-1475.335) [-1472.191] * (-1477.924) (-1478.355) (-1474.813) [-1476.059] -- 0:01:03 73000 -- (-1487.706) [-1476.395] (-1474.333) (-1474.817) * (-1472.760) [-1476.498] (-1474.948) (-1478.422) -- 0:01:03 73500 -- (-1483.322) (-1472.480) (-1474.710) [-1473.660] * [-1474.282] (-1474.082) (-1475.441) (-1473.040) -- 0:01:03 74000 -- (-1494.635) [-1476.101] (-1474.717) (-1472.957) * (-1475.668) (-1478.086) [-1475.286] (-1472.806) -- 0:01:02 74500 -- (-1484.160) (-1478.239) (-1475.359) [-1472.965] * (-1473.991) (-1480.974) [-1473.859] (-1473.712) -- 0:01:02 75000 -- (-1483.149) [-1473.532] (-1476.892) (-1472.915) * (-1473.568) [-1477.631] (-1473.969) (-1473.476) -- 0:01:01 Average standard deviation of split frequencies: 0.024122 75500 -- (-1491.017) [-1472.682] (-1477.275) (-1475.569) * (-1472.386) (-1474.400) [-1474.081] (-1472.744) -- 0:01:01 76000 -- (-1492.812) (-1472.644) (-1476.514) [-1473.533] * (-1475.899) (-1478.567) (-1473.982) [-1472.016] -- 0:01:00 76500 -- (-1489.636) (-1478.285) (-1474.682) [-1473.306] * (-1474.336) (-1474.333) (-1473.183) [-1471.631] -- 0:01:00 77000 -- (-1478.818) (-1475.871) (-1472.455) [-1476.517] * (-1473.302) (-1474.640) (-1475.435) [-1471.631] -- 0:00:59 77500 -- (-1482.136) (-1472.783) [-1472.272] (-1475.400) * [-1472.551] (-1473.605) (-1478.451) (-1472.643) -- 0:00:59 78000 -- [-1487.509] (-1473.429) (-1473.205) (-1477.467) * (-1474.097) [-1476.523] (-1474.427) (-1476.454) -- 0:00:59 78500 -- (-1481.833) (-1474.022) (-1473.849) [-1473.833] * (-1477.895) (-1476.449) [-1472.758] (-1472.172) -- 0:00:58 79000 -- (-1480.435) (-1474.598) (-1473.370) [-1474.167] * [-1472.971] (-1475.287) (-1472.411) (-1472.877) -- 0:00:58 79500 -- (-1482.100) [-1472.864] (-1471.812) (-1474.351) * [-1472.958] (-1475.660) (-1473.157) (-1473.243) -- 0:00:57 80000 -- (-1474.745) (-1474.539) (-1472.644) [-1474.033] * (-1472.974) (-1474.364) [-1472.063] (-1473.332) -- 0:00:57 Average standard deviation of split frequencies: 0.024298 80500 -- (-1474.469) [-1474.768] (-1477.840) (-1473.616) * (-1475.909) [-1474.293] (-1475.774) (-1476.007) -- 0:01:08 81000 -- (-1474.553) [-1473.746] (-1473.612) (-1473.586) * (-1475.183) (-1475.718) (-1480.047) [-1476.908] -- 0:01:08 81500 -- (-1474.497) [-1473.127] (-1472.995) (-1472.092) * [-1472.970] (-1474.671) (-1476.057) (-1476.948) -- 0:01:07 82000 -- [-1475.042] (-1472.063) (-1474.220) (-1473.927) * (-1473.899) [-1471.922] (-1473.427) (-1474.518) -- 0:01:07 82500 -- (-1474.315) [-1471.929] (-1473.850) (-1472.865) * (-1473.385) (-1476.415) (-1473.978) [-1474.759] -- 0:01:06 83000 -- (-1476.361) (-1473.391) (-1472.864) [-1474.213] * (-1472.197) (-1476.651) [-1471.874] (-1473.098) -- 0:01:06 83500 -- (-1477.137) (-1474.318) [-1471.734] (-1474.482) * (-1472.410) [-1474.889] (-1473.225) (-1471.754) -- 0:01:05 84000 -- (-1476.129) [-1474.648] (-1471.740) (-1473.282) * [-1473.125] (-1474.288) (-1480.947) (-1471.811) -- 0:01:05 84500 -- (-1474.132) (-1474.800) [-1471.793] (-1477.231) * (-1472.979) (-1475.013) (-1475.915) [-1475.062] -- 0:01:05 85000 -- (-1474.355) (-1473.648) [-1473.318] (-1477.578) * [-1471.801] (-1474.229) (-1476.807) (-1475.362) -- 0:01:04 Average standard deviation of split frequencies: 0.025763 85500 -- (-1473.940) (-1473.214) [-1471.605] (-1472.563) * [-1472.553] (-1474.705) (-1477.224) (-1471.834) -- 0:01:04 86000 -- (-1474.746) (-1474.136) [-1471.642] (-1473.967) * (-1473.011) (-1472.998) (-1482.368) [-1474.504] -- 0:01:03 86500 -- (-1472.753) (-1472.992) (-1472.532) [-1476.479] * [-1472.348] (-1473.055) (-1474.458) (-1473.858) -- 0:01:03 87000 -- (-1476.015) (-1472.902) [-1472.012] (-1475.864) * (-1473.656) (-1473.046) [-1473.358] (-1473.660) -- 0:01:02 87500 -- (-1476.486) (-1472.181) [-1474.315] (-1478.392) * (-1472.419) [-1474.052] (-1478.081) (-1475.956) -- 0:01:02 88000 -- [-1473.369] (-1472.369) (-1476.698) (-1474.646) * [-1472.525] (-1475.231) (-1473.911) (-1476.032) -- 0:01:02 88500 -- (-1472.092) [-1472.739] (-1476.613) (-1474.209) * (-1474.481) [-1472.469] (-1473.029) (-1474.930) -- 0:01:01 89000 -- (-1472.480) [-1473.403] (-1471.846) (-1473.473) * [-1475.724] (-1473.172) (-1473.833) (-1472.556) -- 0:01:01 89500 -- (-1473.095) [-1474.298] (-1472.259) (-1474.794) * [-1474.577] (-1472.806) (-1472.405) (-1473.191) -- 0:01:01 90000 -- (-1472.693) [-1473.237] (-1474.040) (-1474.149) * (-1472.528) [-1472.497] (-1473.015) (-1473.239) -- 0:01:00 Average standard deviation of split frequencies: 0.027036 90500 -- [-1476.119] (-1474.476) (-1472.227) (-1474.755) * [-1472.572] (-1472.546) (-1472.961) (-1472.811) -- 0:01:00 91000 -- [-1473.341] (-1472.768) (-1472.227) (-1473.636) * (-1473.118) (-1472.788) [-1476.440] (-1474.603) -- 0:00:59 91500 -- (-1472.815) (-1472.062) (-1474.434) [-1474.917] * (-1473.520) (-1472.432) (-1476.723) [-1473.426] -- 0:00:59 92000 -- (-1471.960) (-1472.193) (-1474.062) [-1474.816] * (-1475.021) (-1473.337) (-1472.317) [-1474.277] -- 0:00:59 92500 -- (-1471.651) [-1473.943] (-1474.228) (-1474.779) * (-1475.600) (-1473.278) [-1472.251] (-1472.624) -- 0:00:58 93000 -- [-1471.696] (-1478.260) (-1471.757) (-1475.999) * (-1475.107) (-1473.222) (-1472.152) [-1472.846] -- 0:00:58 93500 -- (-1472.577) (-1473.920) (-1472.606) [-1476.255] * [-1477.398] (-1474.107) (-1472.755) (-1475.437) -- 0:00:58 94000 -- (-1472.600) [-1473.919] (-1472.440) (-1475.699) * [-1476.086] (-1473.754) (-1471.938) (-1474.133) -- 0:00:57 94500 -- (-1473.541) (-1473.386) (-1473.934) [-1472.845] * (-1474.823) [-1473.739] (-1471.890) (-1473.424) -- 0:00:57 95000 -- (-1472.919) (-1473.752) (-1473.905) [-1471.719] * [-1472.052] (-1474.414) (-1473.917) (-1472.832) -- 0:00:57 Average standard deviation of split frequencies: 0.024552 95500 -- (-1471.923) (-1474.768) (-1475.049) [-1472.036] * [-1472.677] (-1473.840) (-1472.201) (-1476.559) -- 0:00:56 96000 -- [-1473.053] (-1472.512) (-1474.072) (-1474.002) * (-1473.948) [-1473.861] (-1472.111) (-1473.779) -- 0:00:56 96500 -- [-1475.284] (-1473.164) (-1476.671) (-1471.729) * [-1472.461] (-1473.767) (-1472.588) (-1473.405) -- 0:01:05 97000 -- (-1475.358) (-1474.057) [-1472.811] (-1474.694) * [-1472.753] (-1472.778) (-1473.836) (-1473.106) -- 0:01:05 97500 -- [-1474.229] (-1472.708) (-1473.220) (-1473.243) * (-1475.818) [-1472.468] (-1472.429) (-1472.590) -- 0:01:04 98000 -- (-1473.463) (-1473.805) [-1473.766] (-1473.458) * (-1477.261) (-1473.014) [-1472.012] (-1475.543) -- 0:01:04 98500 -- (-1474.182) [-1472.958] (-1473.456) (-1474.882) * (-1475.212) [-1472.227] (-1473.261) (-1472.820) -- 0:01:04 99000 -- [-1473.333] (-1472.863) (-1479.147) (-1473.635) * (-1475.628) [-1471.739] (-1472.221) (-1473.877) -- 0:01:03 99500 -- (-1475.348) (-1476.702) [-1472.592] (-1475.330) * (-1473.220) (-1473.597) [-1473.396] (-1474.292) -- 0:01:03 100000 -- [-1473.341] (-1474.023) (-1476.110) (-1475.046) * (-1473.962) (-1475.335) [-1473.446] (-1472.846) -- 0:01:02 Average standard deviation of split frequencies: 0.026125 100500 -- (-1473.431) [-1472.585] (-1477.183) (-1473.263) * (-1473.165) (-1474.078) [-1472.331] (-1473.331) -- 0:01:02 101000 -- [-1474.357] (-1475.955) (-1476.084) (-1472.484) * (-1473.850) (-1473.048) [-1472.714] (-1473.331) -- 0:01:02 101500 -- (-1474.815) (-1475.360) (-1475.709) [-1472.610] * (-1473.389) (-1473.085) [-1473.257] (-1473.468) -- 0:01:01 102000 -- (-1474.458) (-1473.858) (-1475.379) [-1473.055] * (-1476.168) [-1473.023] (-1472.334) (-1473.486) -- 0:01:01 102500 -- (-1475.074) (-1474.006) [-1473.802] (-1472.817) * [-1475.277] (-1473.998) (-1473.911) (-1473.975) -- 0:01:01 103000 -- (-1475.884) (-1473.806) [-1472.920] (-1475.670) * (-1475.660) (-1474.692) [-1474.868] (-1478.713) -- 0:01:00 103500 -- (-1473.328) [-1474.540] (-1473.688) (-1473.499) * (-1475.485) (-1473.511) (-1473.043) [-1472.765] -- 0:01:00 104000 -- [-1472.622] (-1478.045) (-1473.549) (-1472.877) * (-1475.171) (-1472.904) [-1472.568] (-1475.576) -- 0:01:00 104500 -- [-1472.281] (-1475.906) (-1477.724) (-1471.849) * (-1474.345) (-1474.944) (-1473.707) [-1472.552] -- 0:00:59 105000 -- [-1472.094] (-1474.337) (-1476.544) (-1472.710) * (-1474.119) (-1474.942) [-1473.089] (-1472.734) -- 0:00:59 Average standard deviation of split frequencies: 0.023651 105500 -- [-1472.465] (-1474.004) (-1478.393) (-1473.024) * (-1474.025) [-1473.024] (-1475.805) (-1473.579) -- 0:00:59 106000 -- (-1471.771) [-1472.955] (-1474.135) (-1474.068) * (-1472.170) (-1473.326) (-1477.855) [-1476.911] -- 0:00:59 106500 -- (-1474.772) (-1474.395) [-1474.651] (-1473.731) * (-1472.896) (-1473.943) (-1477.020) [-1472.755] -- 0:00:58 107000 -- (-1474.772) [-1471.888] (-1474.994) (-1474.250) * (-1473.423) (-1475.455) (-1472.084) [-1472.894] -- 0:00:58 107500 -- (-1472.458) (-1479.732) (-1473.845) [-1474.448] * [-1473.865] (-1473.634) (-1476.080) (-1474.118) -- 0:00:58 108000 -- (-1475.544) (-1473.219) [-1472.235] (-1473.836) * (-1475.133) (-1472.705) [-1472.006] (-1474.103) -- 0:00:57 108500 -- (-1473.108) [-1472.837] (-1478.041) (-1474.821) * (-1473.534) [-1473.178] (-1472.960) (-1477.829) -- 0:00:57 109000 -- [-1473.930] (-1474.275) (-1476.204) (-1474.140) * [-1472.028] (-1473.688) (-1473.290) (-1477.162) -- 0:00:57 109500 -- (-1474.203) (-1474.759) [-1474.583] (-1473.905) * (-1473.456) (-1473.552) [-1472.832] (-1476.027) -- 0:00:56 110000 -- (-1472.898) (-1474.581) [-1473.235] (-1474.472) * (-1472.866) (-1474.057) (-1473.189) [-1476.790] -- 0:00:56 Average standard deviation of split frequencies: 0.021937 110500 -- (-1477.303) [-1474.555] (-1472.775) (-1473.384) * (-1471.716) [-1473.827] (-1474.055) (-1475.285) -- 0:00:56 111000 -- (-1475.800) (-1476.186) (-1473.675) [-1472.301] * (-1471.652) (-1472.409) [-1476.553] (-1474.969) -- 0:00:56 111500 -- (-1473.660) (-1473.694) [-1473.090] (-1474.536) * (-1472.756) [-1472.497] (-1482.942) (-1479.361) -- 0:00:55 112000 -- (-1476.816) (-1474.064) [-1473.364] (-1474.236) * (-1473.385) [-1472.600] (-1477.373) (-1477.014) -- 0:00:55 112500 -- (-1478.317) (-1473.857) (-1472.377) [-1473.023] * (-1474.647) (-1475.001) [-1476.769] (-1477.313) -- 0:01:03 113000 -- (-1475.780) (-1476.517) [-1472.636] (-1473.542) * [-1472.630] (-1478.252) (-1475.792) (-1479.912) -- 0:01:02 113500 -- (-1475.386) (-1473.893) (-1472.843) [-1474.097] * (-1471.847) (-1475.496) [-1474.428] (-1478.071) -- 0:01:02 114000 -- (-1472.824) [-1473.492] (-1472.354) (-1473.887) * (-1471.883) (-1474.037) [-1475.176] (-1477.865) -- 0:01:02 114500 -- [-1472.155] (-1473.120) (-1475.460) (-1474.185) * (-1471.908) [-1477.448] (-1475.473) (-1473.542) -- 0:01:01 115000 -- (-1473.139) (-1472.081) [-1474.011] (-1475.356) * [-1474.015] (-1482.181) (-1475.524) (-1473.502) -- 0:01:01 Average standard deviation of split frequencies: 0.022148 115500 -- [-1473.423] (-1474.562) (-1475.008) (-1473.452) * (-1473.601) (-1474.185) (-1475.380) [-1473.012] -- 0:01:01 116000 -- (-1472.799) (-1474.821) (-1475.368) [-1473.424] * [-1474.215] (-1478.407) (-1473.874) (-1473.588) -- 0:01:00 116500 -- [-1473.623] (-1473.002) (-1473.943) (-1474.478) * (-1473.645) (-1477.297) (-1473.277) [-1473.057] -- 0:01:00 117000 -- (-1473.053) [-1472.924] (-1476.358) (-1473.479) * [-1474.942] (-1477.321) (-1474.141) (-1472.460) -- 0:01:00 117500 -- (-1477.665) (-1471.610) [-1474.880] (-1473.474) * (-1475.481) (-1474.266) [-1474.116] (-1473.058) -- 0:01:00 118000 -- (-1477.098) (-1471.727) (-1472.522) [-1474.792] * (-1472.001) (-1476.853) (-1474.352) [-1472.748] -- 0:00:59 118500 -- (-1478.722) [-1473.821] (-1472.891) (-1479.550) * [-1474.240] (-1476.663) (-1475.163) (-1473.168) -- 0:00:59 119000 -- (-1479.274) (-1473.129) (-1475.397) [-1478.081] * (-1473.725) (-1475.724) [-1475.004] (-1473.120) -- 0:00:59 119500 -- (-1476.202) [-1472.962] (-1472.991) (-1473.884) * [-1478.260] (-1476.399) (-1473.711) (-1473.197) -- 0:00:58 120000 -- (-1473.971) (-1472.959) (-1471.938) [-1476.447] * [-1476.868] (-1479.216) (-1472.689) (-1473.049) -- 0:00:58 Average standard deviation of split frequencies: 0.017146 120500 -- (-1473.625) (-1475.228) [-1473.093] (-1474.745) * (-1479.575) [-1479.713] (-1472.547) (-1473.337) -- 0:00:58 121000 -- (-1472.635) [-1474.193] (-1480.251) (-1475.117) * (-1477.407) (-1479.830) [-1471.856] (-1472.937) -- 0:00:58 121500 -- (-1477.216) [-1473.653] (-1478.501) (-1474.910) * (-1478.401) (-1479.513) [-1471.751] (-1473.750) -- 0:00:57 122000 -- (-1474.305) [-1474.472] (-1476.958) (-1476.006) * (-1475.304) (-1474.882) [-1471.752] (-1472.805) -- 0:00:57 122500 -- [-1472.999] (-1474.766) (-1474.437) (-1474.247) * (-1473.859) [-1474.854] (-1474.600) (-1474.902) -- 0:00:57 123000 -- [-1473.970] (-1474.798) (-1476.825) (-1476.396) * (-1480.129) (-1475.714) [-1472.433] (-1473.444) -- 0:00:57 123500 -- [-1472.264] (-1477.068) (-1474.546) (-1476.162) * (-1474.807) (-1474.910) (-1474.465) [-1472.919] -- 0:00:56 124000 -- (-1472.976) (-1478.852) (-1475.126) [-1475.605] * [-1477.832] (-1473.940) (-1474.198) (-1476.848) -- 0:00:56 124500 -- (-1473.767) (-1474.917) [-1473.778] (-1475.060) * [-1475.162] (-1474.978) (-1471.876) (-1476.285) -- 0:00:56 125000 -- (-1472.088) [-1472.909] (-1472.377) (-1473.194) * (-1473.989) (-1473.474) (-1472.725) [-1477.561] -- 0:00:56 Average standard deviation of split frequencies: 0.016836 125500 -- (-1471.927) (-1480.182) (-1472.462) [-1472.374] * (-1474.074) (-1474.240) [-1472.748] (-1472.631) -- 0:00:55 126000 -- [-1472.709] (-1472.734) (-1476.631) (-1473.205) * (-1475.809) [-1477.378] (-1472.442) (-1473.495) -- 0:00:55 126500 -- (-1473.419) (-1471.941) [-1475.361] (-1472.963) * (-1475.310) (-1475.132) [-1471.818] (-1477.125) -- 0:00:55 127000 -- (-1473.389) [-1472.392] (-1475.941) (-1473.034) * (-1473.293) [-1473.864] (-1474.502) (-1478.692) -- 0:00:54 127500 -- (-1472.530) [-1473.011] (-1473.162) (-1474.212) * (-1472.066) (-1473.867) [-1473.299] (-1475.802) -- 0:00:54 128000 -- (-1474.542) (-1472.511) (-1473.398) [-1472.789] * (-1471.785) (-1477.367) [-1474.791] (-1472.190) -- 0:01:01 128500 -- (-1473.704) (-1471.816) [-1472.633] (-1472.817) * [-1473.829] (-1476.436) (-1472.800) (-1472.253) -- 0:01:01 129000 -- (-1476.746) (-1474.706) [-1472.563] (-1472.510) * (-1472.215) [-1474.958] (-1474.325) (-1472.727) -- 0:01:00 129500 -- (-1476.835) (-1474.484) (-1472.953) [-1472.801] * (-1473.946) (-1474.934) [-1473.594] (-1472.459) -- 0:01:00 130000 -- (-1473.459) [-1474.991] (-1475.345) (-1472.714) * (-1473.339) (-1472.552) [-1476.888] (-1472.719) -- 0:01:00 Average standard deviation of split frequencies: 0.018399 130500 -- (-1472.765) (-1475.549) [-1474.294] (-1472.977) * (-1474.347) [-1473.055] (-1475.380) (-1473.842) -- 0:00:59 131000 -- (-1474.071) (-1474.060) [-1475.593] (-1475.598) * (-1473.773) (-1476.496) (-1474.522) [-1473.313] -- 0:00:59 131500 -- [-1474.546] (-1473.888) (-1479.509) (-1472.860) * (-1472.191) [-1474.195] (-1473.916) (-1472.749) -- 0:00:59 132000 -- (-1474.123) (-1472.829) [-1476.297] (-1478.062) * (-1473.674) [-1473.796] (-1474.822) (-1472.747) -- 0:00:59 132500 -- [-1473.367] (-1473.740) (-1474.710) (-1479.005) * (-1474.868) (-1472.264) (-1476.240) [-1472.765] -- 0:00:58 133000 -- (-1479.851) [-1475.178] (-1472.901) (-1478.013) * (-1478.321) [-1472.250] (-1474.346) (-1472.862) -- 0:00:58 133500 -- (-1473.054) (-1472.780) (-1472.907) [-1476.716] * (-1473.289) (-1472.116) (-1472.341) [-1472.562] -- 0:00:58 134000 -- (-1476.540) (-1475.607) [-1476.531] (-1473.516) * [-1472.585] (-1475.993) (-1473.189) (-1476.696) -- 0:00:58 134500 -- [-1474.617] (-1475.445) (-1471.992) (-1473.511) * [-1473.124] (-1477.651) (-1472.889) (-1474.726) -- 0:00:57 135000 -- (-1473.719) [-1476.852] (-1472.594) (-1476.386) * (-1472.610) (-1472.980) (-1472.691) [-1474.493] -- 0:00:57 Average standard deviation of split frequencies: 0.018486 135500 -- (-1474.189) [-1474.137] (-1474.498) (-1476.123) * (-1473.067) (-1473.568) [-1476.167] (-1475.618) -- 0:00:57 136000 -- (-1472.164) (-1473.934) (-1475.060) [-1476.431] * (-1473.343) [-1472.716] (-1475.180) (-1475.089) -- 0:00:57 136500 -- (-1474.113) [-1473.606] (-1473.127) (-1473.076) * (-1474.653) [-1472.213] (-1475.180) (-1472.820) -- 0:00:56 137000 -- (-1477.456) [-1473.130] (-1473.108) (-1476.459) * (-1473.389) [-1472.445] (-1475.454) (-1476.020) -- 0:00:56 137500 -- (-1474.584) (-1474.070) [-1478.651] (-1473.326) * (-1477.647) (-1473.498) (-1475.211) [-1473.478] -- 0:00:56 138000 -- [-1476.348] (-1473.962) (-1475.683) (-1474.809) * (-1473.576) (-1473.081) [-1472.518] (-1478.751) -- 0:00:56 138500 -- (-1475.051) [-1473.832] (-1473.073) (-1473.167) * (-1472.311) (-1477.507) (-1473.280) [-1472.936] -- 0:00:55 139000 -- [-1473.222] (-1472.053) (-1471.546) (-1473.550) * (-1473.173) (-1476.355) (-1473.886) [-1472.737] -- 0:00:55 139500 -- (-1473.926) (-1472.500) [-1472.482] (-1474.496) * (-1473.462) (-1475.105) [-1473.430] (-1473.479) -- 0:00:55 140000 -- [-1474.575] (-1471.962) (-1471.876) (-1472.983) * [-1471.692] (-1477.024) (-1477.003) (-1474.612) -- 0:00:55 Average standard deviation of split frequencies: 0.017687 140500 -- (-1474.643) (-1473.311) (-1473.737) [-1473.375] * (-1474.324) [-1475.166] (-1474.353) (-1475.394) -- 0:00:55 141000 -- (-1474.169) (-1473.217) (-1478.070) [-1473.604] * [-1474.866] (-1474.476) (-1472.552) (-1475.381) -- 0:00:54 141500 -- (-1476.957) [-1471.755] (-1473.643) (-1472.358) * [-1472.537] (-1472.809) (-1472.655) (-1476.742) -- 0:00:54 142000 -- (-1472.703) (-1471.833) (-1476.655) [-1472.714] * (-1477.441) (-1471.937) (-1473.003) [-1473.343] -- 0:00:54 142500 -- (-1471.850) (-1472.879) (-1477.851) [-1472.577] * (-1479.281) (-1472.426) [-1475.135] (-1473.853) -- 0:00:54 143000 -- (-1471.856) (-1473.119) (-1475.063) [-1472.194] * (-1483.296) [-1472.283] (-1473.327) (-1475.934) -- 0:00:53 143500 -- [-1472.350] (-1473.993) (-1474.878) (-1472.282) * (-1472.579) (-1472.551) (-1472.976) [-1472.419] -- 0:00:59 144000 -- [-1473.146] (-1473.875) (-1480.531) (-1472.195) * (-1473.650) [-1472.741] (-1472.955) (-1473.954) -- 0:00:59 144500 -- (-1472.480) (-1473.884) (-1473.637) [-1472.810] * (-1472.391) [-1476.069] (-1475.315) (-1472.758) -- 0:00:59 145000 -- (-1473.931) (-1474.601) [-1475.677] (-1475.640) * [-1472.118] (-1472.765) (-1474.262) (-1474.241) -- 0:00:58 Average standard deviation of split frequencies: 0.018476 145500 -- (-1472.263) (-1475.046) [-1475.323] (-1474.850) * (-1472.118) (-1472.991) (-1474.282) [-1473.049] -- 0:00:58 146000 -- (-1472.048) [-1473.898] (-1473.991) (-1473.366) * [-1472.620] (-1474.491) (-1480.169) (-1474.690) -- 0:00:58 146500 -- (-1473.562) (-1475.414) [-1475.695] (-1473.668) * [-1472.290] (-1474.484) (-1472.661) (-1473.318) -- 0:00:58 147000 -- (-1473.562) [-1474.819] (-1475.920) (-1477.150) * (-1472.011) (-1473.881) [-1471.820] (-1473.328) -- 0:00:58 147500 -- [-1474.166] (-1472.259) (-1473.549) (-1475.787) * (-1473.664) (-1473.523) [-1473.439] (-1475.268) -- 0:00:57 148000 -- (-1474.035) (-1474.116) (-1473.615) [-1476.134] * (-1472.527) (-1473.634) (-1473.439) [-1473.693] -- 0:00:57 148500 -- (-1475.356) (-1474.366) [-1473.834] (-1478.960) * (-1472.748) (-1473.470) [-1472.818] (-1473.957) -- 0:00:57 149000 -- (-1477.173) (-1475.792) [-1471.983] (-1473.143) * (-1472.537) (-1472.899) (-1474.781) [-1474.100] -- 0:00:57 149500 -- (-1476.132) (-1473.703) [-1472.601] (-1475.312) * [-1472.387] (-1473.393) (-1474.287) (-1483.017) -- 0:00:56 150000 -- (-1475.122) (-1471.861) (-1471.924) [-1473.646] * [-1474.702] (-1475.586) (-1472.628) (-1477.227) -- 0:00:56 Average standard deviation of split frequencies: 0.017556 150500 -- (-1473.249) (-1476.027) (-1472.052) [-1473.943] * (-1474.505) (-1473.881) [-1472.593] (-1477.659) -- 0:00:56 151000 -- (-1473.246) (-1472.573) (-1472.458) [-1473.515] * (-1472.899) [-1475.855] (-1474.832) (-1475.042) -- 0:00:56 151500 -- [-1472.739] (-1472.383) (-1473.080) (-1473.468) * (-1473.293) [-1472.867] (-1474.599) (-1478.460) -- 0:00:56 152000 -- [-1472.933] (-1471.861) (-1473.797) (-1474.796) * [-1473.271] (-1473.687) (-1473.969) (-1474.855) -- 0:00:55 152500 -- [-1477.166] (-1474.280) (-1472.447) (-1475.772) * [-1473.239] (-1474.168) (-1472.756) (-1474.580) -- 0:00:55 153000 -- (-1478.409) [-1472.630] (-1473.162) (-1474.955) * [-1473.870] (-1473.749) (-1475.786) (-1475.035) -- 0:00:55 153500 -- [-1481.093] (-1474.209) (-1476.483) (-1473.280) * [-1473.744] (-1473.934) (-1474.793) (-1475.398) -- 0:00:55 154000 -- (-1475.172) (-1471.872) (-1475.008) [-1474.135] * (-1474.426) (-1473.167) (-1472.658) [-1474.339] -- 0:00:54 154500 -- [-1472.902] (-1473.180) (-1482.338) (-1472.451) * (-1476.166) (-1474.402) (-1476.227) [-1473.789] -- 0:00:54 155000 -- (-1476.991) (-1472.210) [-1474.715] (-1472.531) * (-1472.428) (-1473.267) [-1473.983] (-1472.567) -- 0:00:54 Average standard deviation of split frequencies: 0.015998 155500 -- (-1472.463) (-1473.023) (-1477.622) [-1473.462] * (-1472.946) (-1475.952) [-1473.154] (-1472.105) -- 0:00:54 156000 -- (-1473.716) (-1476.611) [-1475.123] (-1473.345) * [-1473.381] (-1474.469) (-1472.037) (-1476.427) -- 0:00:54 156500 -- (-1474.649) [-1472.102] (-1475.736) (-1474.171) * (-1473.385) (-1475.822) [-1473.260] (-1474.930) -- 0:00:53 157000 -- [-1473.337] (-1472.075) (-1477.895) (-1472.274) * (-1473.972) (-1474.791) [-1474.305] (-1476.734) -- 0:00:53 157500 -- [-1472.595] (-1472.082) (-1478.827) (-1474.144) * [-1476.358] (-1474.521) (-1471.827) (-1476.884) -- 0:00:53 158000 -- (-1472.494) (-1472.310) (-1479.393) [-1474.126] * (-1476.024) [-1474.312] (-1472.676) (-1475.073) -- 0:00:53 158500 -- [-1476.080] (-1472.355) (-1474.763) (-1476.898) * (-1474.530) [-1474.203] (-1471.887) (-1476.565) -- 0:00:53 159000 -- [-1477.665] (-1472.270) (-1478.118) (-1477.287) * (-1474.087) [-1473.228] (-1472.066) (-1475.916) -- 0:00:52 159500 -- (-1473.387) (-1476.070) (-1476.780) [-1477.078] * (-1474.707) [-1472.878] (-1473.102) (-1474.178) -- 0:00:57 160000 -- (-1471.876) (-1475.066) [-1477.295] (-1475.647) * (-1474.859) [-1473.088] (-1473.641) (-1473.612) -- 0:00:57 Average standard deviation of split frequencies: 0.015188 160500 -- (-1474.562) (-1475.365) (-1477.527) [-1473.900] * (-1475.217) (-1474.022) (-1473.068) [-1475.589] -- 0:00:57 161000 -- (-1472.048) [-1472.309] (-1479.113) (-1472.596) * (-1473.538) [-1472.031] (-1474.823) (-1474.732) -- 0:00:57 161500 -- (-1472.163) [-1472.734] (-1474.908) (-1476.450) * (-1476.351) (-1472.603) (-1476.910) [-1473.339] -- 0:00:57 162000 -- (-1478.440) (-1475.041) [-1472.708] (-1476.158) * [-1474.971] (-1472.578) (-1473.098) (-1473.023) -- 0:00:56 162500 -- (-1472.360) (-1473.459) (-1474.612) [-1474.512] * (-1477.112) [-1472.288] (-1474.819) (-1476.983) -- 0:00:56 163000 -- (-1472.911) [-1472.464] (-1474.129) (-1476.502) * (-1478.643) (-1476.181) (-1479.638) [-1475.624] -- 0:00:56 163500 -- (-1473.259) (-1474.806) (-1477.480) [-1472.481] * [-1473.293] (-1476.731) (-1472.825) (-1476.266) -- 0:00:56 164000 -- (-1472.095) (-1474.806) [-1473.234] (-1473.457) * (-1474.245) (-1476.077) [-1472.338] (-1472.750) -- 0:00:56 164500 -- (-1475.434) (-1477.594) [-1475.545] (-1473.197) * [-1472.999] (-1476.501) (-1472.824) (-1475.747) -- 0:00:55 165000 -- (-1478.307) (-1476.574) [-1475.205] (-1474.482) * (-1472.814) (-1474.264) (-1472.844) [-1475.993] -- 0:00:55 Average standard deviation of split frequencies: 0.016408 165500 -- (-1475.311) (-1473.216) [-1474.463] (-1474.274) * [-1472.185] (-1474.014) (-1475.289) (-1472.953) -- 0:00:55 166000 -- (-1476.363) [-1478.186] (-1473.601) (-1473.506) * (-1474.667) (-1475.978) (-1474.833) [-1472.522] -- 0:00:55 166500 -- [-1475.467] (-1479.155) (-1475.588) (-1473.460) * (-1472.465) (-1478.235) (-1473.315) [-1473.621] -- 0:00:55 167000 -- (-1475.064) (-1480.518) [-1477.317] (-1473.831) * (-1473.020) [-1474.502] (-1474.175) (-1473.023) -- 0:00:54 167500 -- (-1474.838) (-1473.992) (-1473.944) [-1473.004] * (-1476.179) (-1478.013) (-1475.511) [-1472.782] -- 0:00:54 168000 -- [-1475.306] (-1476.216) (-1473.470) (-1473.703) * [-1474.404] (-1474.579) (-1477.046) (-1473.623) -- 0:00:54 168500 -- (-1476.500) (-1473.047) (-1473.731) [-1474.203] * (-1474.764) (-1475.215) (-1479.750) [-1477.839] -- 0:00:54 169000 -- (-1474.945) (-1472.931) (-1473.858) [-1473.822] * (-1473.246) (-1474.711) (-1475.231) [-1475.898] -- 0:00:54 169500 -- [-1475.701] (-1474.041) (-1474.672) (-1473.138) * [-1471.904] (-1472.576) (-1476.193) (-1472.234) -- 0:00:53 170000 -- (-1473.789) [-1474.557] (-1475.832) (-1473.491) * [-1472.616] (-1472.552) (-1473.127) (-1473.340) -- 0:00:53 Average standard deviation of split frequencies: 0.016898 170500 -- [-1474.232] (-1473.900) (-1473.146) (-1473.531) * [-1473.281] (-1474.948) (-1473.177) (-1472.956) -- 0:00:53 171000 -- (-1474.888) (-1472.361) (-1473.217) [-1474.873] * (-1472.043) (-1476.489) (-1474.790) [-1473.830] -- 0:00:53 171500 -- (-1471.852) (-1475.659) [-1472.919] (-1472.995) * [-1473.699] (-1472.883) (-1474.043) (-1473.533) -- 0:00:53 172000 -- [-1473.377] (-1473.557) (-1473.392) (-1478.097) * (-1472.226) [-1473.601] (-1475.185) (-1473.499) -- 0:00:52 172500 -- (-1473.376) [-1472.358] (-1472.465) (-1474.624) * (-1471.953) (-1474.581) (-1473.479) [-1472.826] -- 0:00:52 173000 -- (-1475.134) [-1472.936] (-1472.438) (-1476.477) * [-1471.899] (-1476.009) (-1475.941) (-1473.480) -- 0:00:52 173500 -- (-1476.029) [-1473.860] (-1472.911) (-1476.533) * (-1473.940) (-1480.688) [-1473.026] (-1473.390) -- 0:00:52 174000 -- [-1472.571] (-1474.049) (-1472.515) (-1476.281) * (-1472.501) [-1472.132] (-1473.057) (-1476.540) -- 0:00:52 174500 -- (-1474.393) (-1473.911) (-1472.656) [-1474.605] * (-1472.464) (-1475.584) [-1471.925] (-1477.011) -- 0:00:52 175000 -- (-1471.744) (-1472.269) (-1473.244) [-1473.971] * (-1472.156) (-1472.998) [-1472.644] (-1478.210) -- 0:00:56 Average standard deviation of split frequencies: 0.014968 175500 -- (-1473.581) (-1472.205) (-1472.658) [-1473.860] * (-1472.533) [-1473.546] (-1471.698) (-1476.665) -- 0:00:56 176000 -- (-1475.285) [-1472.117] (-1472.456) (-1472.782) * (-1474.079) [-1472.372] (-1473.423) (-1479.914) -- 0:00:56 176500 -- (-1474.108) (-1472.616) (-1471.919) [-1473.857] * (-1473.459) [-1473.682] (-1475.603) (-1474.358) -- 0:00:55 177000 -- (-1473.422) [-1472.681] (-1471.919) (-1473.730) * (-1480.117) (-1473.409) (-1476.578) [-1472.702] -- 0:00:55 177500 -- [-1473.978] (-1473.430) (-1473.882) (-1472.574) * (-1474.860) (-1475.263) (-1473.830) [-1475.578] -- 0:00:55 178000 -- (-1476.179) (-1473.356) [-1474.225] (-1472.688) * [-1473.364] (-1473.200) (-1473.756) (-1473.724) -- 0:00:55 178500 -- [-1473.610] (-1474.399) (-1474.543) (-1474.120) * (-1473.399) (-1473.199) [-1473.309] (-1474.859) -- 0:00:55 179000 -- (-1475.044) (-1474.818) [-1476.026] (-1475.955) * (-1474.651) (-1474.049) [-1473.611] (-1473.132) -- 0:00:55 179500 -- (-1473.756) [-1475.537] (-1473.794) (-1474.988) * (-1473.841) [-1474.990] (-1472.705) (-1473.906) -- 0:00:54 180000 -- (-1475.504) (-1475.381) [-1471.847] (-1475.965) * (-1473.239) (-1475.976) (-1473.567) [-1474.714] -- 0:00:54 Average standard deviation of split frequencies: 0.013814 180500 -- (-1475.299) [-1474.691] (-1471.965) (-1473.735) * (-1473.993) (-1474.440) [-1475.783] (-1473.648) -- 0:00:54 181000 -- [-1475.492] (-1476.158) (-1471.953) (-1473.930) * (-1472.031) (-1473.669) [-1472.764] (-1472.239) -- 0:00:54 181500 -- (-1473.009) (-1473.991) [-1472.527] (-1473.981) * (-1472.258) (-1473.918) (-1471.984) [-1473.616] -- 0:00:54 182000 -- (-1472.971) [-1473.854] (-1473.188) (-1473.009) * (-1473.155) [-1473.551] (-1473.271) (-1476.910) -- 0:00:53 182500 -- (-1472.808) (-1473.513) [-1472.419] (-1474.929) * (-1472.568) (-1473.704) (-1475.806) [-1473.458] -- 0:00:53 183000 -- [-1474.737] (-1472.534) (-1472.948) (-1474.091) * [-1472.168] (-1474.924) (-1477.620) (-1472.010) -- 0:00:53 183500 -- (-1473.537) (-1473.480) [-1473.090] (-1474.915) * (-1473.738) [-1471.931] (-1473.774) (-1471.717) -- 0:00:53 184000 -- (-1473.189) [-1472.897] (-1473.357) (-1474.289) * (-1475.384) [-1471.726] (-1477.499) (-1472.502) -- 0:00:53 184500 -- (-1473.176) (-1472.357) [-1472.447] (-1474.364) * (-1475.186) (-1472.013) (-1473.574) [-1473.716] -- 0:00:53 185000 -- (-1473.730) [-1472.524] (-1472.553) (-1474.116) * (-1476.835) [-1471.928] (-1474.069) (-1477.553) -- 0:00:52 Average standard deviation of split frequencies: 0.014759 185500 -- (-1474.320) (-1472.992) (-1472.719) [-1472.646] * (-1475.305) (-1473.042) (-1473.139) [-1473.489] -- 0:00:52 186000 -- [-1474.320] (-1473.005) (-1476.979) (-1475.031) * [-1475.325] (-1476.555) (-1474.958) (-1472.371) -- 0:00:52 186500 -- [-1474.316] (-1472.240) (-1474.164) (-1473.773) * (-1476.790) [-1475.402] (-1475.909) (-1472.362) -- 0:00:52 187000 -- (-1473.859) [-1472.965] (-1473.394) (-1473.791) * [-1473.061] (-1473.454) (-1472.313) (-1473.477) -- 0:00:52 187500 -- (-1473.323) [-1476.009] (-1472.738) (-1474.796) * (-1473.089) (-1474.219) [-1472.484] (-1474.361) -- 0:00:52 188000 -- [-1475.442] (-1477.838) (-1472.632) (-1474.140) * (-1475.618) [-1473.044] (-1473.438) (-1474.362) -- 0:00:51 188500 -- [-1474.566] (-1474.723) (-1472.169) (-1474.701) * [-1474.863] (-1472.551) (-1472.738) (-1474.679) -- 0:00:51 189000 -- (-1473.902) [-1476.968] (-1473.768) (-1473.191) * [-1474.698] (-1475.216) (-1472.210) (-1472.233) -- 0:00:51 189500 -- (-1474.049) (-1472.913) [-1472.350] (-1475.952) * [-1475.080] (-1476.259) (-1474.244) (-1472.622) -- 0:00:51 190000 -- [-1474.898] (-1472.974) (-1476.592) (-1472.539) * (-1473.442) (-1474.228) (-1475.854) [-1472.622] -- 0:00:51 Average standard deviation of split frequencies: 0.015109 190500 -- [-1473.269] (-1473.069) (-1475.255) (-1472.523) * [-1474.360] (-1473.839) (-1472.587) (-1473.440) -- 0:00:55 191000 -- (-1472.590) (-1473.236) (-1472.767) [-1472.978] * (-1476.010) (-1472.668) [-1472.649] (-1477.603) -- 0:00:55 191500 -- [-1474.597] (-1475.160) (-1476.627) (-1476.748) * (-1475.340) (-1475.249) (-1473.955) [-1473.901] -- 0:00:54 192000 -- [-1473.576] (-1480.236) (-1474.964) (-1475.314) * (-1475.712) (-1474.170) [-1473.783] (-1475.362) -- 0:00:54 192500 -- (-1472.078) (-1474.836) [-1472.087] (-1472.055) * [-1473.455] (-1472.998) (-1476.411) (-1474.874) -- 0:00:54 193000 -- (-1472.789) [-1475.248] (-1473.674) (-1472.055) * [-1472.434] (-1474.538) (-1477.138) (-1472.672) -- 0:00:54 193500 -- (-1472.639) [-1473.073] (-1473.410) (-1472.041) * (-1472.938) (-1473.556) [-1474.856] (-1474.980) -- 0:00:54 194000 -- (-1473.335) [-1475.221] (-1477.366) (-1472.780) * (-1472.169) [-1476.981] (-1474.037) (-1472.817) -- 0:00:54 194500 -- (-1472.762) (-1474.240) (-1473.726) [-1471.989] * (-1474.580) [-1475.732] (-1474.560) (-1476.314) -- 0:00:53 195000 -- (-1472.540) (-1474.198) [-1471.791] (-1475.021) * [-1472.193] (-1476.106) (-1475.851) (-1473.642) -- 0:00:53 Average standard deviation of split frequencies: 0.015901 195500 -- [-1475.358] (-1474.068) (-1474.258) (-1475.002) * (-1473.998) (-1472.434) [-1473.130] (-1473.105) -- 0:00:53 196000 -- (-1476.877) (-1475.247) [-1472.600] (-1473.975) * (-1474.222) [-1475.124] (-1474.815) (-1472.317) -- 0:00:53 196500 -- (-1478.405) (-1474.639) (-1472.729) [-1472.746] * [-1474.699] (-1474.963) (-1474.449) (-1476.236) -- 0:00:53 197000 -- [-1471.822] (-1475.671) (-1473.219) (-1474.660) * (-1477.586) [-1474.116] (-1474.860) (-1475.379) -- 0:00:52 197500 -- [-1475.108] (-1475.417) (-1474.692) (-1473.818) * (-1477.097) (-1473.884) [-1475.315] (-1473.098) -- 0:00:52 198000 -- [-1473.525] (-1473.050) (-1478.210) (-1474.677) * (-1477.215) (-1473.153) [-1475.186] (-1474.978) -- 0:00:52 198500 -- (-1473.836) [-1473.014] (-1476.998) (-1473.427) * (-1478.053) (-1473.834) [-1475.665] (-1479.238) -- 0:00:52 199000 -- (-1475.628) (-1473.127) (-1473.551) [-1474.381] * (-1474.271) [-1473.158] (-1472.382) (-1477.147) -- 0:00:52 199500 -- [-1472.411] (-1474.027) (-1473.800) (-1474.132) * [-1473.878] (-1471.734) (-1472.053) (-1471.979) -- 0:00:52 200000 -- (-1472.538) (-1472.920) [-1473.049] (-1474.825) * [-1472.824] (-1473.138) (-1472.305) (-1472.077) -- 0:00:51 Average standard deviation of split frequencies: 0.015009 200500 -- (-1474.269) (-1477.170) [-1477.229] (-1481.602) * [-1472.549] (-1474.509) (-1482.230) (-1472.360) -- 0:00:51 201000 -- [-1473.795] (-1475.595) (-1473.558) (-1478.795) * [-1477.157] (-1473.510) (-1473.019) (-1472.170) -- 0:00:51 201500 -- (-1476.895) (-1475.987) (-1473.404) [-1475.975] * [-1474.540] (-1474.134) (-1473.012) (-1472.107) -- 0:00:51 202000 -- (-1473.102) (-1472.794) [-1473.053] (-1474.937) * (-1473.234) (-1474.075) (-1472.964) [-1471.771] -- 0:00:51 202500 -- (-1473.728) [-1475.244] (-1473.053) (-1473.760) * (-1476.268) (-1473.076) (-1471.923) [-1471.564] -- 0:00:51 203000 -- (-1474.508) (-1477.113) (-1472.416) [-1473.217] * (-1472.619) (-1473.457) (-1471.976) [-1471.684] -- 0:00:51 203500 -- (-1473.183) (-1479.659) [-1474.517] (-1474.151) * (-1472.638) (-1473.118) (-1472.687) [-1472.195] -- 0:00:50 204000 -- (-1473.079) (-1478.533) (-1474.303) [-1473.653] * (-1475.300) (-1476.171) (-1475.171) [-1472.271] -- 0:00:50 204500 -- (-1474.277) (-1475.422) [-1472.708] (-1472.980) * [-1475.743] (-1475.576) (-1473.919) (-1476.240) -- 0:00:50 205000 -- (-1473.121) [-1472.949] (-1478.180) (-1473.874) * (-1477.315) (-1477.164) (-1474.195) [-1473.737] -- 0:00:50 Average standard deviation of split frequencies: 0.016982 205500 -- (-1473.955) [-1472.876] (-1477.193) (-1475.354) * [-1474.401] (-1475.505) (-1474.031) (-1473.795) -- 0:00:50 206000 -- [-1473.101] (-1476.847) (-1480.147) (-1475.538) * (-1472.726) (-1473.812) (-1474.861) [-1473.321] -- 0:00:50 206500 -- (-1473.450) (-1475.450) (-1475.700) [-1475.006] * (-1471.842) (-1473.842) (-1472.514) [-1473.688] -- 0:00:53 207000 -- [-1473.405] (-1474.439) (-1477.467) (-1475.279) * (-1473.555) [-1472.485] (-1471.726) (-1475.267) -- 0:00:53 207500 -- [-1474.383] (-1473.313) (-1474.961) (-1474.921) * (-1474.426) (-1472.950) [-1473.737] (-1473.404) -- 0:00:53 208000 -- [-1474.383] (-1474.869) (-1474.158) (-1477.305) * (-1472.409) (-1473.493) [-1472.319] (-1472.225) -- 0:00:53 208500 -- (-1474.041) (-1474.138) (-1478.132) [-1476.393] * [-1472.102] (-1473.061) (-1474.105) (-1472.981) -- 0:00:53 209000 -- (-1474.628) (-1475.367) (-1475.245) [-1475.337] * (-1485.293) (-1472.640) [-1473.076] (-1473.284) -- 0:00:52 209500 -- (-1473.744) (-1475.752) [-1473.654] (-1473.573) * [-1474.467] (-1472.403) (-1473.276) (-1474.584) -- 0:00:52 210000 -- [-1474.145] (-1472.364) (-1473.122) (-1475.632) * [-1475.405] (-1471.937) (-1477.664) (-1474.267) -- 0:00:52 Average standard deviation of split frequencies: 0.016135 210500 -- (-1472.030) [-1472.767] (-1475.313) (-1474.043) * (-1474.844) (-1474.881) [-1478.537] (-1474.349) -- 0:00:52 211000 -- (-1474.830) (-1474.298) (-1475.137) [-1477.863] * (-1477.217) (-1474.533) [-1474.410] (-1474.451) -- 0:00:52 211500 -- (-1471.473) (-1474.019) (-1473.067) [-1480.393] * (-1476.931) [-1476.369] (-1474.095) (-1473.382) -- 0:00:52 212000 -- [-1473.494] (-1475.361) (-1472.959) (-1473.596) * (-1474.940) (-1474.080) [-1475.204] (-1472.368) -- 0:00:52 212500 -- (-1473.711) [-1474.432] (-1473.006) (-1474.220) * (-1474.653) [-1474.089] (-1474.178) (-1477.624) -- 0:00:51 213000 -- (-1474.647) (-1476.296) (-1473.418) [-1473.999] * (-1477.995) (-1472.446) (-1474.862) [-1471.653] -- 0:00:51 213500 -- [-1474.660] (-1473.798) (-1472.356) (-1476.465) * (-1476.423) (-1473.890) (-1472.458) [-1471.620] -- 0:00:51 214000 -- (-1475.097) (-1473.554) (-1473.931) [-1474.615] * (-1475.067) (-1472.798) [-1475.791] (-1471.963) -- 0:00:51 214500 -- (-1473.200) [-1473.589] (-1472.627) (-1476.579) * (-1473.741) [-1473.321] (-1477.564) (-1471.798) -- 0:00:51 215000 -- (-1474.439) (-1473.313) [-1474.200] (-1474.502) * (-1476.737) (-1478.785) (-1476.187) [-1472.684] -- 0:00:51 Average standard deviation of split frequencies: 0.014428 215500 -- [-1474.791] (-1474.301) (-1474.425) (-1473.206) * (-1474.419) [-1474.661] (-1473.600) (-1473.379) -- 0:00:50 216000 -- (-1472.988) (-1476.094) (-1472.552) [-1472.998] * [-1472.460] (-1475.238) (-1475.968) (-1474.965) -- 0:00:50 216500 -- (-1473.753) [-1474.795] (-1473.050) (-1472.410) * (-1472.616) (-1473.706) [-1472.732] (-1473.497) -- 0:00:50 217000 -- (-1474.120) (-1472.942) [-1471.999] (-1472.750) * (-1472.496) [-1473.473] (-1478.201) (-1474.266) -- 0:00:50 217500 -- [-1473.320] (-1474.730) (-1473.074) (-1472.585) * (-1472.226) (-1474.382) [-1473.906] (-1476.527) -- 0:00:50 218000 -- [-1472.192] (-1475.707) (-1474.129) (-1472.764) * (-1472.734) [-1474.738] (-1475.791) (-1479.220) -- 0:00:50 218500 -- (-1474.784) (-1475.822) [-1476.674] (-1473.216) * (-1472.624) (-1472.593) [-1474.711] (-1479.967) -- 0:00:50 219000 -- (-1476.005) (-1473.959) [-1475.144] (-1474.024) * (-1474.468) [-1472.867] (-1472.418) (-1475.486) -- 0:00:49 219500 -- (-1472.977) (-1475.962) (-1475.202) [-1475.050] * (-1474.477) (-1473.323) (-1472.542) [-1472.045] -- 0:00:49 220000 -- [-1474.855] (-1474.806) (-1477.229) (-1473.060) * (-1474.249) (-1473.884) (-1472.137) [-1472.349] -- 0:00:49 Average standard deviation of split frequencies: 0.014004 220500 -- [-1476.104] (-1474.688) (-1474.524) (-1476.775) * (-1473.466) [-1474.990] (-1473.883) (-1471.873) -- 0:00:49 221000 -- (-1473.030) (-1473.823) [-1473.595] (-1473.545) * (-1472.291) (-1475.263) (-1475.961) [-1472.104] -- 0:00:49 221500 -- (-1473.099) (-1474.332) (-1475.522) [-1474.390] * (-1475.307) (-1477.818) (-1474.186) [-1472.291] -- 0:00:49 222000 -- (-1473.450) (-1472.946) [-1473.479] (-1473.716) * (-1473.152) (-1474.484) (-1475.502) [-1472.707] -- 0:00:49 222500 -- [-1473.299] (-1473.062) (-1473.387) (-1474.576) * (-1473.145) (-1475.150) (-1473.909) [-1473.532] -- 0:00:52 223000 -- (-1472.403) (-1473.096) [-1473.038] (-1475.959) * (-1479.180) (-1475.505) [-1472.452] (-1471.849) -- 0:00:52 223500 -- (-1472.787) [-1473.542] (-1472.943) (-1472.652) * (-1474.958) (-1476.284) [-1472.310] (-1472.672) -- 0:00:52 224000 -- (-1476.485) (-1473.542) [-1472.221] (-1473.342) * (-1474.485) (-1475.970) [-1472.931] (-1473.533) -- 0:00:51 224500 -- (-1472.985) [-1473.720] (-1471.979) (-1474.992) * (-1473.916) (-1474.558) [-1475.459] (-1472.107) -- 0:00:51 225000 -- [-1472.542] (-1473.035) (-1473.269) (-1472.510) * (-1474.066) (-1474.148) (-1478.207) [-1473.568] -- 0:00:51 Average standard deviation of split frequencies: 0.014491 225500 -- (-1472.255) [-1472.398] (-1471.816) (-1475.512) * [-1474.038] (-1474.319) (-1476.688) (-1475.687) -- 0:00:51 226000 -- (-1472.109) [-1473.625] (-1471.761) (-1475.378) * [-1474.283] (-1477.598) (-1473.680) (-1472.768) -- 0:00:51 226500 -- (-1473.535) (-1472.438) (-1475.157) [-1472.468] * [-1471.755] (-1477.660) (-1477.665) (-1473.326) -- 0:00:51 227000 -- (-1474.304) (-1473.237) (-1478.487) [-1473.671] * (-1473.095) [-1474.712] (-1476.441) (-1473.187) -- 0:00:51 227500 -- (-1473.456) [-1472.709] (-1479.502) (-1474.048) * (-1474.714) (-1475.211) (-1475.005) [-1473.065] -- 0:00:50 228000 -- [-1473.407] (-1472.398) (-1474.756) (-1473.916) * [-1472.963] (-1473.183) (-1474.121) (-1472.819) -- 0:00:50 228500 -- (-1473.506) [-1473.117] (-1473.245) (-1475.512) * (-1472.313) (-1473.515) (-1473.851) [-1472.959] -- 0:00:50 229000 -- [-1473.871] (-1473.125) (-1473.018) (-1475.030) * [-1472.603] (-1475.808) (-1473.856) (-1475.063) -- 0:00:50 229500 -- (-1473.685) (-1472.779) (-1473.224) [-1474.205] * (-1471.802) (-1475.630) [-1472.749] (-1474.138) -- 0:00:50 230000 -- (-1474.505) (-1472.544) [-1473.143] (-1472.776) * (-1471.726) (-1472.184) [-1473.482] (-1473.551) -- 0:00:50 Average standard deviation of split frequencies: 0.012716 230500 -- (-1473.158) (-1477.041) (-1473.251) [-1474.070] * [-1471.726] (-1474.130) (-1473.631) (-1473.859) -- 0:00:50 231000 -- (-1472.639) [-1473.469] (-1472.359) (-1479.351) * (-1471.626) (-1474.089) [-1473.310] (-1477.220) -- 0:00:49 231500 -- [-1472.357] (-1475.222) (-1475.057) (-1476.514) * [-1471.626] (-1474.534) (-1473.615) (-1473.544) -- 0:00:49 232000 -- (-1472.370) [-1475.312] (-1474.442) (-1478.673) * (-1471.607) [-1472.537] (-1475.023) (-1474.137) -- 0:00:49 232500 -- (-1472.557) (-1472.761) [-1474.398] (-1479.991) * [-1471.633] (-1472.406) (-1474.912) (-1474.583) -- 0:00:49 233000 -- (-1472.894) (-1474.197) (-1473.239) [-1474.974] * (-1471.628) [-1473.082] (-1477.010) (-1473.638) -- 0:00:49 233500 -- (-1474.659) [-1472.898] (-1473.186) (-1474.256) * (-1473.050) (-1473.104) (-1478.667) [-1474.070] -- 0:00:49 234000 -- (-1474.793) (-1472.633) [-1473.562] (-1472.416) * (-1474.643) (-1476.528) (-1473.157) [-1474.380] -- 0:00:49 234500 -- (-1474.664) (-1474.408) (-1473.800) [-1473.137] * (-1475.198) (-1475.593) [-1475.716] (-1474.089) -- 0:00:48 235000 -- (-1476.539) (-1473.797) (-1474.156) [-1473.623] * (-1472.707) (-1476.650) [-1471.873] (-1474.899) -- 0:00:48 Average standard deviation of split frequencies: 0.011874 235500 -- (-1476.769) [-1474.404] (-1473.240) (-1477.136) * [-1474.064] (-1476.895) (-1472.769) (-1472.990) -- 0:00:48 236000 -- (-1475.632) [-1472.870] (-1478.629) (-1473.953) * (-1474.093) (-1476.049) (-1473.361) [-1472.991] -- 0:00:48 236500 -- (-1474.887) [-1472.793] (-1473.952) (-1471.983) * (-1472.730) (-1476.148) (-1473.275) [-1473.005] -- 0:00:48 237000 -- [-1474.028] (-1473.631) (-1474.635) (-1472.815) * (-1474.636) (-1472.964) [-1472.158] (-1473.606) -- 0:00:48 237500 -- [-1473.264] (-1476.952) (-1474.775) (-1472.895) * (-1474.961) (-1481.793) [-1472.515] (-1477.169) -- 0:00:48 238000 -- (-1473.371) [-1473.045] (-1474.825) (-1472.128) * (-1475.574) [-1472.853] (-1472.609) (-1475.455) -- 0:00:48 238500 -- (-1472.833) (-1473.946) (-1473.594) [-1473.028] * (-1472.496) [-1473.521] (-1472.493) (-1473.142) -- 0:00:51 239000 -- (-1472.466) (-1473.846) (-1473.748) [-1474.414] * [-1471.986] (-1473.587) (-1473.421) (-1473.539) -- 0:00:50 239500 -- [-1472.916] (-1472.993) (-1477.931) (-1472.141) * (-1472.155) (-1475.967) (-1471.949) [-1472.284] -- 0:00:50 240000 -- (-1473.146) (-1472.985) [-1474.670] (-1477.021) * (-1473.333) [-1472.599] (-1473.536) (-1472.186) -- 0:00:50 Average standard deviation of split frequencies: 0.012732 240500 -- (-1473.288) (-1477.796) (-1473.120) [-1475.194] * (-1473.334) [-1472.962] (-1472.632) (-1475.967) -- 0:00:50 241000 -- (-1472.733) [-1472.582] (-1476.224) (-1474.721) * (-1473.048) [-1472.647] (-1472.680) (-1473.898) -- 0:00:50 241500 -- (-1472.595) (-1473.994) [-1475.937] (-1475.167) * (-1474.156) (-1473.609) (-1472.930) [-1472.932] -- 0:00:50 242000 -- (-1474.385) [-1472.826] (-1475.291) (-1474.253) * (-1473.847) (-1473.288) [-1472.053] (-1472.786) -- 0:00:50 242500 -- (-1473.151) (-1473.623) (-1477.014) [-1473.915] * (-1472.294) (-1474.200) [-1473.488] (-1472.470) -- 0:00:49 243000 -- [-1473.152] (-1474.408) (-1479.713) (-1474.776) * (-1473.107) (-1474.221) [-1471.773] (-1472.538) -- 0:00:49 243500 -- [-1476.261] (-1479.829) (-1475.422) (-1474.981) * (-1475.194) (-1474.413) [-1472.352] (-1473.541) -- 0:00:49 244000 -- (-1478.715) (-1474.154) (-1476.211) [-1472.653] * (-1479.218) (-1473.969) (-1472.157) [-1472.634] -- 0:00:49 244500 -- (-1473.763) [-1474.346] (-1473.896) (-1475.938) * (-1479.843) (-1471.935) [-1473.078] (-1472.305) -- 0:00:49 245000 -- (-1473.593) [-1474.649] (-1474.409) (-1476.105) * (-1476.281) (-1475.748) [-1472.518] (-1473.770) -- 0:00:49 Average standard deviation of split frequencies: 0.013307 245500 -- [-1472.825] (-1473.182) (-1473.039) (-1474.561) * [-1474.303] (-1473.837) (-1472.689) (-1474.050) -- 0:00:49 246000 -- (-1472.633) (-1473.425) [-1473.708] (-1474.462) * [-1472.741] (-1481.527) (-1473.649) (-1474.469) -- 0:00:49 246500 -- (-1473.677) [-1473.197] (-1474.523) (-1475.037) * (-1472.851) (-1482.507) (-1475.683) [-1472.784] -- 0:00:48 247000 -- (-1473.733) [-1473.112] (-1473.405) (-1476.943) * [-1473.798] (-1476.920) (-1473.531) (-1473.050) -- 0:00:48 247500 -- (-1475.268) (-1472.997) [-1473.534] (-1476.068) * (-1474.585) [-1473.190] (-1475.091) (-1473.351) -- 0:00:48 248000 -- (-1472.012) (-1477.836) [-1473.216] (-1472.736) * (-1480.027) [-1474.186] (-1473.294) (-1473.076) -- 0:00:48 248500 -- [-1476.822] (-1475.849) (-1475.012) (-1472.225) * [-1482.198] (-1471.924) (-1475.233) (-1472.672) -- 0:00:48 249000 -- (-1473.664) [-1473.168] (-1476.381) (-1480.045) * (-1478.092) (-1473.691) (-1473.512) [-1473.532] -- 0:00:48 249500 -- [-1473.619] (-1476.617) (-1473.047) (-1473.773) * [-1477.284] (-1474.508) (-1473.961) (-1473.731) -- 0:00:48 250000 -- (-1474.705) [-1473.187] (-1473.827) (-1474.771) * [-1472.740] (-1472.515) (-1473.894) (-1473.920) -- 0:00:48 Average standard deviation of split frequencies: 0.012851 250500 -- [-1474.997] (-1472.023) (-1473.743) (-1472.426) * (-1475.994) (-1472.486) [-1472.608] (-1477.176) -- 0:00:47 251000 -- [-1474.006] (-1472.021) (-1474.740) (-1475.209) * (-1473.393) (-1472.910) (-1473.747) [-1473.419] -- 0:00:47 251500 -- (-1477.288) (-1474.319) [-1473.993] (-1472.544) * (-1473.107) (-1473.189) [-1475.070] (-1473.909) -- 0:00:47 252000 -- [-1477.138] (-1474.145) (-1473.218) (-1472.070) * (-1472.354) (-1475.044) (-1477.932) [-1474.136] -- 0:00:47 252500 -- (-1477.700) (-1475.212) [-1474.689] (-1473.431) * (-1475.198) [-1473.066] (-1474.061) (-1475.354) -- 0:00:47 253000 -- [-1476.045] (-1475.057) (-1476.834) (-1471.836) * (-1475.627) [-1474.079] (-1475.068) (-1476.176) -- 0:00:47 253500 -- (-1475.946) (-1475.826) [-1473.169] (-1472.657) * (-1474.299) [-1473.145] (-1478.708) (-1477.757) -- 0:00:47 254000 -- (-1477.967) (-1472.810) [-1474.003] (-1473.743) * (-1475.349) (-1472.575) (-1474.319) [-1474.618] -- 0:00:49 254500 -- (-1476.530) [-1472.756] (-1475.789) (-1473.690) * (-1473.515) (-1472.897) (-1474.363) [-1473.616] -- 0:00:49 255000 -- (-1475.118) (-1471.668) (-1477.292) [-1474.463] * (-1473.775) (-1475.899) (-1473.797) [-1472.556] -- 0:00:49 Average standard deviation of split frequencies: 0.011969 255500 -- (-1476.238) [-1472.037] (-1474.175) (-1472.854) * [-1474.664] (-1478.645) (-1475.777) (-1477.557) -- 0:00:49 256000 -- (-1475.580) (-1473.746) (-1473.486) [-1472.736] * (-1478.150) [-1474.757] (-1482.288) (-1476.567) -- 0:00:49 256500 -- (-1475.706) (-1472.599) (-1474.674) [-1473.658] * (-1476.357) [-1473.426] (-1477.219) (-1475.308) -- 0:00:49 257000 -- (-1475.706) [-1474.371] (-1474.477) (-1474.034) * [-1473.151] (-1472.768) (-1474.607) (-1475.104) -- 0:00:49 257500 -- (-1473.336) (-1472.159) [-1475.568] (-1477.307) * (-1473.484) (-1473.158) (-1476.211) [-1472.290] -- 0:00:49 258000 -- (-1474.072) (-1473.102) (-1480.598) [-1473.467] * [-1473.559] (-1474.582) (-1478.484) (-1473.133) -- 0:00:48 258500 -- (-1474.067) (-1474.020) [-1472.871] (-1473.498) * (-1472.640) (-1472.133) (-1472.675) [-1472.506] -- 0:00:48 259000 -- (-1475.201) (-1474.505) (-1471.871) [-1475.329] * (-1473.032) (-1472.532) (-1475.206) [-1473.193] -- 0:00:48 259500 -- (-1477.863) (-1476.701) [-1473.874] (-1478.688) * (-1474.469) (-1473.824) (-1476.544) [-1472.435] -- 0:00:48 260000 -- (-1473.211) (-1479.054) (-1472.050) [-1476.008] * (-1473.403) (-1474.546) [-1472.677] (-1474.756) -- 0:00:48 Average standard deviation of split frequencies: 0.010851 260500 -- [-1473.431] (-1475.652) (-1472.038) (-1475.387) * (-1472.937) (-1473.736) (-1472.779) [-1476.950] -- 0:00:48 261000 -- (-1481.225) [-1479.012] (-1472.095) (-1476.407) * (-1472.005) (-1474.682) [-1473.010] (-1473.031) -- 0:00:48 261500 -- (-1472.584) (-1473.208) [-1473.049] (-1473.038) * (-1472.139) (-1474.928) (-1473.572) [-1472.928] -- 0:00:48 262000 -- (-1482.259) (-1472.911) (-1476.067) [-1474.526] * (-1474.865) (-1473.126) (-1475.931) [-1472.197] -- 0:00:47 262500 -- (-1473.651) (-1474.097) (-1476.615) [-1474.263] * (-1472.515) (-1475.348) [-1475.407] (-1472.275) -- 0:00:47 263000 -- (-1475.127) [-1473.204] (-1475.939) (-1473.777) * (-1473.297) (-1471.707) (-1476.139) [-1472.215] -- 0:00:47 263500 -- (-1472.368) (-1473.160) (-1473.030) [-1472.144] * (-1472.655) (-1473.329) (-1476.596) [-1472.914] -- 0:00:47 264000 -- (-1472.665) (-1475.383) (-1471.780) [-1472.144] * (-1474.994) (-1474.082) (-1476.209) [-1473.408] -- 0:00:47 264500 -- (-1472.603) (-1477.898) [-1471.912] (-1474.275) * (-1473.621) [-1475.540] (-1472.896) (-1474.484) -- 0:00:47 265000 -- (-1473.402) [-1475.556] (-1472.555) (-1473.023) * (-1474.066) (-1476.761) [-1474.348] (-1474.099) -- 0:00:47 Average standard deviation of split frequencies: 0.011224 265500 -- [-1474.143] (-1476.117) (-1475.346) (-1474.610) * (-1473.823) [-1474.312] (-1474.858) (-1473.744) -- 0:00:47 266000 -- (-1474.872) [-1473.203] (-1473.553) (-1474.683) * (-1472.622) (-1472.078) (-1474.594) [-1473.378] -- 0:00:46 266500 -- [-1476.698] (-1475.818) (-1473.427) (-1476.213) * [-1472.429] (-1473.530) (-1472.750) (-1473.289) -- 0:00:46 267000 -- (-1472.427) [-1474.367] (-1472.535) (-1476.152) * (-1472.444) (-1473.176) (-1475.477) [-1472.675] -- 0:00:46 267500 -- [-1472.359] (-1474.339) (-1473.163) (-1476.074) * [-1474.037] (-1474.403) (-1475.652) (-1473.729) -- 0:00:46 268000 -- (-1472.356) (-1477.066) (-1473.149) [-1475.762] * [-1474.055] (-1473.798) (-1475.362) (-1472.119) -- 0:00:46 268500 -- (-1475.851) (-1480.496) (-1473.486) [-1478.469] * (-1472.288) (-1473.468) (-1478.420) [-1473.266] -- 0:00:46 269000 -- (-1476.246) (-1477.537) [-1473.822] (-1475.650) * (-1473.805) [-1472.460] (-1474.919) (-1473.758) -- 0:00:46 269500 -- (-1477.358) (-1475.038) [-1475.082] (-1474.152) * [-1473.586] (-1474.977) (-1474.045) (-1471.736) -- 0:00:46 270000 -- (-1474.819) (-1474.018) (-1479.461) [-1474.743] * (-1472.108) (-1480.864) (-1477.007) [-1472.783] -- 0:00:48 Average standard deviation of split frequencies: 0.012375 270500 -- [-1472.983] (-1475.808) (-1484.062) (-1475.867) * (-1471.994) (-1475.349) [-1475.879] (-1474.313) -- 0:00:48 271000 -- (-1471.627) (-1473.510) (-1483.402) [-1476.581] * [-1477.018] (-1475.443) (-1477.595) (-1476.018) -- 0:00:48 271500 -- (-1472.906) (-1472.508) [-1472.782] (-1475.131) * (-1477.946) [-1474.712] (-1476.632) (-1475.466) -- 0:00:48 272000 -- [-1473.719] (-1475.020) (-1472.797) (-1476.169) * (-1475.207) (-1473.218) (-1474.364) [-1471.626] -- 0:00:48 272500 -- (-1476.644) (-1473.766) [-1471.715] (-1474.526) * (-1473.630) (-1475.921) [-1473.780] (-1471.627) -- 0:00:48 273000 -- (-1472.933) [-1475.131] (-1473.723) (-1472.855) * [-1472.087] (-1476.813) (-1476.512) (-1472.811) -- 0:00:47 273500 -- (-1475.424) [-1472.998] (-1473.893) (-1482.095) * (-1473.290) (-1475.768) (-1474.062) [-1474.508] -- 0:00:47 274000 -- (-1475.669) (-1474.056) [-1472.726] (-1478.289) * (-1473.050) (-1474.473) (-1476.950) [-1473.480] -- 0:00:47 274500 -- (-1474.796) (-1475.039) [-1472.005] (-1478.851) * [-1472.617] (-1471.938) (-1475.319) (-1472.582) -- 0:00:47 275000 -- (-1472.004) (-1478.332) (-1472.522) [-1472.681] * (-1475.163) [-1475.109] (-1473.623) (-1472.722) -- 0:00:47 Average standard deviation of split frequencies: 0.012051 275500 -- (-1471.619) (-1479.861) (-1472.719) [-1474.019] * (-1473.514) (-1474.758) (-1473.307) [-1472.212] -- 0:00:47 276000 -- (-1473.165) (-1472.950) [-1474.975] (-1473.003) * (-1472.815) (-1474.043) [-1477.502] (-1472.842) -- 0:00:47 276500 -- (-1473.594) [-1472.986] (-1476.530) (-1471.886) * [-1472.388] (-1473.763) (-1476.957) (-1476.701) -- 0:00:47 277000 -- (-1476.083) [-1473.440] (-1474.940) (-1473.395) * (-1473.935) (-1475.429) (-1473.956) [-1474.622] -- 0:00:46 277500 -- (-1474.061) [-1473.414] (-1471.770) (-1472.529) * (-1473.646) [-1474.277] (-1473.029) (-1474.478) -- 0:00:46 278000 -- (-1474.592) (-1476.733) (-1474.864) [-1474.698] * (-1482.247) (-1473.796) (-1474.809) [-1473.069] -- 0:00:46 278500 -- (-1472.613) [-1474.296] (-1475.261) (-1472.395) * [-1475.712] (-1474.573) (-1480.337) (-1472.361) -- 0:00:46 279000 -- (-1477.361) (-1475.584) (-1475.212) [-1472.569] * [-1472.838] (-1474.836) (-1480.984) (-1472.942) -- 0:00:46 279500 -- [-1472.921] (-1474.664) (-1474.976) (-1475.855) * (-1473.647) [-1474.078] (-1478.907) (-1472.119) -- 0:00:46 280000 -- [-1472.847] (-1472.144) (-1477.154) (-1475.915) * (-1473.838) (-1474.061) (-1473.149) [-1473.136] -- 0:00:46 Average standard deviation of split frequencies: 0.012022 280500 -- (-1474.059) [-1472.166] (-1478.106) (-1473.947) * (-1476.075) (-1476.524) (-1474.366) [-1474.635] -- 0:00:46 281000 -- [-1472.454] (-1474.313) (-1477.236) (-1474.757) * (-1474.219) (-1475.118) [-1473.590] (-1471.978) -- 0:00:46 281500 -- (-1473.655) (-1473.886) (-1477.061) [-1477.156] * [-1473.179] (-1476.686) (-1473.596) (-1472.216) -- 0:00:45 282000 -- (-1475.020) (-1478.461) [-1479.032] (-1476.401) * [-1472.408] (-1471.771) (-1472.907) (-1476.054) -- 0:00:45 282500 -- (-1474.912) (-1481.264) [-1475.022] (-1476.689) * [-1472.424] (-1471.786) (-1474.596) (-1476.417) -- 0:00:45 283000 -- (-1476.572) (-1481.587) [-1472.318] (-1473.959) * (-1475.415) (-1473.067) [-1475.134] (-1475.277) -- 0:00:45 283500 -- (-1474.898) (-1473.523) (-1477.993) [-1473.276] * (-1476.361) [-1472.466] (-1473.523) (-1475.654) -- 0:00:45 284000 -- (-1474.648) (-1471.838) (-1474.530) [-1475.228] * (-1472.817) (-1472.398) (-1473.896) [-1474.835] -- 0:00:45 284500 -- (-1477.434) [-1473.040] (-1474.951) (-1475.800) * (-1471.603) (-1472.932) (-1472.379) [-1474.072] -- 0:00:45 285000 -- (-1473.431) (-1476.664) (-1472.842) [-1473.689] * (-1472.909) (-1474.054) [-1472.899] (-1475.471) -- 0:00:45 Average standard deviation of split frequencies: 0.011278 285500 -- [-1472.706] (-1478.323) (-1478.898) (-1474.603) * (-1472.671) (-1473.828) (-1473.232) [-1475.820] -- 0:00:45 286000 -- (-1472.943) (-1472.577) [-1474.446] (-1474.812) * (-1473.397) (-1475.626) (-1472.392) [-1474.550] -- 0:00:44 286500 -- [-1472.932] (-1472.581) (-1473.353) (-1474.338) * [-1476.999] (-1476.236) (-1472.633) (-1478.363) -- 0:00:47 287000 -- [-1482.681] (-1472.552) (-1474.231) (-1472.894) * (-1473.992) (-1474.558) (-1473.292) [-1475.197] -- 0:00:47 287500 -- (-1476.272) [-1473.603] (-1473.211) (-1474.320) * [-1475.154] (-1476.589) (-1474.040) (-1476.186) -- 0:00:47 288000 -- (-1475.543) (-1478.176) (-1473.635) [-1473.043] * (-1474.381) [-1471.892] (-1473.415) (-1475.311) -- 0:00:46 288500 -- (-1475.009) (-1473.108) (-1472.723) [-1473.354] * (-1475.193) (-1473.478) [-1474.232] (-1473.955) -- 0:00:46 289000 -- (-1474.242) (-1472.171) (-1473.629) [-1472.629] * (-1476.256) [-1475.277] (-1472.728) (-1474.270) -- 0:00:46 289500 -- (-1474.086) [-1472.102] (-1474.428) (-1472.869) * [-1474.674] (-1477.855) (-1476.047) (-1473.830) -- 0:00:46 290000 -- [-1473.282] (-1474.489) (-1474.284) (-1476.714) * [-1473.191] (-1476.850) (-1475.459) (-1473.009) -- 0:00:46 Average standard deviation of split frequencies: 0.011609 290500 -- (-1475.915) (-1472.749) (-1475.747) [-1474.647] * (-1473.960) [-1474.881] (-1473.792) (-1473.276) -- 0:00:46 291000 -- (-1474.152) (-1473.755) (-1474.771) [-1474.314] * [-1473.443] (-1476.910) (-1475.144) (-1475.101) -- 0:00:46 291500 -- [-1472.271] (-1476.537) (-1473.289) (-1473.480) * (-1473.010) [-1473.792] (-1474.903) (-1475.517) -- 0:00:46 292000 -- (-1473.677) [-1476.139] (-1473.154) (-1472.346) * (-1473.035) [-1472.144] (-1474.347) (-1474.357) -- 0:00:46 292500 -- (-1474.891) [-1472.539] (-1475.795) (-1473.948) * (-1471.975) [-1473.596] (-1474.189) (-1476.830) -- 0:00:45 293000 -- (-1476.304) (-1473.578) (-1474.056) [-1472.247] * (-1474.211) (-1473.428) (-1473.529) [-1479.242] -- 0:00:45 293500 -- [-1473.048] (-1478.594) (-1473.459) (-1473.640) * [-1473.852] (-1476.668) (-1474.152) (-1473.926) -- 0:00:45 294000 -- (-1473.732) [-1472.103] (-1474.501) (-1476.074) * [-1472.019] (-1475.550) (-1474.384) (-1476.668) -- 0:00:45 294500 -- (-1473.627) (-1473.949) [-1475.600] (-1474.791) * (-1478.637) [-1476.171] (-1473.538) (-1474.625) -- 0:00:45 295000 -- (-1474.054) (-1474.380) [-1473.393] (-1476.472) * (-1477.483) (-1474.319) [-1474.307] (-1475.744) -- 0:00:45 Average standard deviation of split frequencies: 0.012121 295500 -- (-1474.574) (-1474.611) (-1473.136) [-1474.400] * (-1476.060) [-1474.758] (-1474.598) (-1477.219) -- 0:00:45 296000 -- [-1475.113] (-1474.617) (-1478.647) (-1473.123) * (-1478.818) (-1474.005) (-1474.254) [-1474.119] -- 0:00:45 296500 -- (-1473.165) (-1480.658) (-1478.543) [-1472.962] * (-1475.086) (-1474.206) [-1474.917] (-1476.315) -- 0:00:45 297000 -- [-1472.644] (-1472.477) (-1474.783) (-1473.267) * [-1472.910] (-1476.271) (-1474.097) (-1479.321) -- 0:00:44 297500 -- [-1471.862] (-1474.216) (-1476.158) (-1473.109) * [-1474.669] (-1474.242) (-1472.473) (-1473.880) -- 0:00:44 298000 -- [-1473.698] (-1477.199) (-1476.025) (-1473.102) * (-1473.679) (-1475.391) [-1473.218] (-1475.830) -- 0:00:44 298500 -- (-1474.158) (-1478.113) (-1476.571) [-1474.054] * (-1472.396) (-1471.975) [-1472.521] (-1473.168) -- 0:00:44 299000 -- (-1472.580) [-1477.504] (-1475.321) (-1472.905) * [-1473.854] (-1472.286) (-1475.806) (-1476.197) -- 0:00:44 299500 -- [-1472.279] (-1476.735) (-1474.347) (-1473.495) * [-1473.060] (-1474.434) (-1476.130) (-1475.368) -- 0:00:44 300000 -- (-1472.721) [-1475.754] (-1473.661) (-1474.023) * (-1473.092) (-1472.423) [-1474.329] (-1472.909) -- 0:00:44 Average standard deviation of split frequencies: 0.013327 300500 -- (-1471.808) (-1472.528) (-1473.460) [-1471.620] * [-1472.058] (-1472.499) (-1474.899) (-1472.820) -- 0:00:44 301000 -- [-1471.654] (-1473.612) (-1479.384) (-1473.064) * (-1474.678) [-1472.375] (-1474.207) (-1472.723) -- 0:00:44 301500 -- (-1471.711) (-1472.930) (-1477.627) [-1471.736] * (-1475.910) (-1473.461) (-1475.086) [-1472.511] -- 0:00:44 302000 -- (-1473.342) (-1474.389) (-1472.571) [-1472.576] * (-1474.181) (-1472.745) [-1473.901] (-1473.206) -- 0:00:46 302500 -- (-1472.941) (-1477.007) [-1473.394] (-1472.389) * (-1473.064) [-1471.721] (-1475.738) (-1478.915) -- 0:00:46 303000 -- (-1473.454) (-1477.260) (-1478.136) [-1474.537] * [-1473.064] (-1472.454) (-1475.232) (-1478.822) -- 0:00:46 303500 -- (-1473.423) (-1476.360) [-1474.320] (-1472.399) * (-1475.889) (-1477.264) [-1473.148] (-1474.512) -- 0:00:45 304000 -- (-1472.916) (-1474.961) [-1472.738] (-1472.399) * [-1472.904] (-1475.523) (-1473.675) (-1474.138) -- 0:00:45 304500 -- (-1474.805) (-1471.773) [-1473.430] (-1472.833) * [-1473.700] (-1474.179) (-1474.028) (-1473.946) -- 0:00:45 305000 -- (-1475.409) [-1472.298] (-1473.238) (-1473.974) * (-1474.011) [-1474.771] (-1474.431) (-1472.431) -- 0:00:45 Average standard deviation of split frequencies: 0.011513 305500 -- (-1474.043) (-1481.330) [-1473.837] (-1473.859) * (-1471.854) [-1474.632] (-1475.114) (-1472.427) -- 0:00:45 306000 -- (-1472.722) (-1476.673) [-1474.223] (-1472.766) * [-1474.267] (-1473.866) (-1475.105) (-1473.192) -- 0:00:45 306500 -- (-1472.351) (-1476.080) [-1474.069] (-1477.378) * (-1474.931) (-1475.359) [-1473.986] (-1474.059) -- 0:00:45 307000 -- (-1473.068) [-1473.995] (-1474.408) (-1475.267) * (-1473.854) [-1474.416] (-1476.069) (-1473.612) -- 0:00:45 307500 -- (-1476.514) (-1474.627) (-1475.304) [-1474.045] * (-1472.322) (-1475.316) [-1473.325] (-1473.489) -- 0:00:45 308000 -- (-1472.701) [-1474.893] (-1476.094) (-1473.472) * (-1472.322) (-1473.302) [-1472.231] (-1473.371) -- 0:00:44 308500 -- [-1473.354] (-1474.893) (-1475.364) (-1472.242) * (-1473.750) (-1473.026) (-1474.159) [-1474.806] -- 0:00:44 309000 -- (-1475.258) [-1474.483] (-1475.754) (-1472.070) * (-1475.043) [-1472.368] (-1472.208) (-1474.283) -- 0:00:44 309500 -- (-1475.850) [-1474.359] (-1476.832) (-1472.009) * [-1473.372] (-1476.078) (-1476.301) (-1474.183) -- 0:00:44 310000 -- [-1473.201] (-1475.958) (-1474.667) (-1472.544) * [-1473.885] (-1476.535) (-1474.654) (-1474.613) -- 0:00:44 Average standard deviation of split frequencies: 0.011886 310500 -- [-1473.361] (-1476.379) (-1473.621) (-1474.901) * (-1471.723) (-1478.062) (-1474.562) [-1474.358] -- 0:00:44 311000 -- (-1473.378) (-1472.995) [-1473.571] (-1477.314) * (-1472.237) [-1475.652] (-1473.641) (-1474.973) -- 0:00:44 311500 -- (-1472.371) [-1475.814] (-1472.033) (-1475.373) * (-1472.237) [-1475.530] (-1474.450) (-1476.941) -- 0:00:44 312000 -- (-1475.297) (-1478.018) [-1473.430] (-1474.595) * [-1475.420] (-1474.973) (-1473.698) (-1472.894) -- 0:00:44 312500 -- (-1473.323) (-1476.065) (-1473.321) [-1475.694] * (-1472.488) [-1472.644] (-1476.179) (-1472.774) -- 0:00:44 313000 -- (-1472.837) (-1474.715) (-1472.373) [-1473.782] * [-1472.036] (-1473.466) (-1473.633) (-1473.174) -- 0:00:43 313500 -- (-1473.371) (-1477.088) [-1472.675] (-1472.398) * [-1473.634] (-1473.255) (-1473.519) (-1472.350) -- 0:00:43 314000 -- [-1475.223] (-1474.668) (-1477.633) (-1472.518) * (-1474.893) (-1472.632) [-1473.052] (-1475.332) -- 0:00:43 314500 -- [-1473.989] (-1475.450) (-1474.944) (-1472.407) * (-1475.431) (-1476.236) (-1474.085) [-1472.693] -- 0:00:43 315000 -- (-1472.889) [-1476.723] (-1472.801) (-1471.896) * (-1475.233) [-1472.910] (-1477.751) (-1474.024) -- 0:00:43 Average standard deviation of split frequencies: 0.012013 315500 -- (-1474.440) (-1477.243) (-1474.584) [-1471.840] * (-1475.068) [-1472.593] (-1475.636) (-1474.266) -- 0:00:43 316000 -- [-1473.253] (-1475.126) (-1475.159) (-1473.605) * [-1474.419] (-1474.066) (-1480.210) (-1473.423) -- 0:00:43 316500 -- [-1472.311] (-1475.621) (-1474.156) (-1474.712) * (-1473.871) (-1472.198) (-1478.459) [-1474.293] -- 0:00:43 317000 -- [-1473.415] (-1472.876) (-1474.155) (-1473.146) * (-1473.920) (-1472.457) [-1476.554] (-1473.535) -- 0:00:43 317500 -- [-1473.549] (-1473.245) (-1475.223) (-1472.538) * [-1473.291] (-1475.605) (-1473.505) (-1475.636) -- 0:00:42 318000 -- (-1476.449) (-1473.430) [-1473.572] (-1474.489) * (-1474.779) [-1478.007] (-1472.368) (-1475.022) -- 0:00:45 318500 -- (-1476.471) (-1477.358) (-1472.676) [-1474.271] * [-1474.260] (-1476.634) (-1472.461) (-1475.408) -- 0:00:44 319000 -- [-1475.442] (-1475.737) (-1477.143) (-1475.087) * (-1473.441) (-1473.180) (-1472.606) [-1473.604] -- 0:00:44 319500 -- (-1474.330) (-1477.105) [-1472.451] (-1473.254) * (-1472.895) [-1473.238] (-1472.680) (-1478.497) -- 0:00:44 320000 -- [-1473.784] (-1475.151) (-1473.472) (-1474.769) * (-1472.975) [-1474.430] (-1477.473) (-1478.033) -- 0:00:44 Average standard deviation of split frequencies: 0.011924 320500 -- (-1477.126) (-1474.553) (-1472.933) [-1474.215] * (-1475.412) [-1472.219] (-1474.082) (-1475.313) -- 0:00:44 321000 -- (-1475.522) [-1473.267] (-1472.374) (-1473.499) * (-1474.832) (-1473.915) [-1473.281] (-1474.413) -- 0:00:44 321500 -- (-1475.194) (-1473.193) (-1472.374) [-1473.146] * (-1477.148) (-1476.078) (-1473.817) [-1474.590] -- 0:00:44 322000 -- (-1473.465) (-1472.253) [-1472.081] (-1474.358) * (-1472.490) (-1476.392) [-1474.479] (-1474.777) -- 0:00:44 322500 -- (-1474.944) [-1473.337] (-1472.068) (-1474.172) * (-1475.748) (-1474.499) [-1474.123] (-1475.609) -- 0:00:44 323000 -- (-1476.724) [-1473.931] (-1472.535) (-1476.115) * (-1476.197) (-1475.271) (-1473.799) [-1472.348] -- 0:00:44 323500 -- (-1476.008) (-1476.821) (-1473.679) [-1476.283] * (-1476.609) (-1474.680) (-1471.904) [-1471.927] -- 0:00:43 324000 -- (-1473.819) [-1473.258] (-1476.463) (-1475.010) * (-1475.934) (-1473.909) (-1472.608) [-1479.174] -- 0:00:43 324500 -- [-1473.466] (-1472.045) (-1476.166) (-1472.519) * (-1475.431) [-1474.232] (-1472.102) (-1474.388) -- 0:00:43 325000 -- (-1473.200) (-1471.779) (-1477.166) [-1472.490] * [-1476.533] (-1474.894) (-1472.876) (-1473.794) -- 0:00:43 Average standard deviation of split frequencies: 0.011188 325500 -- [-1476.070] (-1472.797) (-1476.033) (-1472.740) * (-1475.808) [-1475.164] (-1472.667) (-1471.933) -- 0:00:43 326000 -- (-1473.659) (-1473.380) [-1475.053] (-1472.059) * (-1473.740) [-1473.660] (-1476.049) (-1472.403) -- 0:00:43 326500 -- (-1472.409) [-1472.359] (-1473.698) (-1471.923) * (-1473.484) (-1476.848) (-1473.953) [-1472.156] -- 0:00:43 327000 -- (-1475.039) (-1471.617) (-1473.345) [-1472.332] * (-1472.322) [-1473.593] (-1474.945) (-1471.909) -- 0:00:43 327500 -- (-1475.447) (-1476.147) [-1472.607] (-1474.560) * (-1473.465) (-1475.896) [-1477.779] (-1473.569) -- 0:00:43 328000 -- [-1472.373] (-1473.626) (-1472.968) (-1475.108) * [-1473.573] (-1472.874) (-1475.426) (-1473.143) -- 0:00:43 328500 -- [-1472.066] (-1471.808) (-1473.341) (-1472.111) * [-1473.979] (-1476.250) (-1474.715) (-1472.250) -- 0:00:42 329000 -- (-1472.577) [-1472.882] (-1473.343) (-1475.567) * (-1474.447) (-1474.472) [-1472.722] (-1471.732) -- 0:00:42 329500 -- (-1474.208) [-1474.500] (-1473.343) (-1476.560) * (-1474.264) [-1474.591] (-1477.229) (-1475.556) -- 0:00:42 330000 -- (-1472.523) (-1474.432) [-1472.374] (-1474.588) * [-1477.412] (-1472.768) (-1472.741) (-1473.970) -- 0:00:42 Average standard deviation of split frequencies: 0.011801 330500 -- [-1475.633] (-1471.977) (-1471.868) (-1474.293) * (-1475.196) (-1475.369) [-1472.585] (-1473.962) -- 0:00:42 331000 -- (-1474.551) (-1471.758) [-1472.017] (-1471.899) * (-1474.346) (-1473.335) (-1473.247) [-1475.731] -- 0:00:42 331500 -- (-1472.586) [-1475.343] (-1472.895) (-1472.255) * (-1475.950) (-1472.625) [-1472.660] (-1474.241) -- 0:00:42 332000 -- (-1472.475) (-1473.253) (-1473.919) [-1473.404] * [-1474.975] (-1472.618) (-1472.594) (-1474.109) -- 0:00:42 332500 -- [-1472.190] (-1476.585) (-1474.494) (-1472.591) * (-1474.632) (-1473.411) [-1472.968] (-1474.109) -- 0:00:42 333000 -- (-1473.251) (-1473.673) (-1473.279) [-1473.234] * (-1473.719) (-1475.528) [-1472.452] (-1475.783) -- 0:00:42 333500 -- (-1472.276) (-1472.801) (-1472.716) [-1474.532] * (-1474.242) (-1471.778) (-1472.459) [-1474.146] -- 0:00:41 334000 -- (-1475.386) (-1472.219) [-1472.671] (-1473.450) * (-1476.806) [-1474.630] (-1472.511) (-1475.519) -- 0:00:43 334500 -- [-1473.621] (-1473.757) (-1473.043) (-1471.775) * (-1477.228) (-1473.347) [-1473.743] (-1473.292) -- 0:00:43 335000 -- (-1472.846) [-1473.493] (-1472.430) (-1472.238) * [-1473.431] (-1477.655) (-1474.774) (-1476.013) -- 0:00:43 Average standard deviation of split frequencies: 0.011614 335500 -- [-1473.363] (-1477.733) (-1475.317) (-1472.351) * (-1481.577) (-1474.373) (-1474.641) [-1473.375] -- 0:00:43 336000 -- (-1473.682) (-1473.370) (-1473.126) [-1477.450] * [-1477.275] (-1475.613) (-1475.467) (-1476.381) -- 0:00:43 336500 -- (-1477.015) [-1474.369] (-1473.656) (-1477.175) * (-1478.820) (-1475.168) [-1472.428] (-1474.208) -- 0:00:43 337000 -- [-1473.015] (-1473.716) (-1472.185) (-1476.512) * [-1473.957] (-1474.194) (-1483.386) (-1473.293) -- 0:00:43 337500 -- [-1471.740] (-1474.716) (-1478.612) (-1473.352) * (-1473.289) (-1473.691) (-1481.389) [-1476.777] -- 0:00:43 338000 -- [-1475.109] (-1473.595) (-1479.614) (-1473.256) * [-1475.556] (-1472.477) (-1478.108) (-1475.958) -- 0:00:43 338500 -- (-1473.403) (-1474.060) (-1475.363) [-1474.394] * (-1475.295) [-1471.865] (-1472.706) (-1476.425) -- 0:00:42 339000 -- [-1472.633] (-1474.378) (-1474.750) (-1475.088) * (-1473.326) (-1471.631) (-1473.741) [-1475.738] -- 0:00:42 339500 -- (-1475.533) (-1473.317) [-1474.446] (-1472.748) * (-1473.433) [-1471.625] (-1474.778) (-1474.893) -- 0:00:42 340000 -- (-1475.808) (-1475.223) [-1474.246] (-1473.414) * [-1474.084] (-1471.996) (-1475.963) (-1475.639) -- 0:00:42 Average standard deviation of split frequencies: 0.012223 340500 -- (-1473.938) [-1473.338] (-1475.465) (-1473.475) * [-1473.480] (-1472.015) (-1476.051) (-1474.296) -- 0:00:42 341000 -- (-1476.723) (-1472.767) (-1473.754) [-1472.419] * (-1472.541) (-1476.275) [-1474.547] (-1472.963) -- 0:00:42 341500 -- (-1478.462) (-1472.346) (-1472.676) [-1475.024] * (-1472.482) [-1474.008] (-1478.008) (-1472.957) -- 0:00:42 342000 -- [-1473.610] (-1471.867) (-1473.611) (-1485.332) * [-1471.847] (-1471.915) (-1478.218) (-1473.693) -- 0:00:42 342500 -- (-1473.331) (-1472.224) (-1476.353) [-1474.218] * [-1474.282] (-1473.994) (-1474.654) (-1475.722) -- 0:00:42 343000 -- (-1472.483) [-1474.368] (-1476.704) (-1472.009) * (-1474.388) [-1472.870] (-1476.969) (-1474.550) -- 0:00:42 343500 -- (-1473.185) (-1472.508) (-1475.727) [-1476.018] * [-1473.870] (-1474.037) (-1474.543) (-1479.770) -- 0:00:42 344000 -- [-1473.311] (-1474.133) (-1472.803) (-1472.940) * (-1475.958) (-1476.104) (-1473.143) [-1474.483] -- 0:00:41 344500 -- (-1472.857) (-1471.815) (-1472.100) [-1475.011] * (-1476.163) (-1477.170) [-1473.223] (-1473.371) -- 0:00:41 345000 -- (-1473.294) [-1472.851] (-1471.826) (-1473.307) * (-1474.512) (-1475.969) (-1477.762) [-1473.537] -- 0:00:41 Average standard deviation of split frequencies: 0.011959 345500 -- [-1474.319] (-1473.242) (-1472.188) (-1472.713) * (-1474.248) (-1475.890) (-1473.598) [-1471.759] -- 0:00:41 346000 -- [-1477.856] (-1473.413) (-1472.574) (-1471.924) * (-1473.755) (-1473.192) (-1473.488) [-1471.487] -- 0:00:41 346500 -- (-1475.295) (-1473.413) (-1474.278) [-1472.974] * (-1475.111) [-1473.188] (-1473.175) (-1474.563) -- 0:00:41 347000 -- (-1473.772) [-1471.859] (-1472.528) (-1471.845) * [-1472.666] (-1474.094) (-1477.591) (-1474.414) -- 0:00:41 347500 -- [-1472.244] (-1472.345) (-1471.830) (-1471.561) * (-1472.702) [-1473.808] (-1477.521) (-1473.070) -- 0:00:41 348000 -- (-1472.526) [-1472.408] (-1475.439) (-1472.150) * [-1473.136] (-1475.522) (-1473.677) (-1474.018) -- 0:00:41 348500 -- (-1473.534) (-1471.695) (-1475.280) [-1471.946] * (-1472.605) (-1473.528) (-1473.490) [-1475.179] -- 0:00:41 349000 -- (-1475.563) (-1472.960) (-1474.698) [-1471.937] * (-1473.563) (-1473.986) (-1472.743) [-1476.084] -- 0:00:41 349500 -- (-1475.268) (-1474.694) [-1475.628] (-1472.888) * (-1472.501) (-1474.688) [-1473.101] (-1475.629) -- 0:00:40 350000 -- (-1474.703) [-1471.617] (-1475.494) (-1473.697) * (-1473.111) (-1474.155) (-1473.096) [-1473.534] -- 0:00:40 Average standard deviation of split frequencies: 0.012173 350500 -- (-1474.549) (-1471.749) [-1473.363] (-1474.404) * (-1474.450) [-1474.502] (-1472.649) (-1471.934) -- 0:00:42 351000 -- (-1475.678) (-1471.767) (-1473.838) [-1474.629] * (-1475.403) (-1473.363) (-1473.382) [-1471.907] -- 0:00:42 351500 -- (-1477.729) (-1478.586) [-1477.078] (-1473.078) * [-1474.599] (-1472.034) (-1475.544) (-1472.821) -- 0:00:42 352000 -- (-1473.591) [-1476.692] (-1472.988) (-1474.403) * (-1474.295) [-1477.907] (-1472.870) (-1474.156) -- 0:00:42 352500 -- (-1474.992) [-1477.105] (-1472.891) (-1474.175) * [-1475.390] (-1474.647) (-1474.855) (-1475.089) -- 0:00:42 353000 -- [-1474.397] (-1473.763) (-1473.305) (-1474.573) * [-1472.476] (-1476.689) (-1477.377) (-1475.548) -- 0:00:42 353500 -- (-1474.243) (-1472.188) [-1475.308] (-1472.811) * (-1473.709) [-1474.643] (-1472.417) (-1475.542) -- 0:00:42 354000 -- (-1475.259) (-1473.449) [-1478.081] (-1473.748) * (-1473.800) [-1472.844] (-1474.877) (-1475.234) -- 0:00:41 354500 -- [-1473.334] (-1473.680) (-1476.112) (-1473.830) * (-1473.544) (-1475.894) [-1476.004] (-1473.864) -- 0:00:41 355000 -- (-1473.026) (-1476.696) (-1476.627) [-1475.124] * [-1472.839] (-1475.757) (-1473.961) (-1473.477) -- 0:00:41 Average standard deviation of split frequencies: 0.012463 355500 -- (-1472.135) (-1477.326) (-1475.002) [-1473.514] * (-1473.045) (-1474.604) (-1476.044) [-1474.626] -- 0:00:41 356000 -- (-1472.678) (-1477.832) (-1474.149) [-1474.965] * (-1474.919) [-1473.604] (-1473.247) (-1472.760) -- 0:00:41 356500 -- (-1472.379) (-1474.785) [-1475.479] (-1473.194) * [-1475.091] (-1473.843) (-1472.861) (-1472.154) -- 0:00:41 357000 -- (-1472.134) (-1484.260) (-1472.229) [-1473.881] * (-1473.431) (-1475.379) [-1472.395] (-1473.178) -- 0:00:41 357500 -- (-1471.925) (-1473.862) [-1474.121] (-1474.335) * [-1473.114] (-1474.361) (-1473.595) (-1474.834) -- 0:00:41 358000 -- (-1475.630) (-1473.377) [-1473.964] (-1472.430) * (-1473.563) (-1476.804) [-1477.677] (-1474.546) -- 0:00:41 358500 -- [-1475.564] (-1473.503) (-1474.374) (-1473.815) * [-1473.530] (-1473.603) (-1477.599) (-1473.940) -- 0:00:41 359000 -- (-1474.556) (-1473.323) (-1475.476) [-1475.281] * [-1472.343] (-1475.266) (-1480.727) (-1474.964) -- 0:00:41 359500 -- (-1477.456) (-1472.773) (-1477.236) [-1474.257] * (-1473.814) (-1472.920) (-1474.628) [-1477.666] -- 0:00:40 360000 -- (-1477.962) (-1479.722) (-1476.316) [-1474.257] * (-1477.926) (-1473.425) (-1477.213) [-1474.378] -- 0:00:40 Average standard deviation of split frequencies: 0.011994 360500 -- (-1479.392) (-1479.955) [-1474.923] (-1476.334) * (-1478.523) (-1472.690) (-1477.066) [-1472.466] -- 0:00:40 361000 -- (-1477.309) (-1471.788) [-1473.406] (-1474.041) * [-1473.395] (-1473.450) (-1476.667) (-1475.042) -- 0:00:40 361500 -- (-1481.815) (-1472.344) [-1473.136] (-1473.968) * (-1476.437) [-1472.727] (-1476.344) (-1473.816) -- 0:00:40 362000 -- (-1472.772) (-1474.571) [-1474.446] (-1472.306) * [-1474.186] (-1473.246) (-1475.814) (-1473.706) -- 0:00:40 362500 -- (-1472.727) [-1472.334] (-1472.557) (-1473.231) * (-1473.746) (-1473.350) (-1476.278) [-1475.316] -- 0:00:40 363000 -- (-1474.531) [-1472.217] (-1474.081) (-1472.914) * (-1476.581) (-1473.858) (-1472.681) [-1471.892] -- 0:00:40 363500 -- (-1476.158) [-1472.789] (-1472.914) (-1478.667) * (-1478.101) [-1475.726] (-1472.039) (-1473.991) -- 0:00:40 364000 -- (-1481.903) (-1472.674) [-1473.162] (-1472.495) * (-1475.569) (-1475.949) (-1474.547) [-1472.708] -- 0:00:40 364500 -- (-1477.272) [-1472.987] (-1472.387) (-1472.947) * (-1477.899) (-1476.561) (-1475.509) [-1472.556] -- 0:00:40 365000 -- (-1474.361) (-1473.964) [-1476.147] (-1476.409) * (-1477.169) [-1474.756] (-1476.033) (-1475.040) -- 0:00:40 Average standard deviation of split frequencies: 0.011592 365500 -- (-1475.733) [-1474.779] (-1472.215) (-1473.108) * (-1476.122) (-1473.659) [-1474.189] (-1473.628) -- 0:00:39 366000 -- [-1473.275] (-1473.521) (-1473.687) (-1473.931) * [-1474.995] (-1474.823) (-1477.141) (-1473.520) -- 0:00:41 366500 -- (-1472.281) (-1473.440) [-1472.563] (-1478.027) * (-1472.818) [-1472.462] (-1473.370) (-1474.118) -- 0:00:41 367000 -- (-1471.901) (-1473.848) (-1472.423) [-1474.420] * (-1475.489) [-1472.413] (-1474.329) (-1474.543) -- 0:00:41 367500 -- (-1472.958) [-1473.384] (-1472.569) (-1475.144) * [-1472.429] (-1474.049) (-1475.473) (-1477.296) -- 0:00:41 368000 -- (-1473.439) [-1473.701] (-1473.631) (-1476.398) * (-1472.636) (-1472.343) [-1474.576] (-1477.407) -- 0:00:41 368500 -- (-1474.640) (-1475.943) [-1473.275] (-1472.050) * (-1475.035) (-1473.809) (-1472.018) [-1477.336] -- 0:00:41 369000 -- (-1473.392) (-1473.700) [-1474.528] (-1476.284) * [-1472.691] (-1473.401) (-1472.211) (-1478.057) -- 0:00:41 369500 -- (-1474.042) (-1472.567) (-1480.025) [-1473.438] * (-1476.025) (-1472.340) [-1472.538] (-1474.966) -- 0:00:40 370000 -- (-1474.783) [-1472.662] (-1476.505) (-1476.314) * (-1473.855) (-1472.540) [-1474.264] (-1473.892) -- 0:00:40 Average standard deviation of split frequencies: 0.011222 370500 -- (-1480.685) [-1475.098] (-1474.975) (-1472.492) * (-1474.914) (-1474.451) (-1474.207) [-1473.480] -- 0:00:40 371000 -- (-1477.559) (-1477.007) [-1475.303] (-1472.526) * (-1473.332) [-1472.620] (-1475.814) (-1472.315) -- 0:00:40 371500 -- (-1475.824) (-1474.051) (-1474.311) [-1472.545] * (-1473.536) (-1472.527) (-1474.033) [-1472.102] -- 0:00:40 372000 -- [-1473.617] (-1474.700) (-1474.238) (-1473.649) * [-1473.522] (-1474.553) (-1473.265) (-1473.818) -- 0:00:40 372500 -- (-1472.496) [-1473.477] (-1472.254) (-1472.904) * (-1476.312) (-1472.004) [-1473.270] (-1472.738) -- 0:00:40 373000 -- (-1474.552) (-1474.740) (-1474.167) [-1472.672] * (-1477.931) (-1472.796) (-1472.380) [-1473.136] -- 0:00:40 373500 -- (-1473.768) (-1474.673) (-1473.565) [-1472.977] * (-1472.485) [-1474.118] (-1473.724) (-1473.677) -- 0:00:40 374000 -- (-1473.759) (-1473.908) (-1474.000) [-1474.565] * (-1473.339) [-1475.157] (-1473.643) (-1477.707) -- 0:00:40 374500 -- (-1474.475) [-1473.929] (-1473.248) (-1475.385) * (-1473.243) (-1478.299) [-1476.077] (-1475.720) -- 0:00:40 375000 -- (-1473.049) [-1473.191] (-1473.401) (-1476.332) * (-1473.365) (-1474.926) (-1476.788) [-1473.538] -- 0:00:40 Average standard deviation of split frequencies: 0.011136 375500 -- (-1473.201) [-1472.261] (-1476.002) (-1476.020) * (-1475.056) (-1475.422) (-1475.382) [-1473.932] -- 0:00:39 376000 -- [-1471.651] (-1480.851) (-1475.857) (-1473.020) * (-1472.484) (-1474.210) [-1474.251] (-1472.268) -- 0:00:39 376500 -- [-1472.270] (-1475.487) (-1474.271) (-1472.630) * (-1475.628) (-1472.520) (-1481.293) [-1472.296] -- 0:00:39 377000 -- (-1474.755) (-1476.599) (-1474.051) [-1472.527] * [-1476.350] (-1473.574) (-1478.007) (-1473.755) -- 0:00:39 377500 -- [-1472.042] (-1475.479) (-1475.653) (-1472.443) * (-1474.560) [-1472.562] (-1475.302) (-1473.991) -- 0:00:39 378000 -- [-1472.395] (-1474.419) (-1475.081) (-1473.892) * (-1478.291) (-1476.976) (-1477.891) [-1474.645] -- 0:00:39 378500 -- (-1472.455) (-1473.188) (-1474.720) [-1474.037] * (-1474.470) (-1472.882) [-1475.801] (-1477.113) -- 0:00:39 379000 -- (-1473.488) (-1474.841) [-1474.739] (-1474.370) * [-1473.008] (-1476.014) (-1476.003) (-1478.491) -- 0:00:39 379500 -- (-1474.188) [-1474.446] (-1479.271) (-1473.115) * (-1473.080) (-1472.658) (-1473.481) [-1482.921] -- 0:00:39 380000 -- (-1473.570) (-1473.109) (-1475.431) [-1475.904] * (-1472.581) (-1472.354) [-1474.785] (-1480.390) -- 0:00:39 Average standard deviation of split frequencies: 0.010062 380500 -- (-1474.156) (-1473.596) (-1475.353) [-1476.844] * (-1473.077) [-1472.020] (-1474.699) (-1476.977) -- 0:00:39 381000 -- (-1476.434) [-1473.355] (-1473.990) (-1474.690) * (-1474.585) [-1471.924] (-1473.598) (-1478.089) -- 0:00:38 381500 -- [-1473.969] (-1478.664) (-1476.986) (-1474.897) * (-1474.130) [-1472.082] (-1473.024) (-1474.629) -- 0:00:38 382000 -- [-1472.502] (-1476.258) (-1472.519) (-1474.563) * (-1473.505) (-1472.254) [-1472.721] (-1475.363) -- 0:00:40 382500 -- (-1474.932) (-1472.563) [-1474.607] (-1473.564) * (-1473.443) (-1476.371) [-1472.675] (-1475.895) -- 0:00:40 383000 -- (-1472.760) (-1472.299) [-1472.366] (-1474.237) * (-1473.086) (-1475.168) (-1474.409) [-1475.950] -- 0:00:40 383500 -- [-1473.763] (-1471.763) (-1472.959) (-1478.876) * (-1473.969) (-1477.079) [-1475.059] (-1473.417) -- 0:00:40 384000 -- [-1473.496] (-1472.171) (-1474.035) (-1473.567) * [-1471.857] (-1477.813) (-1474.722) (-1472.090) -- 0:00:40 384500 -- (-1476.343) [-1472.158] (-1478.333) (-1473.874) * [-1475.621] (-1473.929) (-1473.727) (-1472.238) -- 0:00:40 385000 -- (-1475.801) [-1472.093] (-1474.247) (-1474.076) * (-1472.743) (-1472.840) [-1472.263] (-1471.994) -- 0:00:39 Average standard deviation of split frequencies: 0.009541 385500 -- (-1477.343) [-1472.880] (-1473.379) (-1476.660) * (-1472.758) (-1472.875) (-1473.741) [-1478.014] -- 0:00:39 386000 -- (-1475.418) (-1472.253) (-1472.169) [-1473.800] * (-1472.765) (-1472.859) [-1475.951] (-1473.649) -- 0:00:39 386500 -- (-1474.173) [-1472.112] (-1474.300) (-1476.638) * (-1472.252) (-1472.705) (-1475.798) [-1475.712] -- 0:00:39 387000 -- (-1473.971) (-1472.433) [-1472.857] (-1477.517) * (-1472.933) (-1472.848) [-1472.367] (-1473.837) -- 0:00:39 387500 -- [-1472.178] (-1471.931) (-1474.065) (-1477.852) * (-1472.915) (-1474.331) [-1473.700] (-1473.072) -- 0:00:39 388000 -- (-1479.699) [-1474.103] (-1472.889) (-1478.750) * (-1475.716) [-1476.166] (-1478.225) (-1473.451) -- 0:00:39 388500 -- (-1474.136) [-1474.716] (-1472.692) (-1473.676) * (-1475.509) (-1474.340) [-1473.936] (-1475.969) -- 0:00:39 389000 -- (-1476.540) (-1473.913) [-1472.262] (-1471.992) * (-1473.721) [-1473.475] (-1475.289) (-1472.103) -- 0:00:39 389500 -- (-1473.327) (-1474.537) [-1472.601] (-1471.894) * (-1473.826) [-1472.109] (-1475.076) (-1472.776) -- 0:00:39 390000 -- (-1476.926) [-1474.505] (-1474.463) (-1472.624) * [-1472.852] (-1472.385) (-1474.906) (-1473.296) -- 0:00:39 Average standard deviation of split frequencies: 0.009276 390500 -- [-1475.098] (-1472.502) (-1476.611) (-1471.643) * (-1474.513) [-1472.153] (-1473.594) (-1475.052) -- 0:00:39 391000 -- (-1478.491) (-1474.917) (-1479.840) [-1471.684] * (-1472.583) (-1471.971) (-1475.718) [-1476.510] -- 0:00:38 391500 -- (-1475.112) (-1472.433) (-1476.368) [-1471.677] * (-1474.619) (-1472.039) (-1477.664) [-1473.219] -- 0:00:38 392000 -- (-1479.144) (-1472.187) (-1474.104) [-1473.632] * (-1473.936) [-1474.058] (-1476.421) (-1471.605) -- 0:00:38 392500 -- (-1473.140) (-1472.569) [-1472.401] (-1473.560) * (-1473.493) (-1475.501) (-1474.431) [-1474.618] -- 0:00:38 393000 -- [-1473.205] (-1476.478) (-1472.300) (-1472.499) * (-1473.059) (-1476.856) [-1473.556] (-1476.239) -- 0:00:38 393500 -- (-1472.693) (-1475.717) [-1474.387] (-1472.994) * [-1473.857] (-1474.254) (-1472.937) (-1477.076) -- 0:00:38 394000 -- [-1472.981] (-1475.381) (-1473.373) (-1473.396) * (-1481.486) (-1474.917) (-1480.190) [-1474.854] -- 0:00:38 394500 -- [-1473.500] (-1477.635) (-1473.909) (-1473.060) * [-1474.219] (-1477.135) (-1472.945) (-1474.097) -- 0:00:38 395000 -- (-1479.592) [-1474.172] (-1472.892) (-1472.425) * (-1473.694) (-1473.185) [-1472.888] (-1476.101) -- 0:00:38 Average standard deviation of split frequencies: 0.008893 395500 -- (-1479.548) [-1472.410] (-1472.166) (-1475.639) * (-1472.734) (-1474.347) [-1472.755] (-1475.717) -- 0:00:38 396000 -- [-1474.470] (-1475.620) (-1472.782) (-1479.038) * [-1474.240] (-1472.928) (-1472.898) (-1475.681) -- 0:00:38 396500 -- [-1473.521] (-1474.832) (-1472.570) (-1473.003) * [-1474.758] (-1478.499) (-1472.194) (-1474.825) -- 0:00:38 397000 -- (-1473.737) (-1476.297) (-1472.742) [-1473.863] * (-1475.493) (-1476.586) [-1472.135] (-1471.848) -- 0:00:37 397500 -- (-1478.061) [-1472.573] (-1471.584) (-1473.275) * (-1472.236) (-1473.932) [-1475.885] (-1472.216) -- 0:00:37 398000 -- (-1475.185) (-1473.371) [-1473.140] (-1473.661) * (-1475.011) [-1473.965] (-1478.940) (-1472.421) -- 0:00:39 398500 -- [-1473.102] (-1473.194) (-1472.750) (-1477.791) * (-1485.275) (-1472.600) [-1473.114] (-1473.326) -- 0:00:39 399000 -- (-1472.989) (-1472.379) (-1472.761) [-1476.074] * (-1478.127) (-1473.460) [-1473.673] (-1472.340) -- 0:00:39 399500 -- [-1474.698] (-1474.258) (-1472.717) (-1476.759) * (-1475.447) (-1475.243) (-1476.985) [-1474.374] -- 0:00:39 400000 -- (-1477.725) [-1473.267] (-1473.048) (-1476.205) * (-1472.453) (-1473.288) (-1473.022) [-1477.584] -- 0:00:39 Average standard deviation of split frequencies: 0.008898 400500 -- (-1475.926) (-1477.006) (-1476.142) [-1476.301] * (-1473.504) [-1476.473] (-1475.072) (-1477.816) -- 0:00:38 401000 -- [-1475.815] (-1475.347) (-1474.411) (-1480.858) * (-1474.461) [-1474.941] (-1475.014) (-1472.608) -- 0:00:38 401500 -- (-1474.014) (-1472.341) [-1472.873] (-1473.464) * [-1474.615] (-1475.843) (-1475.541) (-1477.112) -- 0:00:38 402000 -- (-1476.600) (-1473.368) [-1472.266] (-1471.728) * [-1473.912] (-1474.258) (-1475.445) (-1475.234) -- 0:00:38 402500 -- (-1472.031) (-1477.027) (-1472.472) [-1473.938] * [-1472.678] (-1473.584) (-1473.324) (-1473.758) -- 0:00:38 403000 -- [-1472.317] (-1475.304) (-1472.837) (-1474.519) * (-1472.588) (-1471.861) [-1474.470] (-1474.697) -- 0:00:38 403500 -- (-1471.749) (-1475.792) [-1474.748] (-1475.950) * (-1473.400) (-1472.366) (-1472.585) [-1475.834] -- 0:00:38 404000 -- (-1476.386) [-1475.621] (-1472.382) (-1471.853) * (-1474.186) (-1472.660) [-1475.606] (-1474.785) -- 0:00:38 404500 -- (-1472.668) (-1476.805) (-1472.326) [-1474.664] * (-1474.374) (-1472.659) (-1482.232) [-1472.909] -- 0:00:38 405000 -- (-1474.716) [-1472.846] (-1474.821) (-1475.061) * [-1474.113] (-1473.026) (-1475.415) (-1473.491) -- 0:00:38 Average standard deviation of split frequencies: 0.009071 405500 -- [-1472.952] (-1472.007) (-1474.582) (-1473.465) * (-1474.113) (-1473.800) [-1473.603] (-1475.551) -- 0:00:38 406000 -- [-1473.706] (-1474.712) (-1473.879) (-1473.756) * [-1473.366] (-1472.681) (-1474.526) (-1477.248) -- 0:00:38 406500 -- [-1472.488] (-1475.428) (-1475.034) (-1474.434) * (-1476.314) (-1473.730) (-1475.128) [-1472.523] -- 0:00:37 407000 -- (-1473.454) (-1475.069) (-1475.223) [-1472.504] * (-1472.080) (-1476.713) (-1473.684) [-1473.195] -- 0:00:37 407500 -- (-1474.474) (-1474.808) [-1472.893] (-1475.547) * (-1476.488) (-1473.144) (-1474.912) [-1472.379] -- 0:00:37 408000 -- (-1472.523) [-1472.590] (-1473.389) (-1473.829) * (-1477.659) (-1474.938) [-1475.369] (-1473.548) -- 0:00:37 408500 -- (-1472.215) [-1473.873] (-1472.849) (-1477.404) * (-1472.693) (-1473.646) [-1474.979] (-1474.998) -- 0:00:37 409000 -- [-1472.796] (-1472.247) (-1471.986) (-1474.332) * (-1473.292) (-1472.961) [-1473.792] (-1473.832) -- 0:00:37 409500 -- [-1475.059] (-1476.069) (-1473.289) (-1472.350) * (-1476.366) (-1476.654) [-1472.295] (-1473.892) -- 0:00:37 410000 -- [-1473.331] (-1474.713) (-1476.006) (-1472.888) * (-1475.792) (-1475.159) [-1473.349] (-1474.235) -- 0:00:37 Average standard deviation of split frequencies: 0.008643 410500 -- (-1472.520) [-1473.817] (-1472.197) (-1472.644) * [-1475.941] (-1476.289) (-1473.706) (-1472.682) -- 0:00:37 411000 -- [-1475.102] (-1474.110) (-1473.176) (-1472.662) * (-1474.349) (-1474.693) [-1472.871] (-1475.361) -- 0:00:37 411500 -- (-1475.526) (-1476.163) (-1473.149) [-1474.154] * [-1472.670] (-1482.219) (-1472.597) (-1473.642) -- 0:00:37 412000 -- (-1474.675) [-1476.485] (-1475.412) (-1473.956) * [-1471.743] (-1474.083) (-1472.211) (-1474.862) -- 0:00:37 412500 -- (-1475.068) (-1473.722) (-1474.479) [-1477.613] * (-1471.764) (-1474.313) [-1471.825] (-1474.877) -- 0:00:37 413000 -- (-1471.916) (-1477.071) (-1479.013) [-1474.269] * (-1473.106) (-1474.022) [-1472.147] (-1474.182) -- 0:00:36 413500 -- [-1471.958] (-1474.078) (-1474.242) (-1474.804) * (-1473.261) (-1474.264) [-1472.754] (-1476.846) -- 0:00:36 414000 -- (-1471.669) (-1473.962) (-1473.933) [-1474.498] * (-1473.578) (-1472.359) [-1472.593] (-1474.808) -- 0:00:38 414500 -- [-1473.555] (-1473.821) (-1473.915) (-1474.986) * [-1473.327] (-1473.722) (-1472.323) (-1474.449) -- 0:00:38 415000 -- [-1474.948] (-1474.546) (-1474.791) (-1473.807) * [-1474.264] (-1472.984) (-1473.251) (-1472.979) -- 0:00:38 Average standard deviation of split frequencies: 0.009065 415500 -- [-1475.037] (-1471.778) (-1474.630) (-1473.519) * [-1475.984] (-1474.163) (-1472.432) (-1472.728) -- 0:00:37 416000 -- (-1475.725) (-1472.395) (-1475.832) [-1473.146] * (-1474.539) [-1474.405] (-1479.156) (-1475.903) -- 0:00:37 416500 -- (-1473.570) (-1476.384) (-1476.026) [-1477.478] * (-1473.527) (-1472.624) (-1472.786) [-1472.374] -- 0:00:37 417000 -- (-1473.565) (-1475.590) (-1475.943) [-1474.748] * (-1472.795) [-1472.087] (-1473.030) (-1474.354) -- 0:00:37 417500 -- (-1473.648) (-1473.614) (-1476.142) [-1474.842] * (-1474.645) (-1473.136) (-1476.173) [-1471.697] -- 0:00:37 418000 -- (-1475.658) (-1475.448) [-1481.207] (-1476.014) * [-1476.115] (-1477.606) (-1474.682) (-1471.809) -- 0:00:37 418500 -- [-1475.068] (-1475.169) (-1475.374) (-1475.588) * (-1477.267) (-1482.063) (-1471.912) [-1471.932] -- 0:00:37 419000 -- [-1472.157] (-1472.667) (-1473.297) (-1473.122) * [-1474.529] (-1480.500) (-1472.697) (-1474.642) -- 0:00:37 419500 -- (-1472.653) [-1474.860] (-1473.179) (-1473.919) * [-1473.199] (-1475.364) (-1472.953) (-1474.853) -- 0:00:37 420000 -- [-1472.467] (-1475.287) (-1475.772) (-1474.043) * [-1473.637] (-1474.070) (-1475.205) (-1474.089) -- 0:00:37 Average standard deviation of split frequencies: 0.008265 420500 -- (-1472.618) [-1475.516] (-1475.773) (-1476.464) * (-1471.919) (-1474.937) (-1475.930) [-1477.809] -- 0:00:37 421000 -- [-1472.677] (-1477.746) (-1472.865) (-1473.793) * (-1477.586) (-1473.199) [-1474.169] (-1476.525) -- 0:00:37 421500 -- (-1473.898) [-1474.336] (-1471.935) (-1471.733) * (-1476.508) (-1473.210) (-1474.291) [-1475.864] -- 0:00:37 422000 -- (-1474.302) (-1476.829) [-1471.935] (-1471.585) * (-1474.967) [-1473.863] (-1473.669) (-1472.632) -- 0:00:36 422500 -- (-1474.027) (-1473.454) (-1478.321) [-1472.434] * (-1474.724) (-1472.718) [-1473.302] (-1472.727) -- 0:00:36 423000 -- (-1475.309) [-1473.246] (-1475.301) (-1473.059) * [-1474.873] (-1473.693) (-1473.589) (-1474.070) -- 0:00:36 423500 -- (-1473.903) [-1474.404] (-1475.655) (-1479.044) * (-1472.027) (-1474.064) (-1472.206) [-1473.292] -- 0:00:36 424000 -- (-1474.613) (-1473.918) (-1474.639) [-1474.789] * [-1472.632] (-1471.949) (-1475.294) (-1472.184) -- 0:00:36 424500 -- [-1472.764] (-1473.836) (-1473.003) (-1472.183) * (-1472.827) (-1473.842) (-1474.620) [-1476.231] -- 0:00:36 425000 -- (-1473.459) (-1473.145) (-1473.556) [-1472.242] * (-1474.340) (-1472.946) [-1473.471] (-1475.833) -- 0:00:36 Average standard deviation of split frequencies: 0.008484 425500 -- (-1473.455) [-1474.528] (-1472.260) (-1473.332) * (-1474.287) (-1478.976) [-1472.345] (-1476.046) -- 0:00:36 426000 -- (-1477.204) (-1472.181) (-1472.004) [-1473.523] * (-1473.798) [-1473.516] (-1472.251) (-1473.824) -- 0:00:36 426500 -- (-1477.527) [-1472.704] (-1477.686) (-1472.522) * [-1473.952] (-1476.296) (-1473.182) (-1472.208) -- 0:00:36 427000 -- (-1473.444) [-1478.569] (-1475.523) (-1474.084) * (-1474.483) (-1474.948) (-1474.150) [-1472.818] -- 0:00:36 427500 -- (-1474.455) [-1472.135] (-1474.915) (-1472.313) * (-1474.888) (-1472.712) [-1472.458] (-1476.024) -- 0:00:36 428000 -- [-1474.514] (-1475.156) (-1473.450) (-1472.543) * (-1476.870) (-1472.601) (-1474.173) [-1472.430] -- 0:00:36 428500 -- (-1473.585) [-1475.761] (-1473.362) (-1478.325) * (-1474.570) [-1473.014] (-1474.574) (-1473.845) -- 0:00:36 429000 -- (-1476.304) (-1475.505) [-1475.114] (-1474.230) * (-1471.929) (-1472.637) (-1479.500) [-1473.176] -- 0:00:35 429500 -- (-1475.712) [-1474.149] (-1472.534) (-1474.147) * [-1472.674] (-1477.561) (-1477.203) (-1472.723) -- 0:00:35 430000 -- (-1474.001) (-1473.635) (-1474.283) [-1474.983] * [-1471.982] (-1474.896) (-1476.146) (-1472.566) -- 0:00:37 Average standard deviation of split frequencies: 0.008692 430500 -- (-1472.758) (-1478.682) [-1473.963] (-1475.580) * (-1475.413) (-1474.868) (-1473.348) [-1474.379] -- 0:00:37 431000 -- (-1473.508) (-1477.574) (-1474.356) [-1472.196] * (-1471.834) (-1477.415) (-1474.256) [-1475.637] -- 0:00:36 431500 -- (-1473.161) (-1473.202) [-1473.848] (-1472.381) * (-1476.216) (-1475.590) (-1473.735) [-1477.382] -- 0:00:36 432000 -- (-1473.130) (-1473.774) (-1476.845) [-1472.821] * (-1476.087) (-1472.823) (-1473.541) [-1472.054] -- 0:00:36 432500 -- [-1473.331] (-1476.051) (-1472.994) (-1472.308) * (-1477.165) (-1472.225) (-1476.658) [-1472.304] -- 0:00:36 433000 -- (-1473.883) [-1472.821] (-1476.221) (-1475.102) * [-1473.873] (-1472.762) (-1473.079) (-1472.349) -- 0:00:36 433500 -- (-1477.652) (-1473.016) (-1474.534) [-1474.075] * [-1473.388] (-1473.834) (-1473.504) (-1473.579) -- 0:00:36 434000 -- (-1473.490) [-1474.429] (-1475.235) (-1473.581) * (-1474.744) [-1473.179] (-1474.975) (-1475.336) -- 0:00:36 434500 -- (-1477.227) (-1474.390) [-1472.460] (-1473.858) * (-1474.770) (-1475.781) [-1471.993] (-1472.041) -- 0:00:36 435000 -- (-1473.347) (-1472.767) [-1472.426] (-1474.687) * [-1474.342] (-1473.846) (-1473.242) (-1472.061) -- 0:00:36 Average standard deviation of split frequencies: 0.008204 435500 -- (-1473.588) [-1475.290] (-1472.503) (-1472.699) * (-1472.760) (-1474.163) [-1475.615] (-1474.905) -- 0:00:36 436000 -- (-1473.207) (-1478.681) [-1474.745] (-1475.927) * [-1475.051] (-1478.982) (-1473.323) (-1474.536) -- 0:00:36 436500 -- (-1475.532) [-1473.413] (-1473.926) (-1472.976) * (-1474.791) (-1476.886) (-1474.693) [-1473.231] -- 0:00:36 437000 -- (-1473.522) (-1475.221) [-1475.085] (-1472.694) * (-1477.242) [-1473.980] (-1473.335) (-1473.501) -- 0:00:36 437500 -- (-1475.738) (-1474.656) (-1475.341) [-1472.767] * (-1475.169) [-1471.966] (-1474.787) (-1473.922) -- 0:00:36 438000 -- (-1473.632) (-1475.607) (-1474.191) [-1476.961] * (-1476.868) (-1475.303) [-1473.768] (-1472.223) -- 0:00:35 438500 -- (-1472.396) (-1476.463) (-1475.862) [-1475.070] * (-1472.389) (-1477.738) (-1475.142) [-1473.103] -- 0:00:35 439000 -- [-1472.394] (-1474.215) (-1476.499) (-1475.979) * (-1472.983) [-1473.985] (-1472.669) (-1477.364) -- 0:00:35 439500 -- (-1471.997) (-1482.383) [-1474.375] (-1473.908) * (-1472.549) [-1473.887] (-1472.165) (-1472.093) -- 0:00:35 440000 -- (-1472.009) (-1482.710) [-1472.990] (-1473.019) * (-1475.184) (-1474.300) (-1472.215) [-1472.296] -- 0:00:35 Average standard deviation of split frequencies: 0.008023 440500 -- (-1471.632) (-1474.768) [-1473.764] (-1474.032) * [-1475.214] (-1474.375) (-1474.008) (-1475.418) -- 0:00:35 441000 -- [-1472.841] (-1477.107) (-1472.835) (-1474.669) * (-1472.807) (-1476.040) [-1473.769] (-1476.946) -- 0:00:35 441500 -- (-1472.530) [-1472.227] (-1473.013) (-1474.111) * (-1475.003) (-1476.529) [-1475.606] (-1472.900) -- 0:00:35 442000 -- (-1472.837) (-1473.555) (-1474.307) [-1473.435] * (-1473.841) (-1475.909) (-1473.474) [-1473.389] -- 0:00:35 442500 -- (-1473.753) [-1474.941] (-1472.694) (-1472.408) * (-1474.739) [-1475.894] (-1473.824) (-1473.448) -- 0:00:35 443000 -- (-1473.750) [-1472.315] (-1472.491) (-1480.472) * [-1475.552] (-1474.988) (-1472.817) (-1473.144) -- 0:00:35 443500 -- (-1472.534) (-1473.811) [-1472.491] (-1477.835) * (-1477.144) (-1473.105) [-1475.630] (-1473.148) -- 0:00:35 444000 -- (-1474.076) (-1473.602) (-1472.367) [-1473.491] * (-1480.888) [-1471.866] (-1476.494) (-1471.811) -- 0:00:35 444500 -- [-1476.271] (-1475.415) (-1475.410) (-1472.819) * (-1475.308) [-1473.390] (-1472.306) (-1474.012) -- 0:00:34 445000 -- (-1475.712) [-1475.628] (-1475.348) (-1474.796) * (-1472.825) [-1473.494] (-1473.495) (-1472.605) -- 0:00:34 Average standard deviation of split frequencies: 0.008704 445500 -- (-1473.538) [-1474.502] (-1475.926) (-1477.311) * (-1471.992) (-1476.573) (-1473.864) [-1474.043] -- 0:00:34 446000 -- (-1474.118) (-1473.469) (-1472.382) [-1474.262] * (-1472.426) (-1473.742) (-1473.574) [-1473.478] -- 0:00:36 446500 -- (-1472.719) (-1475.889) [-1472.659] (-1475.119) * (-1472.448) (-1472.686) (-1473.206) [-1475.173] -- 0:00:35 447000 -- [-1472.970] (-1475.840) (-1473.582) (-1473.968) * (-1477.135) [-1473.922] (-1476.931) (-1477.358) -- 0:00:35 447500 -- [-1472.472] (-1473.274) (-1473.392) (-1472.241) * [-1475.450] (-1475.068) (-1477.688) (-1475.728) -- 0:00:35 448000 -- [-1480.133] (-1473.698) (-1474.474) (-1475.438) * [-1476.163] (-1475.394) (-1473.628) (-1472.996) -- 0:00:35 448500 -- (-1476.113) (-1476.536) [-1474.580] (-1478.049) * (-1473.081) (-1474.715) (-1474.118) [-1473.982] -- 0:00:35 449000 -- (-1472.902) [-1472.993] (-1474.654) (-1476.366) * (-1473.412) (-1473.147) [-1474.856] (-1473.523) -- 0:00:35 449500 -- [-1474.786] (-1473.493) (-1474.750) (-1477.063) * (-1475.505) (-1473.501) [-1475.173] (-1476.615) -- 0:00:35 450000 -- (-1474.575) (-1474.649) (-1473.581) [-1474.230] * (-1476.705) (-1473.947) [-1473.029] (-1476.162) -- 0:00:35 Average standard deviation of split frequencies: 0.008891 450500 -- (-1474.584) [-1473.360] (-1473.317) (-1472.453) * (-1475.270) [-1472.627] (-1474.273) (-1474.749) -- 0:00:35 451000 -- (-1472.784) [-1473.151] (-1473.228) (-1473.946) * [-1473.393] (-1472.266) (-1479.120) (-1479.341) -- 0:00:35 451500 -- (-1474.983) (-1473.660) [-1475.412] (-1474.767) * (-1471.644) [-1472.814] (-1482.214) (-1475.647) -- 0:00:35 452000 -- (-1475.865) [-1473.437] (-1477.999) (-1471.874) * [-1471.918] (-1477.841) (-1480.513) (-1476.598) -- 0:00:35 452500 -- (-1474.160) (-1473.371) (-1478.739) [-1473.358] * (-1472.098) (-1477.919) (-1476.284) [-1473.604] -- 0:00:35 453000 -- [-1474.213] (-1475.410) (-1473.829) (-1473.222) * (-1473.105) (-1472.386) [-1475.827] (-1474.079) -- 0:00:35 453500 -- (-1474.770) (-1473.099) [-1474.110] (-1472.549) * (-1474.331) (-1472.681) [-1473.949] (-1475.797) -- 0:00:34 454000 -- (-1474.242) [-1474.629] (-1472.938) (-1473.025) * (-1476.282) (-1473.861) [-1475.618] (-1476.650) -- 0:00:34 454500 -- (-1474.114) (-1474.603) [-1472.851] (-1473.179) * [-1474.762] (-1473.132) (-1475.626) (-1476.253) -- 0:00:34 455000 -- [-1472.017] (-1480.722) (-1472.314) (-1473.103) * (-1473.600) (-1473.205) [-1475.994] (-1473.515) -- 0:00:34 Average standard deviation of split frequencies: 0.009486 455500 -- (-1471.860) (-1479.883) (-1475.119) [-1472.074] * [-1472.181] (-1475.186) (-1473.031) (-1473.551) -- 0:00:34 456000 -- [-1473.087] (-1476.765) (-1473.875) (-1474.729) * (-1471.872) (-1476.724) (-1472.980) [-1472.281] -- 0:00:34 456500 -- (-1473.151) (-1473.632) (-1475.593) [-1474.356] * (-1473.961) (-1474.610) (-1472.978) [-1473.137] -- 0:00:34 457000 -- (-1475.343) [-1475.459] (-1479.213) (-1474.259) * [-1475.822] (-1472.516) (-1472.106) (-1474.656) -- 0:00:34 457500 -- (-1474.291) [-1476.660] (-1473.136) (-1475.718) * (-1477.705) (-1472.785) (-1473.808) [-1474.549] -- 0:00:34 458000 -- (-1473.963) [-1475.139] (-1473.409) (-1475.860) * (-1480.128) (-1473.400) (-1472.397) [-1475.302] -- 0:00:34 458500 -- (-1474.433) [-1476.847] (-1473.420) (-1473.657) * [-1476.877] (-1473.645) (-1472.433) (-1474.052) -- 0:00:34 459000 -- (-1473.785) (-1476.190) (-1474.275) [-1471.775] * (-1476.499) [-1473.696] (-1473.117) (-1474.210) -- 0:00:34 459500 -- [-1472.672] (-1476.693) (-1472.980) (-1472.578) * [-1473.931] (-1472.675) (-1473.088) (-1472.729) -- 0:00:34 460000 -- (-1472.940) (-1475.275) [-1474.016] (-1473.681) * (-1471.696) (-1471.689) (-1472.762) [-1472.711] -- 0:00:34 Average standard deviation of split frequencies: 0.009872 460500 -- (-1477.479) (-1476.186) [-1474.015] (-1473.960) * [-1472.301] (-1473.513) (-1475.937) (-1472.123) -- 0:00:33 461000 -- [-1474.485] (-1473.513) (-1473.427) (-1472.651) * (-1472.838) (-1472.666) (-1477.928) [-1472.122] -- 0:00:33 461500 -- (-1476.064) (-1472.983) (-1474.589) [-1472.374] * (-1473.733) (-1472.875) [-1473.490] (-1473.945) -- 0:00:33 462000 -- (-1474.137) (-1474.528) (-1472.874) [-1471.953] * (-1476.214) (-1474.081) (-1475.156) [-1479.397] -- 0:00:34 462500 -- [-1474.316] (-1475.940) (-1476.975) (-1473.752) * [-1474.629] (-1473.018) (-1475.602) (-1473.652) -- 0:00:34 463000 -- [-1472.994] (-1473.873) (-1475.383) (-1472.777) * (-1474.239) (-1474.670) [-1471.904] (-1473.675) -- 0:00:34 463500 -- [-1472.719] (-1474.847) (-1481.375) (-1472.307) * (-1478.051) (-1473.298) [-1474.456] (-1474.040) -- 0:00:34 464000 -- (-1476.120) (-1473.845) (-1478.759) [-1473.327] * (-1480.146) (-1474.613) (-1472.951) [-1473.030] -- 0:00:34 464500 -- (-1474.720) [-1472.872] (-1474.831) (-1473.375) * [-1478.194] (-1472.662) (-1477.202) (-1476.814) -- 0:00:34 465000 -- [-1475.091] (-1474.291) (-1476.481) (-1474.264) * (-1473.103) (-1473.570) [-1476.764] (-1476.265) -- 0:00:34 Average standard deviation of split frequencies: 0.010771 465500 -- (-1478.191) [-1472.663] (-1474.414) (-1474.193) * (-1473.053) (-1473.028) [-1475.191] (-1476.584) -- 0:00:34 466000 -- [-1473.130] (-1474.223) (-1474.063) (-1474.647) * (-1472.225) (-1473.789) (-1472.709) [-1472.347] -- 0:00:34 466500 -- (-1474.231) (-1472.471) (-1473.522) [-1474.386] * (-1472.681) (-1474.529) [-1472.700] (-1474.689) -- 0:00:34 467000 -- (-1472.112) [-1473.396] (-1473.915) (-1473.667) * (-1478.449) (-1472.186) [-1472.667] (-1473.996) -- 0:00:34 467500 -- (-1474.195) [-1473.078] (-1471.961) (-1474.578) * (-1478.794) [-1474.180] (-1473.016) (-1474.546) -- 0:00:34 468000 -- (-1473.004) [-1472.168] (-1473.033) (-1474.131) * (-1475.561) (-1473.003) (-1474.483) [-1473.487] -- 0:00:34 468500 -- (-1473.624) (-1474.663) (-1474.256) [-1472.613] * (-1473.049) [-1474.258] (-1472.661) (-1476.414) -- 0:00:34 469000 -- (-1473.700) (-1473.853) (-1474.662) [-1473.033] * (-1472.336) [-1472.271] (-1471.853) (-1476.273) -- 0:00:33 469500 -- (-1475.328) [-1475.227] (-1476.295) (-1474.995) * (-1475.160) [-1473.529] (-1473.969) (-1474.314) -- 0:00:33 470000 -- (-1485.161) (-1473.168) [-1473.622] (-1474.927) * [-1473.637] (-1473.123) (-1474.496) (-1472.597) -- 0:00:33 Average standard deviation of split frequencies: 0.010958 470500 -- [-1481.168] (-1472.401) (-1472.200) (-1476.514) * (-1475.144) [-1474.554] (-1475.045) (-1474.832) -- 0:00:33 471000 -- (-1474.617) [-1472.898] (-1471.816) (-1472.641) * (-1473.139) (-1475.398) (-1474.354) [-1473.874] -- 0:00:33 471500 -- [-1475.360] (-1474.373) (-1471.853) (-1475.206) * [-1471.862] (-1475.502) (-1476.326) (-1473.916) -- 0:00:33 472000 -- (-1477.793) [-1473.973] (-1472.561) (-1475.208) * (-1472.923) [-1471.982] (-1474.044) (-1473.005) -- 0:00:33 472500 -- (-1472.138) [-1472.943] (-1473.546) (-1476.001) * (-1473.897) (-1474.411) (-1473.893) [-1473.671] -- 0:00:33 473000 -- (-1472.568) (-1474.258) (-1475.355) [-1473.720] * (-1476.445) (-1474.517) [-1471.891] (-1474.323) -- 0:00:33 473500 -- (-1472.581) [-1471.804] (-1473.475) (-1472.785) * (-1472.260) [-1474.066] (-1471.639) (-1473.314) -- 0:00:33 474000 -- [-1472.731] (-1474.515) (-1478.299) (-1471.963) * (-1475.914) [-1476.067] (-1475.659) (-1473.640) -- 0:00:33 474500 -- (-1474.706) (-1472.685) [-1474.856] (-1472.695) * (-1474.590) [-1472.464] (-1473.322) (-1473.719) -- 0:00:33 475000 -- [-1473.703] (-1473.771) (-1476.922) (-1473.454) * (-1472.593) (-1473.779) (-1472.104) [-1473.385] -- 0:00:33 Average standard deviation of split frequencies: 0.010777 475500 -- (-1474.320) (-1472.178) [-1474.671] (-1474.654) * [-1473.912] (-1473.316) (-1473.325) (-1472.520) -- 0:00:33 476000 -- (-1473.560) (-1473.979) [-1473.895] (-1471.936) * (-1473.737) (-1473.394) [-1474.640] (-1475.205) -- 0:00:33 476500 -- [-1474.681] (-1475.038) (-1473.506) (-1474.276) * [-1473.289] (-1471.938) (-1479.847) (-1473.373) -- 0:00:32 477000 -- (-1474.312) (-1479.985) (-1475.354) [-1472.430] * [-1473.079] (-1473.504) (-1477.772) (-1472.705) -- 0:00:32 477500 -- (-1475.091) (-1478.408) [-1472.267] (-1474.001) * (-1471.906) (-1473.745) (-1474.922) [-1472.889] -- 0:00:32 478000 -- (-1474.968) [-1475.731] (-1473.739) (-1472.326) * [-1475.597] (-1473.412) (-1475.132) (-1473.056) -- 0:00:33 478500 -- (-1476.458) (-1475.816) (-1472.705) [-1474.997] * (-1475.060) [-1473.498] (-1473.268) (-1474.973) -- 0:00:33 479000 -- [-1475.081] (-1476.972) (-1476.059) (-1476.742) * (-1475.135) (-1473.589) (-1474.195) [-1477.320] -- 0:00:33 479500 -- (-1473.584) [-1472.439] (-1473.761) (-1479.216) * (-1474.435) (-1476.181) (-1472.285) [-1478.266] -- 0:00:33 480000 -- (-1476.403) [-1472.413] (-1474.538) (-1475.265) * [-1475.599] (-1474.121) (-1475.162) (-1476.038) -- 0:00:33 Average standard deviation of split frequencies: 0.010788 480500 -- (-1474.957) (-1473.884) (-1477.335) [-1473.335] * (-1476.228) (-1475.195) [-1472.843] (-1472.309) -- 0:00:33 481000 -- (-1473.456) (-1473.018) [-1472.860] (-1474.004) * (-1476.516) (-1475.099) (-1473.777) [-1472.186] -- 0:00:33 481500 -- [-1473.885] (-1473.117) (-1475.100) (-1477.016) * (-1473.577) (-1475.433) [-1472.245] (-1477.493) -- 0:00:33 482000 -- (-1474.101) (-1472.878) [-1474.998] (-1472.393) * (-1473.255) (-1473.604) (-1472.706) [-1474.350] -- 0:00:33 482500 -- [-1476.273] (-1475.232) (-1473.130) (-1472.172) * (-1471.437) [-1475.269] (-1476.487) (-1477.968) -- 0:00:33 483000 -- (-1479.250) [-1473.032] (-1476.222) (-1476.045) * [-1472.152] (-1474.560) (-1476.293) (-1474.768) -- 0:00:33 483500 -- (-1473.092) [-1472.506] (-1475.321) (-1475.867) * [-1471.653] (-1477.863) (-1473.674) (-1482.476) -- 0:00:33 484000 -- (-1475.089) (-1473.291) [-1473.694] (-1476.742) * (-1472.061) (-1473.291) [-1473.642] (-1472.847) -- 0:00:33 484500 -- (-1475.566) [-1475.904] (-1480.392) (-1475.009) * [-1474.005] (-1474.533) (-1475.303) (-1473.530) -- 0:00:32 485000 -- (-1481.230) (-1472.178) (-1472.469) [-1474.600] * (-1474.475) [-1479.054] (-1473.500) (-1477.592) -- 0:00:32 Average standard deviation of split frequencies: 0.010727 485500 -- (-1474.140) (-1473.799) [-1477.354] (-1477.614) * (-1481.737) (-1486.807) [-1472.629] (-1474.911) -- 0:00:32 486000 -- (-1475.232) [-1473.631] (-1479.762) (-1477.647) * [-1473.706] (-1482.432) (-1473.472) (-1475.103) -- 0:00:32 486500 -- [-1473.043] (-1474.072) (-1476.141) (-1473.875) * (-1473.619) [-1474.306] (-1476.735) (-1476.077) -- 0:00:32 487000 -- (-1475.588) [-1473.647] (-1473.188) (-1477.271) * [-1474.769] (-1473.799) (-1474.091) (-1473.346) -- 0:00:32 487500 -- [-1472.173] (-1474.384) (-1472.340) (-1473.349) * (-1473.335) (-1474.924) [-1474.329] (-1475.529) -- 0:00:32 488000 -- (-1472.237) [-1475.016] (-1472.751) (-1474.350) * [-1472.716] (-1472.761) (-1474.548) (-1473.314) -- 0:00:32 488500 -- (-1471.983) [-1475.052] (-1474.677) (-1475.659) * (-1472.388) [-1473.033] (-1473.550) (-1472.466) -- 0:00:32 489000 -- (-1473.285) (-1473.097) (-1474.711) [-1472.952] * (-1475.358) [-1474.528] (-1473.540) (-1473.360) -- 0:00:32 489500 -- (-1472.007) (-1475.553) [-1474.776] (-1473.861) * (-1473.511) (-1476.023) (-1472.738) [-1472.293] -- 0:00:32 490000 -- (-1472.330) (-1473.832) [-1472.432] (-1473.079) * [-1473.152] (-1475.738) (-1473.821) (-1473.651) -- 0:00:32 Average standard deviation of split frequencies: 0.011303 490500 -- (-1472.731) (-1473.735) [-1475.514] (-1472.674) * (-1474.819) (-1472.888) (-1473.766) [-1474.372] -- 0:00:32 491000 -- (-1472.123) (-1473.728) (-1473.394) [-1472.413] * (-1474.805) (-1473.948) (-1473.917) [-1474.952] -- 0:00:32 491500 -- [-1473.311] (-1472.314) (-1472.593) (-1472.953) * (-1476.090) (-1473.453) [-1479.219] (-1474.819) -- 0:00:32 492000 -- (-1475.824) (-1475.785) [-1473.637] (-1472.536) * (-1476.332) (-1473.652) (-1474.381) [-1472.883] -- 0:00:32 492500 -- (-1475.285) (-1475.690) [-1473.643] (-1473.046) * (-1473.975) [-1473.899] (-1475.033) (-1477.465) -- 0:00:31 493000 -- [-1474.523] (-1474.040) (-1473.729) (-1473.242) * (-1473.357) [-1473.661] (-1471.951) (-1475.572) -- 0:00:31 493500 -- [-1474.137] (-1474.618) (-1472.339) (-1472.976) * (-1474.083) (-1474.178) (-1475.768) [-1473.444] -- 0:00:31 494000 -- (-1474.683) (-1476.860) [-1472.160] (-1477.005) * (-1472.945) (-1476.208) [-1477.081] (-1474.135) -- 0:00:32 494500 -- (-1474.900) (-1472.541) (-1474.545) [-1472.781] * [-1474.440] (-1473.344) (-1476.127) (-1475.920) -- 0:00:32 495000 -- [-1474.876] (-1474.934) (-1474.619) (-1475.568) * [-1475.254] (-1474.683) (-1475.214) (-1476.296) -- 0:00:32 Average standard deviation of split frequencies: 0.011908 495500 -- (-1475.798) [-1474.237] (-1475.942) (-1474.453) * (-1473.274) (-1476.377) (-1477.131) [-1478.291] -- 0:00:32 496000 -- [-1475.619] (-1476.122) (-1475.945) (-1472.653) * (-1473.351) (-1475.249) (-1481.122) [-1476.197] -- 0:00:32 496500 -- (-1474.435) [-1477.319] (-1474.672) (-1473.839) * [-1476.231] (-1474.784) (-1476.958) (-1472.883) -- 0:00:32 497000 -- [-1476.023] (-1476.930) (-1473.734) (-1474.102) * (-1472.957) (-1481.756) [-1473.703] (-1473.935) -- 0:00:32 497500 -- (-1473.583) (-1473.900) (-1475.095) [-1473.412] * [-1474.633] (-1476.318) (-1473.723) (-1472.035) -- 0:00:32 498000 -- (-1473.453) [-1476.035] (-1475.837) (-1474.837) * [-1474.473] (-1472.935) (-1472.469) (-1478.843) -- 0:00:32 498500 -- [-1472.564] (-1473.632) (-1474.927) (-1476.140) * [-1472.005] (-1475.042) (-1475.867) (-1473.370) -- 0:00:32 499000 -- (-1472.296) (-1477.120) (-1476.194) [-1474.358] * [-1472.701] (-1475.306) (-1474.995) (-1473.997) -- 0:00:32 499500 -- (-1475.703) (-1473.524) [-1474.512] (-1474.172) * (-1474.879) [-1471.991] (-1475.555) (-1472.977) -- 0:00:32 500000 -- (-1473.188) [-1475.441] (-1473.651) (-1472.554) * (-1475.158) (-1472.219) (-1475.914) [-1473.296] -- 0:00:32 Average standard deviation of split frequencies: 0.012115 500500 -- (-1472.192) [-1471.839] (-1474.347) (-1473.954) * (-1473.524) (-1473.514) (-1474.166) [-1474.063] -- 0:00:31 501000 -- (-1472.609) (-1473.419) (-1480.653) [-1473.240] * (-1472.426) [-1473.214] (-1473.040) (-1476.173) -- 0:00:31 501500 -- (-1472.435) [-1474.291] (-1472.924) (-1476.561) * [-1474.007] (-1475.067) (-1475.210) (-1475.817) -- 0:00:31 502000 -- (-1473.968) (-1475.245) [-1473.828] (-1474.909) * [-1474.589] (-1474.029) (-1474.210) (-1473.189) -- 0:00:31 502500 -- (-1474.487) (-1473.003) (-1473.991) [-1477.615] * (-1474.518) (-1473.419) [-1473.464] (-1473.701) -- 0:00:31 503000 -- (-1474.395) (-1474.279) [-1474.010] (-1474.198) * [-1474.648] (-1477.360) (-1473.482) (-1474.037) -- 0:00:31 503500 -- [-1473.796] (-1472.815) (-1473.479) (-1473.757) * (-1473.432) [-1475.349] (-1474.810) (-1474.620) -- 0:00:31 504000 -- (-1473.593) (-1472.561) (-1473.125) [-1473.539] * [-1473.390] (-1476.388) (-1475.570) (-1476.099) -- 0:00:31 504500 -- (-1473.325) (-1476.445) (-1473.334) [-1473.733] * (-1474.727) (-1473.667) (-1474.820) [-1476.922] -- 0:00:31 505000 -- [-1473.915] (-1472.132) (-1474.461) (-1475.532) * (-1475.453) (-1473.478) (-1476.228) [-1473.801] -- 0:00:31 Average standard deviation of split frequencies: 0.012002 505500 -- (-1472.464) (-1473.135) (-1473.432) [-1472.418] * [-1473.979] (-1475.133) (-1472.935) (-1474.977) -- 0:00:31 506000 -- (-1475.602) (-1473.227) [-1474.653] (-1472.413) * (-1472.674) (-1474.510) (-1472.670) [-1476.401] -- 0:00:31 506500 -- [-1476.872] (-1472.447) (-1476.184) (-1472.580) * [-1472.550] (-1471.572) (-1473.731) (-1472.667) -- 0:00:31 507000 -- (-1473.683) (-1472.162) (-1476.326) [-1475.024] * (-1472.400) [-1472.222] (-1472.847) (-1475.970) -- 0:00:31 507500 -- [-1473.653] (-1472.158) (-1475.276) (-1474.589) * [-1472.636] (-1475.149) (-1472.050) (-1475.277) -- 0:00:31 508000 -- (-1474.644) (-1472.378) [-1474.480] (-1474.136) * [-1472.637] (-1477.366) (-1472.011) (-1473.942) -- 0:00:30 508500 -- [-1474.166] (-1472.887) (-1474.697) (-1473.021) * [-1474.540] (-1481.032) (-1476.564) (-1472.488) -- 0:00:30 509000 -- (-1474.058) [-1471.891] (-1476.301) (-1475.941) * (-1476.029) [-1485.846] (-1473.395) (-1472.412) -- 0:00:30 509500 -- (-1474.016) [-1474.382] (-1475.356) (-1473.292) * [-1472.944] (-1477.869) (-1473.585) (-1474.525) -- 0:00:31 510000 -- (-1473.755) (-1475.080) (-1472.342) [-1473.036] * (-1474.651) [-1474.941] (-1474.490) (-1473.654) -- 0:00:31 Average standard deviation of split frequencies: 0.012001 510500 -- (-1472.318) [-1473.920] (-1472.329) (-1475.995) * (-1474.637) (-1482.265) (-1473.714) [-1473.194] -- 0:00:31 511000 -- (-1474.826) (-1473.048) (-1472.330) [-1475.766] * (-1478.197) (-1477.306) [-1472.156] (-1473.052) -- 0:00:31 511500 -- (-1477.945) (-1474.169) [-1473.539] (-1471.741) * [-1476.179] (-1472.409) (-1472.156) (-1472.662) -- 0:00:31 512000 -- (-1474.600) (-1474.824) [-1476.253] (-1473.899) * (-1472.332) (-1472.874) (-1472.801) [-1472.768] -- 0:00:31 512500 -- [-1473.497] (-1473.529) (-1473.468) (-1475.948) * (-1474.761) [-1473.010] (-1473.672) (-1472.388) -- 0:00:31 513000 -- (-1472.411) (-1473.611) (-1472.514) [-1473.587] * (-1475.606) (-1472.846) [-1475.415] (-1472.603) -- 0:00:31 513500 -- [-1473.705] (-1471.771) (-1474.189) (-1472.731) * [-1473.665] (-1475.059) (-1477.299) (-1472.521) -- 0:00:31 514000 -- (-1472.823) [-1472.261] (-1477.006) (-1472.083) * (-1472.871) (-1472.196) [-1471.673] (-1473.388) -- 0:00:31 514500 -- (-1474.819) (-1474.569) (-1473.441) [-1473.686] * (-1471.835) (-1475.264) [-1475.374] (-1472.942) -- 0:00:31 515000 -- [-1475.905] (-1476.348) (-1475.708) (-1474.631) * [-1474.438] (-1474.277) (-1473.973) (-1473.369) -- 0:00:31 Average standard deviation of split frequencies: 0.011389 515500 -- [-1475.389] (-1475.014) (-1472.818) (-1478.426) * (-1476.611) [-1473.870] (-1471.768) (-1473.699) -- 0:00:31 516000 -- (-1478.834) (-1471.912) (-1475.917) [-1472.484] * (-1474.800) [-1471.580] (-1474.772) (-1473.633) -- 0:00:30 516500 -- (-1474.843) (-1471.923) [-1472.549] (-1472.477) * (-1472.243) (-1472.614) [-1472.205] (-1472.939) -- 0:00:30 517000 -- (-1475.746) [-1473.733] (-1476.765) (-1472.402) * (-1472.245) (-1472.402) [-1472.467] (-1476.182) -- 0:00:30 517500 -- (-1475.774) [-1474.777] (-1474.891) (-1473.793) * (-1475.711) (-1473.371) [-1472.175] (-1471.691) -- 0:00:30 518000 -- (-1473.204) (-1474.526) (-1472.103) [-1474.983] * (-1474.705) (-1476.857) (-1475.055) [-1472.464] -- 0:00:30 518500 -- [-1472.793] (-1474.047) (-1472.842) (-1474.668) * (-1475.676) (-1474.268) [-1475.994] (-1474.178) -- 0:00:30 519000 -- [-1473.164] (-1476.520) (-1473.551) (-1475.801) * (-1472.968) [-1473.080] (-1474.627) (-1475.685) -- 0:00:30 519500 -- (-1471.960) [-1473.096] (-1479.195) (-1476.245) * (-1472.989) [-1474.874] (-1474.191) (-1473.542) -- 0:00:30 520000 -- (-1473.559) (-1474.499) [-1474.392] (-1477.194) * [-1474.251] (-1475.027) (-1473.916) (-1473.365) -- 0:00:30 Average standard deviation of split frequencies: 0.011996 520500 -- [-1473.768] (-1472.803) (-1473.294) (-1476.705) * (-1476.126) [-1475.525] (-1473.932) (-1474.504) -- 0:00:30 521000 -- [-1472.886] (-1476.051) (-1474.334) (-1474.029) * (-1478.467) [-1474.579] (-1475.270) (-1473.890) -- 0:00:30 521500 -- (-1478.592) (-1476.828) [-1473.963] (-1471.634) * (-1476.235) [-1473.584] (-1475.749) (-1472.699) -- 0:00:30 522000 -- (-1483.456) [-1473.735] (-1472.231) (-1473.392) * (-1472.493) (-1473.573) (-1475.759) [-1475.994] -- 0:00:30 522500 -- (-1484.441) (-1478.196) (-1472.289) [-1473.475] * [-1472.381] (-1473.543) (-1475.183) (-1477.492) -- 0:00:30 523000 -- (-1477.541) [-1472.081] (-1472.166) (-1473.603) * (-1476.186) (-1474.310) (-1473.933) [-1478.328] -- 0:00:30 523500 -- (-1474.935) (-1473.955) (-1473.577) [-1471.950] * [-1474.879] (-1474.639) (-1473.261) (-1473.722) -- 0:00:30 524000 -- (-1473.137) [-1472.928] (-1472.289) (-1478.243) * (-1476.938) [-1473.707] (-1475.859) (-1473.888) -- 0:00:29 524500 -- (-1473.274) [-1474.693] (-1473.309) (-1475.235) * (-1476.560) [-1474.468] (-1477.113) (-1477.734) -- 0:00:29 525000 -- (-1471.908) [-1474.750] (-1473.582) (-1474.046) * (-1473.697) [-1472.257] (-1472.421) (-1472.202) -- 0:00:29 Average standard deviation of split frequencies: 0.011707 525500 -- [-1472.276] (-1476.155) (-1473.693) (-1475.501) * [-1473.767] (-1474.614) (-1471.849) (-1475.977) -- 0:00:30 526000 -- (-1474.089) (-1475.800) (-1473.588) [-1473.472] * (-1473.402) [-1474.805] (-1475.508) (-1478.171) -- 0:00:30 526500 -- (-1477.069) [-1474.565] (-1472.526) (-1473.574) * [-1474.848] (-1472.502) (-1472.551) (-1476.556) -- 0:00:30 527000 -- (-1474.428) [-1476.322] (-1472.431) (-1475.642) * [-1473.617] (-1472.296) (-1473.382) (-1476.064) -- 0:00:30 527500 -- (-1474.691) (-1475.243) (-1473.482) [-1473.020] * (-1474.134) [-1472.400] (-1473.537) (-1477.624) -- 0:00:30 528000 -- (-1476.360) (-1473.942) (-1477.671) [-1472.126] * (-1473.117) [-1475.226] (-1472.997) (-1478.377) -- 0:00:30 528500 -- (-1475.879) (-1473.986) [-1478.513] (-1475.451) * (-1472.733) (-1476.900) [-1474.571] (-1476.843) -- 0:00:30 529000 -- (-1478.200) (-1472.264) [-1474.268] (-1473.782) * (-1474.682) (-1473.697) (-1474.710) [-1473.047] -- 0:00:30 529500 -- [-1472.887] (-1474.829) (-1474.538) (-1473.739) * (-1473.058) (-1472.514) (-1474.610) [-1474.485] -- 0:00:30 530000 -- [-1473.290] (-1475.087) (-1474.665) (-1476.723) * (-1475.422) (-1474.714) [-1472.153] (-1475.110) -- 0:00:30 Average standard deviation of split frequencies: 0.012103 530500 -- [-1475.293] (-1475.840) (-1473.042) (-1475.813) * (-1475.881) [-1473.456] (-1474.074) (-1475.758) -- 0:00:30 531000 -- (-1473.353) (-1476.462) (-1473.231) [-1473.226] * (-1473.600) (-1471.888) [-1473.541] (-1473.826) -- 0:00:30 531500 -- [-1474.949] (-1479.609) (-1473.925) (-1474.032) * (-1472.550) (-1471.988) (-1478.134) [-1472.467] -- 0:00:29 532000 -- [-1474.238] (-1474.367) (-1474.764) (-1472.541) * (-1474.026) [-1472.750] (-1476.009) (-1472.386) -- 0:00:29 532500 -- [-1473.014] (-1473.267) (-1474.250) (-1477.082) * (-1474.697) [-1473.152] (-1478.321) (-1473.633) -- 0:00:29 533000 -- [-1473.068] (-1472.629) (-1471.706) (-1476.711) * (-1477.396) [-1472.105] (-1480.671) (-1472.422) -- 0:00:29 533500 -- (-1472.939) (-1474.326) [-1472.512] (-1472.176) * (-1476.530) (-1475.896) (-1475.064) [-1475.154] -- 0:00:29 534000 -- [-1474.698] (-1478.826) (-1472.678) (-1472.879) * (-1477.105) (-1477.351) [-1473.840] (-1473.035) -- 0:00:29 534500 -- (-1472.304) [-1478.622] (-1473.445) (-1473.581) * [-1474.970] (-1476.564) (-1474.164) (-1474.380) -- 0:00:29 535000 -- (-1473.388) (-1472.620) [-1472.458] (-1473.746) * (-1475.693) (-1477.373) (-1474.304) [-1474.462] -- 0:00:29 Average standard deviation of split frequencies: 0.012148 535500 -- (-1475.539) (-1474.948) (-1472.369) [-1474.698] * [-1473.764] (-1475.146) (-1475.563) (-1474.372) -- 0:00:29 536000 -- (-1473.244) (-1472.612) (-1475.404) [-1472.566] * (-1472.529) (-1474.240) (-1473.566) [-1472.043] -- 0:00:29 536500 -- (-1473.541) [-1473.062] (-1476.509) (-1471.659) * (-1474.095) (-1471.981) (-1473.171) [-1473.283] -- 0:00:29 537000 -- [-1472.946] (-1473.854) (-1474.799) (-1472.531) * (-1477.317) [-1472.005] (-1476.556) (-1474.635) -- 0:00:29 537500 -- [-1476.796] (-1473.759) (-1474.206) (-1472.630) * (-1475.998) (-1475.767) (-1472.470) [-1471.972] -- 0:00:29 538000 -- (-1477.523) (-1473.647) (-1473.533) [-1472.638] * [-1476.330] (-1477.247) (-1474.803) (-1476.085) -- 0:00:29 538500 -- (-1479.591) (-1473.580) [-1472.993] (-1477.581) * (-1475.051) (-1477.165) [-1476.030] (-1474.234) -- 0:00:29 539000 -- (-1479.096) (-1475.308) (-1473.814) [-1476.256] * (-1473.513) (-1473.160) [-1476.488] (-1475.710) -- 0:00:29 539500 -- (-1475.447) [-1473.538] (-1474.481) (-1476.142) * (-1475.041) [-1474.544] (-1474.824) (-1472.953) -- 0:00:29 540000 -- [-1473.976] (-1478.292) (-1477.603) (-1473.458) * (-1475.124) [-1473.127] (-1471.967) (-1472.188) -- 0:00:28 Average standard deviation of split frequencies: 0.012207 540500 -- (-1472.345) (-1474.086) [-1472.575] (-1473.883) * (-1476.110) [-1473.025] (-1471.984) (-1476.978) -- 0:00:28 541000 -- [-1474.262] (-1477.618) (-1472.852) (-1473.177) * (-1473.313) (-1472.213) (-1472.610) [-1472.592] -- 0:00:28 541500 -- [-1478.971] (-1474.095) (-1479.570) (-1474.235) * (-1472.976) (-1480.287) [-1474.688] (-1473.323) -- 0:00:29 542000 -- (-1475.401) (-1473.679) (-1473.178) [-1472.704] * (-1473.475) [-1473.175] (-1475.923) (-1473.738) -- 0:00:29 542500 -- (-1475.898) [-1473.788] (-1474.131) (-1473.102) * (-1473.046) (-1475.478) (-1474.776) [-1474.519] -- 0:00:29 543000 -- (-1477.801) [-1473.276] (-1474.180) (-1474.674) * [-1472.100] (-1475.531) (-1476.003) (-1473.770) -- 0:00:29 543500 -- (-1478.633) [-1472.865] (-1473.656) (-1473.913) * [-1473.026] (-1481.842) (-1472.021) (-1472.840) -- 0:00:29 544000 -- [-1472.120] (-1474.038) (-1473.144) (-1472.352) * (-1473.399) (-1479.093) (-1472.048) [-1472.836] -- 0:00:29 544500 -- (-1475.799) (-1473.214) (-1472.797) [-1473.603] * (-1476.041) [-1472.050] (-1476.615) (-1472.946) -- 0:00:29 545000 -- (-1472.951) (-1475.096) [-1474.777] (-1477.935) * [-1472.775] (-1472.978) (-1474.517) (-1474.396) -- 0:00:29 Average standard deviation of split frequencies: 0.011925 545500 -- [-1474.580] (-1472.600) (-1475.834) (-1478.429) * (-1476.367) (-1475.580) (-1475.132) [-1476.980] -- 0:00:29 546000 -- [-1474.062] (-1472.376) (-1475.873) (-1475.344) * [-1473.021] (-1475.755) (-1474.217) (-1473.731) -- 0:00:29 546500 -- [-1473.534] (-1474.988) (-1473.958) (-1473.541) * (-1473.805) (-1474.937) [-1473.848] (-1472.467) -- 0:00:29 547000 -- (-1478.243) [-1473.568] (-1474.670) (-1475.828) * (-1474.047) (-1477.356) [-1472.174] (-1476.221) -- 0:00:28 547500 -- (-1476.560) (-1474.330) (-1474.841) [-1472.736] * (-1474.913) (-1476.787) (-1472.232) [-1472.376] -- 0:00:28 548000 -- (-1477.347) [-1475.118] (-1473.992) (-1472.629) * (-1474.045) (-1474.549) [-1473.377] (-1472.431) -- 0:00:28 548500 -- [-1471.952] (-1473.797) (-1476.041) (-1472.294) * (-1476.491) (-1472.009) [-1472.126] (-1472.044) -- 0:00:28 549000 -- [-1475.962] (-1472.057) (-1473.048) (-1473.251) * (-1475.400) [-1475.450] (-1472.211) (-1472.406) -- 0:00:28 549500 -- [-1473.659] (-1474.378) (-1474.130) (-1473.625) * [-1473.407] (-1473.430) (-1474.759) (-1472.352) -- 0:00:28 550000 -- (-1472.947) [-1474.724] (-1474.133) (-1477.770) * [-1472.555] (-1473.378) (-1473.508) (-1472.436) -- 0:00:28 Average standard deviation of split frequencies: 0.011824 550500 -- [-1472.176] (-1473.383) (-1475.845) (-1473.621) * (-1474.232) (-1476.550) [-1475.205] (-1473.518) -- 0:00:28 551000 -- (-1475.801) (-1474.230) [-1473.584] (-1481.849) * (-1475.066) (-1475.955) [-1477.455] (-1472.841) -- 0:00:28 551500 -- [-1475.144] (-1472.764) (-1473.997) (-1474.325) * (-1473.126) [-1475.397] (-1472.182) (-1473.788) -- 0:00:28 552000 -- [-1474.269] (-1473.605) (-1477.638) (-1474.541) * (-1474.833) (-1474.679) [-1473.207] (-1476.568) -- 0:00:28 552500 -- [-1474.000] (-1473.557) (-1475.048) (-1474.018) * (-1473.001) [-1472.593] (-1472.194) (-1473.959) -- 0:00:28 553000 -- (-1473.729) [-1472.763] (-1475.034) (-1474.217) * (-1473.192) [-1472.372] (-1472.391) (-1472.755) -- 0:00:28 553500 -- (-1473.103) (-1473.620) (-1472.907) [-1474.224] * (-1475.924) (-1474.015) (-1475.143) [-1474.269] -- 0:00:28 554000 -- (-1475.075) (-1472.732) (-1473.922) [-1473.658] * [-1471.977] (-1474.636) (-1473.530) (-1473.013) -- 0:00:28 554500 -- (-1472.867) (-1475.183) (-1475.592) [-1473.736] * (-1471.874) (-1477.535) [-1472.462] (-1475.771) -- 0:00:28 555000 -- (-1473.233) (-1474.718) [-1472.503] (-1473.985) * [-1471.847] (-1478.299) (-1473.694) (-1475.392) -- 0:00:28 Average standard deviation of split frequencies: 0.011711 555500 -- (-1478.376) (-1474.460) (-1473.075) [-1472.271] * (-1473.103) (-1473.380) (-1474.140) [-1474.199] -- 0:00:28 556000 -- (-1476.159) [-1475.094] (-1473.568) (-1472.073) * (-1477.251) [-1473.332] (-1474.072) (-1475.406) -- 0:00:27 556500 -- (-1476.967) (-1473.534) [-1476.207] (-1472.642) * [-1472.767] (-1473.015) (-1472.890) (-1471.617) -- 0:00:27 557000 -- (-1475.839) (-1472.657) (-1476.488) [-1472.947] * (-1473.551) (-1472.124) (-1475.873) [-1472.860] -- 0:00:27 557500 -- (-1475.523) (-1473.492) [-1477.235] (-1473.809) * (-1472.593) (-1471.892) (-1477.517) [-1471.889] -- 0:00:28 558000 -- (-1472.469) [-1474.889] (-1475.061) (-1473.780) * (-1473.790) [-1471.929] (-1475.455) (-1471.801) -- 0:00:28 558500 -- (-1476.853) (-1476.209) [-1474.373] (-1473.870) * [-1473.014] (-1473.164) (-1473.786) (-1471.915) -- 0:00:28 559000 -- [-1474.482] (-1474.225) (-1473.875) (-1476.525) * (-1472.460) [-1474.285] (-1473.594) (-1471.737) -- 0:00:28 559500 -- (-1475.770) (-1474.053) [-1471.991] (-1475.936) * (-1473.141) [-1474.235] (-1473.651) (-1473.138) -- 0:00:28 560000 -- (-1473.823) (-1474.065) [-1473.607] (-1475.713) * [-1473.015] (-1474.352) (-1474.753) (-1476.143) -- 0:00:28 Average standard deviation of split frequencies: 0.011722 560500 -- [-1472.595] (-1472.524) (-1475.341) (-1476.145) * (-1475.094) (-1474.097) (-1474.530) [-1474.148] -- 0:00:28 561000 -- (-1472.764) (-1474.053) [-1475.298] (-1474.082) * (-1474.525) (-1473.023) [-1473.888] (-1475.422) -- 0:00:28 561500 -- (-1472.579) (-1473.513) [-1473.273] (-1472.931) * [-1474.390] (-1474.131) (-1477.585) (-1479.856) -- 0:00:28 562000 -- [-1472.120] (-1472.153) (-1474.008) (-1473.358) * (-1474.278) [-1475.300] (-1475.231) (-1480.974) -- 0:00:28 562500 -- (-1476.632) [-1474.470] (-1473.344) (-1472.746) * (-1476.088) [-1472.599] (-1472.895) (-1473.990) -- 0:00:28 563000 -- (-1475.785) (-1473.574) (-1477.229) [-1471.765] * (-1472.355) (-1474.679) [-1472.545] (-1474.098) -- 0:00:27 563500 -- (-1473.615) (-1472.608) [-1473.279] (-1471.774) * (-1471.679) [-1474.758] (-1472.478) (-1474.307) -- 0:00:27 564000 -- (-1472.988) (-1471.793) (-1473.626) [-1472.540] * [-1472.695] (-1474.715) (-1472.942) (-1473.141) -- 0:00:27 564500 -- (-1473.363) [-1472.710] (-1471.793) (-1480.314) * [-1472.925] (-1472.691) (-1473.832) (-1474.018) -- 0:00:27 565000 -- [-1473.748] (-1474.011) (-1477.370) (-1476.611) * [-1476.048] (-1471.716) (-1473.412) (-1475.221) -- 0:00:27 Average standard deviation of split frequencies: 0.011807 565500 -- (-1476.145) (-1475.815) (-1475.107) [-1477.500] * (-1474.400) (-1473.537) [-1473.730] (-1472.954) -- 0:00:27 566000 -- (-1476.297) [-1477.134] (-1476.186) (-1477.935) * (-1476.251) (-1481.215) [-1473.914] (-1475.985) -- 0:00:27 566500 -- (-1475.665) [-1474.579] (-1476.702) (-1476.727) * [-1474.535] (-1483.300) (-1472.490) (-1474.790) -- 0:00:27 567000 -- (-1471.866) (-1476.666) (-1474.899) [-1475.947] * (-1474.567) (-1478.649) [-1472.476] (-1474.383) -- 0:00:27 567500 -- (-1472.427) (-1478.061) (-1473.816) [-1473.674] * (-1476.006) (-1474.241) [-1473.168] (-1472.795) -- 0:00:27 568000 -- (-1472.416) (-1472.447) [-1474.205] (-1474.941) * (-1475.268) (-1474.214) [-1474.386] (-1472.963) -- 0:00:27 568500 -- (-1473.844) (-1472.447) (-1474.837) [-1475.999] * (-1475.994) [-1474.126] (-1478.603) (-1474.932) -- 0:00:27 569000 -- (-1473.610) [-1474.079] (-1473.167) (-1474.172) * (-1473.840) (-1475.950) (-1476.684) [-1473.734] -- 0:00:27 569500 -- (-1473.091) [-1474.624] (-1472.812) (-1473.380) * (-1473.457) [-1476.772] (-1474.874) (-1473.098) -- 0:00:27 570000 -- (-1474.797) (-1472.716) (-1479.811) [-1473.138] * (-1472.387) (-1474.667) [-1474.512] (-1474.194) -- 0:00:27 Average standard deviation of split frequencies: 0.012488 570500 -- (-1473.941) [-1473.495] (-1472.912) (-1473.731) * (-1474.516) (-1473.803) (-1475.495) [-1474.577] -- 0:00:27 571000 -- (-1474.848) (-1474.624) (-1473.037) [-1474.323] * (-1474.367) (-1472.526) (-1475.898) [-1472.767] -- 0:00:27 571500 -- (-1472.391) [-1474.699] (-1472.843) (-1474.963) * (-1472.774) (-1475.929) (-1475.120) [-1474.675] -- 0:00:26 572000 -- (-1473.317) (-1473.678) [-1472.699] (-1474.313) * (-1474.245) [-1474.462] (-1477.970) (-1475.497) -- 0:00:26 572500 -- [-1471.546] (-1472.657) (-1473.973) (-1474.259) * [-1475.128] (-1472.791) (-1476.359) (-1473.329) -- 0:00:26 573000 -- [-1472.117] (-1473.267) (-1475.658) (-1473.657) * (-1481.411) (-1475.791) [-1473.401] (-1476.854) -- 0:00:26 573500 -- [-1473.502] (-1472.916) (-1474.544) (-1475.959) * [-1480.693] (-1475.336) (-1474.405) (-1476.825) -- 0:00:27 574000 -- [-1474.178] (-1472.649) (-1472.661) (-1473.620) * (-1474.684) [-1475.266] (-1473.006) (-1473.998) -- 0:00:27 574500 -- (-1473.495) (-1475.111) [-1476.888] (-1479.472) * (-1473.947) (-1474.404) [-1474.422] (-1476.227) -- 0:00:27 575000 -- [-1473.208] (-1473.854) (-1473.978) (-1474.293) * [-1473.518] (-1474.258) (-1472.885) (-1475.567) -- 0:00:27 Average standard deviation of split frequencies: 0.012806 575500 -- (-1472.600) (-1473.854) (-1475.169) [-1472.918] * [-1472.328] (-1476.335) (-1472.500) (-1474.253) -- 0:00:27 576000 -- [-1473.745] (-1472.933) (-1471.998) (-1472.833) * (-1473.305) (-1473.677) [-1473.176] (-1475.953) -- 0:00:27 576500 -- [-1474.247] (-1472.769) (-1473.319) (-1475.579) * (-1473.900) (-1473.558) [-1474.325] (-1474.537) -- 0:00:27 577000 -- (-1473.894) (-1474.512) (-1475.343) [-1474.047] * (-1475.926) [-1475.264] (-1472.247) (-1474.261) -- 0:00:27 577500 -- [-1474.525] (-1473.259) (-1474.588) (-1472.724) * (-1472.521) (-1474.149) [-1474.187] (-1475.156) -- 0:00:27 578000 -- (-1474.658) (-1478.014) [-1476.452] (-1472.497) * (-1475.365) (-1472.746) (-1475.377) [-1473.918] -- 0:00:27 578500 -- (-1475.056) [-1472.860] (-1475.638) (-1473.537) * (-1475.378) [-1472.934] (-1476.422) (-1474.588) -- 0:00:26 579000 -- [-1472.047] (-1474.144) (-1476.182) (-1475.715) * (-1472.340) [-1472.478] (-1479.933) (-1475.833) -- 0:00:26 579500 -- (-1473.245) [-1473.530] (-1473.013) (-1473.487) * [-1472.361] (-1471.908) (-1474.361) (-1478.318) -- 0:00:26 580000 -- (-1473.529) (-1477.352) (-1475.710) [-1474.044] * (-1473.286) [-1471.941] (-1472.665) (-1477.962) -- 0:00:26 Average standard deviation of split frequencies: 0.012130 580500 -- [-1472.310] (-1474.063) (-1473.534) (-1475.640) * (-1474.752) (-1473.141) [-1474.834] (-1477.473) -- 0:00:26 581000 -- (-1472.266) [-1472.792] (-1472.703) (-1474.939) * (-1475.914) (-1473.112) [-1472.634] (-1476.909) -- 0:00:26 581500 -- (-1472.063) [-1475.581] (-1473.894) (-1472.702) * (-1477.450) (-1473.023) (-1472.591) [-1473.416] -- 0:00:26 582000 -- (-1473.361) (-1472.989) (-1475.044) [-1472.610] * (-1474.453) (-1472.813) (-1476.108) [-1473.905] -- 0:00:26 582500 -- (-1476.434) (-1472.512) [-1474.622] (-1474.279) * [-1476.198] (-1473.791) (-1476.084) (-1472.703) -- 0:00:26 583000 -- (-1472.182) (-1472.208) [-1473.628] (-1473.964) * (-1473.676) [-1472.683] (-1478.320) (-1472.774) -- 0:00:26 583500 -- (-1472.908) (-1472.929) [-1473.180] (-1475.724) * (-1476.932) [-1472.572] (-1475.270) (-1472.878) -- 0:00:26 584000 -- [-1474.101] (-1473.411) (-1473.869) (-1474.330) * (-1476.630) [-1475.289] (-1474.709) (-1474.882) -- 0:00:26 584500 -- (-1473.297) [-1474.690] (-1473.745) (-1476.286) * (-1474.112) (-1473.746) [-1474.744] (-1475.624) -- 0:00:26 585000 -- (-1472.441) (-1474.990) [-1471.644] (-1474.153) * [-1473.783] (-1472.907) (-1477.552) (-1474.394) -- 0:00:26 Average standard deviation of split frequencies: 0.011783 585500 -- (-1474.055) (-1472.109) (-1472.133) [-1474.615] * (-1473.524) [-1472.061] (-1476.826) (-1474.382) -- 0:00:26 586000 -- (-1473.171) (-1476.600) [-1472.573] (-1473.194) * (-1472.858) [-1473.065] (-1473.188) (-1476.696) -- 0:00:26 586500 -- (-1477.095) (-1475.131) [-1472.539] (-1474.776) * (-1473.015) [-1472.228] (-1473.078) (-1472.605) -- 0:00:26 587000 -- (-1473.031) [-1474.000] (-1473.084) (-1475.058) * [-1474.083] (-1471.920) (-1474.247) (-1473.095) -- 0:00:26 587500 -- (-1474.128) (-1473.359) (-1473.138) [-1478.504] * (-1475.477) (-1472.579) [-1472.970] (-1474.235) -- 0:00:25 588000 -- [-1474.963] (-1473.605) (-1474.207) (-1475.657) * (-1474.182) (-1473.584) (-1472.503) [-1474.815] -- 0:00:25 588500 -- (-1474.556) [-1473.346] (-1472.333) (-1482.236) * (-1474.045) [-1472.989] (-1473.525) (-1474.062) -- 0:00:25 589000 -- (-1473.527) (-1473.376) [-1472.005] (-1473.964) * (-1472.555) (-1473.515) [-1473.265] (-1473.602) -- 0:00:25 589500 -- (-1471.915) [-1473.769] (-1472.815) (-1480.337) * [-1472.616] (-1474.111) (-1473.266) (-1478.912) -- 0:00:26 590000 -- [-1472.134] (-1473.241) (-1472.252) (-1476.113) * [-1472.163] (-1474.728) (-1477.908) (-1473.617) -- 0:00:26 Average standard deviation of split frequencies: 0.011373 590500 -- [-1473.925] (-1474.931) (-1472.412) (-1472.959) * (-1473.597) (-1474.039) (-1473.932) [-1475.696] -- 0:00:26 591000 -- [-1474.364] (-1474.265) (-1472.421) (-1475.788) * (-1474.864) [-1472.287] (-1474.948) (-1472.193) -- 0:00:26 591500 -- [-1476.389] (-1477.481) (-1472.530) (-1475.855) * (-1475.034) (-1473.981) [-1473.346] (-1474.689) -- 0:00:26 592000 -- (-1473.442) (-1477.009) (-1476.580) [-1474.088] * (-1471.845) (-1472.458) [-1474.839] (-1472.282) -- 0:00:26 592500 -- (-1476.839) (-1475.045) (-1474.599) [-1475.312] * (-1473.593) [-1473.154] (-1474.995) (-1472.003) -- 0:00:26 593000 -- (-1477.683) [-1475.142] (-1476.816) (-1477.285) * [-1476.390] (-1472.694) (-1474.331) (-1477.944) -- 0:00:26 593500 -- (-1476.299) [-1474.331] (-1473.889) (-1473.873) * (-1472.816) [-1472.234] (-1474.397) (-1476.887) -- 0:00:26 594000 -- (-1475.632) (-1476.322) [-1473.701] (-1471.643) * (-1473.456) (-1473.834) (-1477.886) [-1474.558] -- 0:00:25 594500 -- (-1472.711) [-1475.155] (-1473.637) (-1472.098) * (-1473.341) (-1476.365) (-1472.304) [-1475.182] -- 0:00:25 595000 -- [-1475.958] (-1472.946) (-1473.163) (-1473.473) * (-1471.713) (-1471.691) [-1472.029] (-1475.926) -- 0:00:25 Average standard deviation of split frequencies: 0.010794 595500 -- (-1477.651) (-1472.500) [-1474.332] (-1473.122) * (-1472.571) (-1473.221) [-1472.092] (-1475.014) -- 0:00:25 596000 -- (-1472.719) [-1472.431] (-1473.090) (-1475.626) * (-1474.272) (-1476.751) (-1473.265) [-1473.406] -- 0:00:25 596500 -- (-1474.581) (-1473.443) (-1473.090) [-1475.456] * (-1473.775) (-1481.658) (-1474.987) [-1473.410] -- 0:00:25 597000 -- [-1472.520] (-1472.590) (-1472.367) (-1473.444) * (-1472.772) (-1477.729) [-1472.618] (-1476.701) -- 0:00:25 597500 -- (-1472.009) (-1473.147) [-1472.777] (-1473.682) * (-1472.015) (-1475.395) (-1472.103) [-1477.272] -- 0:00:25 598000 -- (-1472.007) [-1473.246] (-1473.933) (-1473.986) * (-1471.954) [-1473.756] (-1472.667) (-1475.312) -- 0:00:25 598500 -- [-1472.057] (-1474.592) (-1475.414) (-1473.065) * [-1475.430] (-1474.440) (-1476.147) (-1473.833) -- 0:00:25 599000 -- (-1471.754) (-1477.018) (-1475.104) [-1474.652] * (-1477.883) (-1472.565) (-1473.094) [-1473.218] -- 0:00:25 599500 -- (-1473.187) (-1476.262) (-1472.169) [-1474.230] * [-1475.147] (-1472.938) (-1473.530) (-1474.769) -- 0:00:25 600000 -- (-1472.209) (-1474.678) (-1472.137) [-1475.739] * (-1473.187) (-1472.557) (-1475.532) [-1473.451] -- 0:00:25 Average standard deviation of split frequencies: 0.010987 600500 -- [-1472.189] (-1473.556) (-1475.704) (-1471.844) * (-1472.190) [-1475.519] (-1475.182) (-1473.067) -- 0:00:25 601000 -- [-1472.006] (-1473.541) (-1474.601) (-1475.480) * [-1473.539] (-1474.161) (-1474.799) (-1472.555) -- 0:00:25 601500 -- (-1475.549) (-1473.002) (-1472.536) [-1473.711] * (-1473.439) [-1473.766] (-1474.095) (-1472.487) -- 0:00:25 602000 -- [-1472.794] (-1474.628) (-1475.559) (-1474.351) * (-1473.114) (-1472.991) (-1472.771) [-1471.880] -- 0:00:25 602500 -- (-1472.668) (-1474.687) (-1472.376) [-1473.297] * (-1474.867) (-1475.666) [-1472.710] (-1475.799) -- 0:00:25 603000 -- (-1474.856) (-1474.665) (-1475.096) [-1476.969] * [-1472.271] (-1475.007) (-1472.407) (-1473.413) -- 0:00:25 603500 -- (-1472.193) [-1476.957] (-1477.197) (-1477.354) * (-1472.271) (-1476.173) [-1472.586] (-1473.276) -- 0:00:24 604000 -- (-1474.034) (-1472.129) [-1476.735] (-1473.822) * (-1472.330) [-1472.894] (-1472.735) (-1474.963) -- 0:00:24 604500 -- [-1471.655] (-1474.506) (-1473.916) (-1471.787) * (-1472.941) (-1472.693) (-1475.530) [-1473.534] -- 0:00:24 605000 -- (-1473.762) (-1473.307) (-1475.196) [-1471.761] * (-1477.591) (-1471.752) [-1472.563] (-1474.061) -- 0:00:24 Average standard deviation of split frequencies: 0.010842 605500 -- (-1473.953) [-1473.103] (-1473.915) (-1474.207) * [-1473.714] (-1472.485) (-1473.731) (-1473.741) -- 0:00:25 606000 -- [-1473.082] (-1473.824) (-1472.558) (-1477.747) * (-1472.970) (-1476.633) (-1476.165) [-1471.974] -- 0:00:25 606500 -- (-1474.945) (-1472.313) [-1472.499] (-1474.571) * (-1473.376) [-1472.115] (-1477.970) (-1473.206) -- 0:00:25 607000 -- (-1472.727) [-1474.943] (-1473.005) (-1479.628) * [-1475.538] (-1472.206) (-1476.221) (-1476.344) -- 0:00:25 607500 -- [-1474.245] (-1474.835) (-1473.433) (-1473.264) * (-1473.307) (-1472.997) [-1475.585] (-1476.350) -- 0:00:25 608000 -- [-1474.617] (-1474.902) (-1474.735) (-1473.278) * (-1472.359) (-1472.488) [-1476.168] (-1472.719) -- 0:00:25 608500 -- (-1474.318) (-1475.254) [-1473.514] (-1472.900) * (-1472.277) (-1473.951) (-1474.050) [-1473.712] -- 0:00:25 609000 -- (-1474.049) (-1474.234) (-1474.657) [-1472.345] * [-1475.175] (-1478.841) (-1472.509) (-1473.234) -- 0:00:25 609500 -- (-1473.455) (-1472.580) (-1475.774) [-1472.386] * [-1472.962] (-1481.975) (-1472.967) (-1472.572) -- 0:00:24 610000 -- (-1473.108) (-1472.047) [-1473.890] (-1472.606) * [-1473.912] (-1474.771) (-1472.497) (-1474.769) -- 0:00:24 Average standard deviation of split frequencies: 0.011242 610500 -- [-1472.484] (-1476.602) (-1472.878) (-1474.527) * (-1473.121) (-1478.575) [-1473.144] (-1472.379) -- 0:00:24 611000 -- (-1472.455) [-1473.557] (-1473.505) (-1473.701) * [-1473.132] (-1476.011) (-1472.021) (-1473.137) -- 0:00:24 611500 -- (-1471.709) (-1472.959) (-1474.880) [-1474.536] * (-1474.246) (-1474.178) (-1472.549) [-1474.359] -- 0:00:24 612000 -- [-1472.042] (-1474.650) (-1471.818) (-1475.180) * (-1476.095) (-1471.573) [-1481.402] (-1479.999) -- 0:00:24 612500 -- (-1472.462) [-1473.964] (-1474.456) (-1473.443) * (-1477.293) (-1471.601) (-1474.592) [-1473.923] -- 0:00:24 613000 -- (-1474.004) [-1472.891] (-1472.823) (-1472.018) * (-1472.449) (-1471.933) [-1472.909] (-1476.321) -- 0:00:24 613500 -- (-1477.499) [-1473.060] (-1474.593) (-1472.687) * (-1472.993) (-1472.645) [-1472.364] (-1473.616) -- 0:00:24 614000 -- (-1476.802) (-1476.560) [-1474.618] (-1473.171) * (-1476.144) [-1471.901] (-1475.345) (-1473.731) -- 0:00:24 614500 -- (-1473.656) (-1475.860) [-1476.248] (-1472.292) * (-1473.059) (-1477.509) [-1473.292] (-1480.292) -- 0:00:24 615000 -- (-1472.068) (-1474.972) (-1477.412) [-1472.514] * [-1474.140] (-1474.683) (-1473.729) (-1472.526) -- 0:00:24 Average standard deviation of split frequencies: 0.011622 615500 -- [-1472.929] (-1474.427) (-1473.330) (-1476.753) * [-1474.697] (-1473.528) (-1475.160) (-1481.087) -- 0:00:24 616000 -- (-1473.090) (-1474.295) (-1477.342) [-1472.828] * (-1474.132) (-1473.562) (-1474.274) [-1473.995] -- 0:00:24 616500 -- [-1475.043] (-1478.561) (-1474.138) (-1472.232) * [-1472.787] (-1473.965) (-1472.156) (-1476.784) -- 0:00:24 617000 -- (-1474.232) (-1473.935) (-1473.508) [-1472.797] * (-1473.269) (-1473.559) [-1472.547] (-1472.869) -- 0:00:24 617500 -- (-1474.121) (-1472.446) [-1472.712] (-1476.271) * (-1472.403) [-1473.593] (-1477.398) (-1471.907) -- 0:00:24 618000 -- (-1473.643) (-1472.438) [-1473.818] (-1474.581) * (-1474.106) (-1473.401) (-1477.221) [-1473.258] -- 0:00:24 618500 -- (-1474.879) [-1473.257] (-1473.098) (-1475.586) * (-1476.954) (-1475.196) (-1480.213) [-1474.388] -- 0:00:24 619000 -- [-1473.117] (-1473.147) (-1473.941) (-1473.022) * (-1471.766) (-1473.214) [-1477.247] (-1472.036) -- 0:00:24 619500 -- (-1472.365) (-1475.883) (-1476.349) [-1473.568] * (-1472.216) (-1473.557) [-1473.058] (-1472.895) -- 0:00:23 620000 -- [-1472.523] (-1477.226) (-1473.112) (-1475.396) * (-1471.826) (-1474.707) [-1475.175] (-1472.730) -- 0:00:23 Average standard deviation of split frequencies: 0.011298 620500 -- [-1472.826] (-1476.114) (-1473.152) (-1472.576) * [-1472.280] (-1474.701) (-1476.793) (-1474.267) -- 0:00:23 621000 -- (-1473.707) (-1474.308) [-1473.109] (-1472.808) * (-1471.989) (-1473.321) [-1473.552] (-1475.577) -- 0:00:24 621500 -- (-1473.753) [-1475.334] (-1473.724) (-1475.077) * (-1473.326) (-1474.966) [-1473.083] (-1477.338) -- 0:00:24 622000 -- (-1472.258) [-1475.216] (-1473.026) (-1473.702) * [-1472.459] (-1475.305) (-1473.117) (-1473.831) -- 0:00:24 622500 -- (-1474.799) (-1474.911) [-1473.265] (-1472.736) * (-1473.861) [-1477.512] (-1473.667) (-1475.814) -- 0:00:24 623000 -- (-1474.878) [-1472.732] (-1473.454) (-1474.243) * [-1473.501] (-1475.383) (-1475.686) (-1475.399) -- 0:00:24 623500 -- (-1474.878) (-1474.253) [-1472.765] (-1473.405) * [-1473.640] (-1478.405) (-1474.104) (-1472.923) -- 0:00:24 624000 -- (-1475.238) (-1474.024) (-1472.789) [-1472.856] * (-1477.251) [-1475.094] (-1472.819) (-1476.925) -- 0:00:24 624500 -- (-1473.198) [-1472.843] (-1471.937) (-1475.985) * (-1481.528) [-1474.615] (-1476.451) (-1474.618) -- 0:00:24 625000 -- (-1474.972) (-1476.771) (-1471.965) [-1473.308] * (-1479.786) [-1473.408] (-1473.415) (-1473.673) -- 0:00:24 Average standard deviation of split frequencies: 0.011296 625500 -- (-1474.051) [-1472.559] (-1472.365) (-1474.463) * (-1475.261) [-1474.046] (-1476.194) (-1473.691) -- 0:00:23 626000 -- (-1474.711) (-1477.827) [-1472.443] (-1472.770) * (-1476.989) [-1472.157] (-1474.884) (-1473.048) -- 0:00:23 626500 -- (-1474.590) (-1477.491) (-1473.045) [-1472.119] * [-1473.554] (-1474.172) (-1474.658) (-1477.265) -- 0:00:23 627000 -- (-1472.673) (-1473.318) [-1473.250] (-1472.160) * [-1472.009] (-1472.883) (-1475.205) (-1477.204) -- 0:00:23 627500 -- (-1473.065) [-1474.837] (-1473.852) (-1476.758) * [-1472.537] (-1476.216) (-1473.935) (-1474.883) -- 0:00:23 628000 -- (-1472.292) (-1476.168) (-1475.000) [-1473.023] * [-1473.843] (-1472.971) (-1472.883) (-1475.181) -- 0:00:23 628500 -- [-1477.086] (-1474.249) (-1474.136) (-1472.167) * (-1477.081) (-1472.943) [-1476.487] (-1477.545) -- 0:00:23 629000 -- (-1477.899) (-1476.087) [-1474.660] (-1472.171) * [-1473.950] (-1474.130) (-1472.930) (-1475.533) -- 0:00:23 629500 -- (-1475.538) (-1476.475) (-1474.315) [-1473.836] * [-1475.172] (-1474.337) (-1474.459) (-1472.532) -- 0:00:23 630000 -- [-1475.297] (-1482.086) (-1472.656) (-1474.335) * (-1473.273) (-1474.036) [-1473.839] (-1473.890) -- 0:00:23 Average standard deviation of split frequencies: 0.011586 630500 -- (-1472.083) [-1473.089] (-1473.153) (-1476.097) * (-1475.655) (-1474.563) [-1472.480] (-1472.739) -- 0:00:23 631000 -- (-1473.023) [-1472.698] (-1473.621) (-1472.962) * [-1478.499] (-1476.378) (-1473.229) (-1476.597) -- 0:00:23 631500 -- [-1473.439] (-1472.135) (-1477.045) (-1471.966) * (-1474.876) (-1472.696) [-1473.463] (-1474.345) -- 0:00:23 632000 -- (-1473.885) [-1471.768] (-1473.308) (-1473.390) * (-1474.728) (-1473.434) [-1472.598] (-1475.073) -- 0:00:23 632500 -- (-1474.724) (-1471.781) (-1473.801) [-1472.400] * (-1474.898) (-1475.865) (-1474.277) [-1471.987] -- 0:00:23 633000 -- (-1476.754) (-1472.120) [-1474.517] (-1472.386) * (-1477.677) (-1474.645) (-1475.419) [-1471.902] -- 0:00:23 633500 -- (-1476.434) [-1472.660] (-1474.466) (-1472.680) * (-1473.235) [-1474.253] (-1473.688) (-1476.941) -- 0:00:23 634000 -- (-1471.622) (-1472.529) (-1472.689) [-1473.326] * (-1474.094) (-1478.085) (-1477.889) [-1473.594] -- 0:00:23 634500 -- (-1474.750) (-1473.163) [-1472.690] (-1473.140) * (-1474.091) (-1474.539) (-1472.910) [-1473.570] -- 0:00:23 635000 -- (-1472.899) (-1474.274) [-1472.578] (-1476.586) * (-1476.989) (-1473.849) (-1472.910) [-1473.907] -- 0:00:22 Average standard deviation of split frequencies: 0.011350 635500 -- (-1472.635) [-1473.074] (-1474.145) (-1474.137) * (-1475.513) (-1471.496) [-1473.875] (-1472.589) -- 0:00:22 636000 -- (-1473.070) [-1473.172] (-1473.196) (-1477.357) * (-1474.283) [-1472.594] (-1475.351) (-1474.465) -- 0:00:22 636500 -- (-1472.054) (-1473.804) (-1473.261) [-1474.399] * (-1474.358) (-1472.167) (-1473.378) [-1473.997] -- 0:00:22 637000 -- (-1474.822) [-1474.111] (-1475.418) (-1476.568) * [-1477.825] (-1471.808) (-1472.472) (-1474.805) -- 0:00:23 637500 -- (-1474.846) [-1473.383] (-1476.780) (-1473.670) * [-1474.050] (-1471.706) (-1472.443) (-1475.699) -- 0:00:23 638000 -- [-1473.449] (-1473.744) (-1473.247) (-1477.887) * (-1476.740) [-1471.694] (-1473.563) (-1475.657) -- 0:00:23 638500 -- (-1476.335) (-1473.965) (-1473.676) [-1474.447] * (-1478.229) [-1472.091] (-1475.987) (-1473.846) -- 0:00:23 639000 -- (-1475.469) (-1474.417) [-1472.903] (-1474.364) * (-1475.772) [-1472.862] (-1477.920) (-1475.505) -- 0:00:23 639500 -- (-1472.439) (-1477.702) (-1472.494) [-1472.776] * [-1475.561] (-1472.192) (-1475.263) (-1474.832) -- 0:00:23 640000 -- (-1475.075) (-1475.504) (-1472.988) [-1471.627] * (-1477.350) [-1474.758] (-1474.092) (-1475.045) -- 0:00:23 Average standard deviation of split frequencies: 0.011497 640500 -- (-1475.848) (-1472.865) [-1472.417] (-1472.456) * (-1477.595) (-1473.238) (-1474.176) [-1475.178] -- 0:00:23 641000 -- [-1473.373] (-1472.813) (-1472.717) (-1472.801) * [-1472.408] (-1474.841) (-1475.417) (-1473.474) -- 0:00:22 641500 -- (-1472.429) [-1472.555] (-1477.737) (-1472.342) * (-1476.051) [-1473.301] (-1472.772) (-1475.297) -- 0:00:22 642000 -- (-1472.935) (-1474.542) [-1474.122] (-1473.683) * [-1473.001] (-1474.507) (-1474.537) (-1474.476) -- 0:00:22 642500 -- (-1476.117) [-1473.712] (-1474.077) (-1473.942) * [-1472.936] (-1475.331) (-1475.446) (-1472.736) -- 0:00:22 643000 -- (-1474.816) [-1472.297] (-1474.133) (-1473.728) * [-1475.846] (-1473.015) (-1475.049) (-1476.733) -- 0:00:22 643500 -- (-1477.033) [-1471.919] (-1472.683) (-1472.805) * (-1472.282) (-1473.542) (-1472.789) [-1475.355] -- 0:00:22 644000 -- (-1474.559) [-1471.919] (-1475.728) (-1472.834) * (-1473.353) [-1473.232] (-1475.458) (-1472.297) -- 0:00:22 644500 -- (-1474.366) (-1476.957) (-1474.356) [-1473.031] * [-1472.765] (-1474.071) (-1475.204) (-1472.127) -- 0:00:22 645000 -- [-1472.940] (-1473.064) (-1474.537) (-1472.074) * (-1472.780) (-1472.505) [-1474.942] (-1473.192) -- 0:00:22 Average standard deviation of split frequencies: 0.011904 645500 -- (-1473.510) (-1475.004) [-1474.110] (-1475.806) * (-1471.933) (-1475.494) [-1473.133] (-1476.518) -- 0:00:22 646000 -- (-1475.281) [-1473.744] (-1474.068) (-1473.483) * (-1472.290) [-1473.341] (-1475.659) (-1476.110) -- 0:00:22 646500 -- [-1476.315] (-1473.511) (-1475.237) (-1474.810) * (-1474.256) (-1473.636) [-1473.838] (-1473.174) -- 0:00:22 647000 -- (-1476.463) (-1476.362) [-1473.451] (-1473.447) * (-1474.200) [-1474.076] (-1473.974) (-1475.142) -- 0:00:22 647500 -- (-1473.140) (-1472.312) (-1472.811) [-1474.001] * [-1472.202] (-1474.034) (-1472.674) (-1476.038) -- 0:00:22 648000 -- (-1472.430) (-1473.856) [-1473.183] (-1472.041) * (-1474.858) (-1475.438) [-1473.408] (-1482.834) -- 0:00:22 648500 -- (-1473.090) (-1473.548) [-1472.889] (-1473.506) * (-1472.660) (-1472.722) (-1475.317) [-1473.929] -- 0:00:22 649000 -- (-1472.507) (-1476.680) (-1474.086) [-1474.428] * [-1473.264] (-1471.968) (-1473.638) (-1472.995) -- 0:00:22 649500 -- (-1474.008) (-1472.096) (-1474.214) [-1473.343] * [-1475.564] (-1474.492) (-1474.363) (-1475.376) -- 0:00:22 650000 -- (-1474.487) (-1473.165) [-1474.479] (-1474.806) * [-1473.586] (-1474.618) (-1473.853) (-1473.373) -- 0:00:22 Average standard deviation of split frequencies: 0.011635 650500 -- (-1475.353) (-1473.239) (-1475.725) [-1472.774] * (-1474.250) (-1475.756) [-1475.860] (-1471.827) -- 0:00:22 651000 -- [-1474.627] (-1479.270) (-1473.937) (-1478.824) * (-1475.474) (-1472.992) [-1473.885] (-1472.654) -- 0:00:21 651500 -- (-1477.922) (-1473.758) (-1476.320) [-1472.637] * (-1474.426) [-1473.637] (-1473.359) (-1472.995) -- 0:00:21 652000 -- [-1473.346] (-1475.011) (-1476.993) (-1472.855) * (-1472.447) (-1472.988) (-1477.497) [-1474.996] -- 0:00:21 652500 -- [-1475.839] (-1473.793) (-1478.318) (-1472.741) * (-1473.410) [-1479.108] (-1474.542) (-1474.313) -- 0:00:21 653000 -- (-1474.047) (-1474.320) (-1472.350) [-1472.592] * (-1472.574) (-1473.136) [-1476.986] (-1473.830) -- 0:00:22 653500 -- (-1473.344) (-1472.787) [-1472.583] (-1473.517) * [-1474.505] (-1478.092) (-1473.709) (-1473.386) -- 0:00:22 654000 -- (-1473.994) (-1474.264) (-1472.480) [-1473.470] * (-1476.150) [-1472.742] (-1473.513) (-1474.726) -- 0:00:22 654500 -- (-1472.571) (-1472.750) (-1475.454) [-1473.470] * (-1473.516) [-1473.378] (-1472.010) (-1474.321) -- 0:00:22 655000 -- (-1472.815) (-1473.866) (-1476.872) [-1473.237] * (-1473.772) (-1473.005) (-1471.998) [-1476.064] -- 0:00:22 Average standard deviation of split frequencies: 0.011722 655500 -- [-1473.672] (-1474.560) (-1478.985) (-1472.901) * (-1474.737) [-1473.164] (-1473.265) (-1475.758) -- 0:00:22 656000 -- (-1474.010) [-1473.700] (-1477.057) (-1471.959) * [-1473.228] (-1475.161) (-1472.714) (-1474.730) -- 0:00:22 656500 -- [-1473.222] (-1473.094) (-1473.281) (-1473.660) * [-1472.965] (-1479.450) (-1472.728) (-1475.349) -- 0:00:21 657000 -- (-1475.794) [-1475.081] (-1474.709) (-1476.702) * (-1474.238) [-1472.571] (-1473.908) (-1474.576) -- 0:00:21 657500 -- (-1474.025) (-1476.216) [-1475.031] (-1474.275) * (-1474.111) [-1473.751] (-1477.178) (-1472.031) -- 0:00:21 658000 -- (-1472.711) (-1474.974) (-1475.685) [-1476.137] * [-1472.910] (-1473.769) (-1477.561) (-1471.907) -- 0:00:21 658500 -- [-1473.662] (-1476.521) (-1472.438) (-1475.145) * (-1476.246) (-1472.894) (-1476.195) [-1473.337] -- 0:00:21 659000 -- (-1474.567) (-1471.830) (-1473.807) [-1473.685] * (-1472.764) [-1474.757] (-1476.290) (-1474.352) -- 0:00:21 659500 -- (-1471.864) [-1471.840] (-1472.142) (-1473.993) * [-1473.387] (-1473.889) (-1476.303) (-1475.467) -- 0:00:21 660000 -- (-1472.438) (-1472.430) [-1473.054] (-1472.769) * (-1473.446) (-1473.528) [-1473.145] (-1472.212) -- 0:00:21 Average standard deviation of split frequencies: 0.011283 660500 -- (-1475.909) (-1473.798) (-1472.905) [-1475.263] * (-1476.451) (-1474.918) (-1472.899) [-1475.477] -- 0:00:21 661000 -- (-1472.305) [-1474.303] (-1472.975) (-1474.771) * (-1474.811) [-1473.654] (-1473.076) (-1473.873) -- 0:00:21 661500 -- (-1474.411) (-1474.376) (-1475.091) [-1474.628] * [-1472.968] (-1474.286) (-1475.218) (-1476.865) -- 0:00:21 662000 -- [-1474.119] (-1472.086) (-1472.901) (-1473.074) * [-1472.492] (-1473.425) (-1474.368) (-1474.627) -- 0:00:21 662500 -- (-1475.586) [-1474.663] (-1476.978) (-1474.870) * (-1472.061) [-1472.202] (-1473.962) (-1479.345) -- 0:00:21 663000 -- [-1475.775] (-1475.031) (-1472.647) (-1473.707) * [-1473.162] (-1471.954) (-1474.316) (-1473.892) -- 0:00:21 663500 -- (-1474.348) [-1475.063] (-1473.342) (-1477.573) * (-1473.113) (-1473.072) [-1476.941] (-1474.181) -- 0:00:21 664000 -- [-1474.247] (-1476.124) (-1472.712) (-1472.795) * [-1475.564] (-1473.407) (-1473.813) (-1473.955) -- 0:00:21 664500 -- [-1474.514] (-1473.012) (-1474.340) (-1474.952) * (-1477.721) (-1472.758) [-1475.594] (-1474.847) -- 0:00:21 665000 -- (-1473.869) (-1473.159) (-1479.632) [-1472.246] * [-1471.924] (-1475.135) (-1474.443) (-1474.838) -- 0:00:21 Average standard deviation of split frequencies: 0.010573 665500 -- (-1475.400) (-1476.060) [-1471.905] (-1472.843) * (-1474.283) (-1475.818) (-1479.496) [-1472.733] -- 0:00:21 666000 -- (-1473.705) (-1475.489) (-1472.319) [-1473.660] * (-1473.894) [-1473.601] (-1475.712) (-1473.006) -- 0:00:21 666500 -- (-1473.817) [-1472.982] (-1472.338) (-1473.990) * [-1474.217] (-1478.762) (-1481.384) (-1473.465) -- 0:00:21 667000 -- [-1474.703] (-1474.519) (-1472.782) (-1476.911) * [-1475.448] (-1472.803) (-1474.784) (-1474.415) -- 0:00:20 667500 -- (-1475.676) [-1476.327] (-1472.823) (-1475.089) * (-1476.023) (-1476.336) (-1476.481) [-1474.257] -- 0:00:20 668000 -- (-1474.142) (-1472.914) [-1473.169] (-1477.210) * (-1473.762) (-1474.435) (-1475.029) [-1474.911] -- 0:00:20 668500 -- (-1477.936) (-1471.834) [-1472.383] (-1471.828) * [-1474.968] (-1473.972) (-1475.056) (-1472.027) -- 0:00:21 669000 -- [-1473.318] (-1472.239) (-1474.850) (-1472.213) * [-1474.835] (-1474.729) (-1473.052) (-1474.472) -- 0:00:21 669500 -- [-1473.521] (-1472.231) (-1472.470) (-1471.963) * (-1475.133) [-1473.671] (-1476.796) (-1473.535) -- 0:00:21 670000 -- (-1472.174) (-1473.798) (-1472.053) [-1474.418] * (-1476.565) (-1472.753) [-1473.563] (-1474.510) -- 0:00:21 Average standard deviation of split frequencies: 0.010324 670500 -- [-1474.505] (-1475.749) (-1473.149) (-1473.484) * (-1472.815) [-1472.986] (-1475.805) (-1475.095) -- 0:00:21 671000 -- (-1474.162) (-1472.131) (-1476.692) [-1473.354] * (-1473.439) [-1472.929] (-1475.475) (-1476.452) -- 0:00:21 671500 -- (-1472.174) [-1473.477] (-1477.674) (-1473.871) * [-1476.696] (-1477.019) (-1472.604) (-1472.860) -- 0:00:21 672000 -- (-1471.716) [-1474.301] (-1473.731) (-1474.691) * [-1473.758] (-1474.364) (-1479.930) (-1475.315) -- 0:00:20 672500 -- (-1471.669) [-1473.458] (-1474.718) (-1472.867) * (-1473.466) [-1476.496] (-1473.406) (-1475.139) -- 0:00:20 673000 -- (-1475.612) [-1475.570] (-1472.675) (-1478.732) * (-1473.551) (-1473.227) [-1472.122] (-1475.752) -- 0:00:20 673500 -- (-1473.300) (-1472.415) [-1473.107] (-1476.398) * (-1473.913) (-1476.994) (-1472.979) [-1478.385] -- 0:00:20 674000 -- (-1473.449) (-1472.611) [-1474.771] (-1474.726) * (-1473.426) [-1475.226] (-1472.850) (-1475.022) -- 0:00:20 674500 -- (-1475.997) (-1473.554) [-1476.399] (-1473.192) * (-1472.517) (-1475.023) [-1472.901] (-1473.963) -- 0:00:20 675000 -- (-1477.111) [-1474.093] (-1472.363) (-1474.042) * (-1480.296) (-1474.413) [-1476.003] (-1472.933) -- 0:00:20 Average standard deviation of split frequencies: 0.009632 675500 -- (-1473.533) [-1475.009] (-1474.422) (-1477.865) * (-1472.728) (-1475.371) [-1475.366] (-1473.546) -- 0:00:20 676000 -- (-1475.886) [-1474.121] (-1472.358) (-1474.088) * [-1474.884] (-1474.877) (-1472.375) (-1478.191) -- 0:00:20 676500 -- (-1473.273) (-1471.836) [-1474.858] (-1473.086) * (-1472.701) (-1473.858) [-1471.980] (-1473.516) -- 0:00:20 677000 -- (-1475.140) (-1472.121) (-1473.180) [-1472.212] * (-1475.909) [-1474.770] (-1474.911) (-1473.414) -- 0:00:20 677500 -- (-1474.270) [-1478.318] (-1472.342) (-1472.481) * [-1475.632] (-1476.075) (-1474.279) (-1475.108) -- 0:00:20 678000 -- (-1474.654) (-1479.497) (-1476.088) [-1472.393] * (-1474.155) (-1476.577) [-1472.016] (-1475.330) -- 0:00:20 678500 -- (-1474.986) (-1473.259) [-1473.466] (-1475.055) * (-1473.632) (-1472.827) [-1473.044] (-1473.900) -- 0:00:20 679000 -- (-1473.424) (-1472.790) (-1475.710) [-1475.258] * [-1474.917] (-1472.325) (-1477.200) (-1472.064) -- 0:00:20 679500 -- [-1476.126] (-1472.508) (-1472.327) (-1473.251) * [-1474.008] (-1471.856) (-1472.955) (-1472.470) -- 0:00:20 680000 -- (-1471.952) (-1472.852) [-1472.695] (-1471.768) * (-1475.354) [-1475.396] (-1472.246) (-1472.803) -- 0:00:20 Average standard deviation of split frequencies: 0.009263 680500 -- (-1473.199) (-1472.481) (-1472.626) [-1472.328] * [-1478.484] (-1473.347) (-1472.296) (-1473.101) -- 0:00:20 681000 -- [-1473.481] (-1475.584) (-1475.279) (-1473.388) * (-1476.936) (-1472.899) [-1472.238] (-1477.871) -- 0:00:20 681500 -- (-1473.152) (-1475.031) (-1473.007) [-1478.552] * (-1474.018) (-1475.446) (-1472.922) [-1474.172] -- 0:00:20 682000 -- (-1474.098) (-1473.928) [-1472.438] (-1475.790) * (-1475.838) [-1474.488] (-1474.108) (-1472.599) -- 0:00:20 682500 -- (-1476.933) [-1474.520] (-1473.138) (-1475.775) * (-1477.995) [-1472.629] (-1474.920) (-1476.811) -- 0:00:20 683000 -- [-1472.134] (-1476.477) (-1473.695) (-1472.745) * (-1480.188) (-1471.717) (-1472.688) [-1476.540] -- 0:00:19 683500 -- (-1474.012) [-1477.695] (-1473.529) (-1472.146) * (-1476.543) (-1473.355) [-1474.386] (-1474.515) -- 0:00:19 684000 -- [-1473.700] (-1480.889) (-1473.272) (-1472.616) * (-1475.608) (-1472.489) (-1475.420) [-1474.772] -- 0:00:19 684500 -- (-1476.823) (-1476.343) [-1473.826] (-1474.969) * [-1474.626] (-1473.317) (-1475.130) (-1474.362) -- 0:00:20 685000 -- (-1471.908) [-1473.347] (-1475.097) (-1473.850) * (-1475.010) (-1472.996) [-1475.938] (-1480.371) -- 0:00:20 Average standard deviation of split frequencies: 0.009277 685500 -- [-1472.052] (-1472.419) (-1476.660) (-1476.382) * (-1472.887) (-1475.950) (-1474.022) [-1474.082] -- 0:00:20 686000 -- (-1472.678) (-1472.633) [-1471.878] (-1475.652) * [-1477.128] (-1475.310) (-1472.510) (-1474.567) -- 0:00:20 686500 -- (-1477.479) [-1472.147] (-1477.130) (-1476.689) * (-1473.054) (-1473.286) [-1473.818] (-1476.678) -- 0:00:20 687000 -- [-1474.203] (-1472.756) (-1474.075) (-1475.040) * (-1477.731) (-1474.689) (-1473.989) [-1472.463] -- 0:00:20 687500 -- [-1474.747] (-1472.701) (-1473.599) (-1475.176) * [-1473.487] (-1475.355) (-1473.126) (-1473.569) -- 0:00:20 688000 -- (-1473.800) [-1474.181] (-1472.895) (-1473.883) * (-1476.386) [-1474.628] (-1476.075) (-1475.263) -- 0:00:19 688500 -- [-1474.774] (-1472.910) (-1471.916) (-1477.133) * (-1476.242) (-1472.501) (-1475.245) [-1474.150] -- 0:00:19 689000 -- (-1473.138) [-1471.763] (-1475.220) (-1473.714) * (-1474.858) [-1472.468] (-1475.405) (-1474.698) -- 0:00:19 689500 -- (-1476.952) (-1472.684) [-1473.853] (-1473.648) * (-1474.292) (-1471.809) [-1472.277] (-1475.519) -- 0:00:19 690000 -- (-1476.015) [-1473.000] (-1474.508) (-1474.878) * [-1474.526] (-1472.531) (-1475.794) (-1472.862) -- 0:00:19 Average standard deviation of split frequencies: 0.009300 690500 -- (-1475.879) (-1472.793) (-1471.923) [-1472.997] * (-1473.874) (-1477.449) (-1475.773) [-1473.421] -- 0:00:19 691000 -- (-1472.009) [-1475.019] (-1471.927) (-1472.363) * [-1476.531] (-1472.994) (-1473.929) (-1472.052) -- 0:00:19 691500 -- (-1474.307) (-1474.122) [-1471.927] (-1472.444) * (-1472.359) (-1472.465) (-1473.738) [-1472.641] -- 0:00:19 692000 -- (-1473.451) (-1475.903) (-1474.084) [-1473.160] * (-1474.350) (-1472.465) (-1476.281) [-1472.112] -- 0:00:19 692500 -- [-1472.390] (-1475.279) (-1476.115) (-1473.597) * [-1474.214] (-1472.287) (-1473.792) (-1474.523) -- 0:00:19 693000 -- (-1472.175) (-1474.811) (-1474.398) [-1472.173] * (-1471.978) (-1472.748) [-1476.042] (-1473.951) -- 0:00:19 693500 -- (-1473.949) (-1479.493) (-1472.201) [-1472.703] * (-1472.116) (-1473.025) (-1473.512) [-1473.092] -- 0:00:19 694000 -- (-1473.534) (-1474.846) (-1477.486) [-1472.626] * (-1472.862) [-1473.467] (-1475.413) (-1474.727) -- 0:00:19 694500 -- (-1474.715) (-1476.035) (-1475.465) [-1475.662] * (-1472.334) [-1474.412] (-1472.977) (-1475.573) -- 0:00:19 695000 -- (-1474.633) [-1476.337] (-1475.419) (-1477.550) * (-1471.959) (-1476.722) [-1473.246] (-1473.146) -- 0:00:19 Average standard deviation of split frequencies: 0.008895 695500 -- [-1474.875] (-1474.052) (-1476.990) (-1476.058) * [-1475.440] (-1473.865) (-1476.237) (-1475.368) -- 0:00:19 696000 -- (-1473.539) (-1476.732) (-1476.424) [-1474.025] * (-1479.126) [-1477.468] (-1472.587) (-1473.537) -- 0:00:19 696500 -- [-1476.032] (-1476.074) (-1475.650) (-1473.704) * (-1476.218) (-1478.266) (-1472.946) [-1471.856] -- 0:00:19 697000 -- (-1473.647) (-1475.613) (-1474.662) [-1474.467] * [-1473.723] (-1476.571) (-1473.389) (-1472.169) -- 0:00:19 697500 -- [-1473.642] (-1474.464) (-1476.452) (-1476.489) * (-1472.799) (-1471.990) (-1472.762) [-1473.504] -- 0:00:19 698000 -- (-1475.323) (-1474.681) [-1476.695] (-1476.052) * (-1473.377) [-1472.392] (-1473.422) (-1473.345) -- 0:00:19 698500 -- [-1475.549] (-1473.242) (-1472.348) (-1475.293) * (-1475.219) [-1473.971] (-1473.099) (-1477.546) -- 0:00:18 699000 -- (-1475.855) (-1472.136) (-1472.495) [-1473.368] * (-1476.257) [-1473.823] (-1473.263) (-1477.945) -- 0:00:18 699500 -- [-1476.067] (-1472.710) (-1472.836) (-1474.864) * (-1474.040) (-1473.772) [-1472.770] (-1475.038) -- 0:00:18 700000 -- (-1474.630) (-1473.991) [-1474.655] (-1474.582) * [-1472.900] (-1472.397) (-1474.956) (-1475.189) -- 0:00:18 Average standard deviation of split frequencies: 0.009167 700500 -- (-1473.264) (-1473.238) [-1474.848] (-1471.822) * (-1476.071) (-1472.517) [-1471.944] (-1474.128) -- 0:00:19 701000 -- (-1473.276) [-1472.448] (-1475.177) (-1473.332) * (-1477.036) [-1473.622] (-1474.285) (-1472.348) -- 0:00:19 701500 -- (-1476.719) (-1475.146) [-1474.943] (-1472.499) * (-1474.166) (-1476.678) [-1473.185] (-1472.240) -- 0:00:19 702000 -- [-1477.525] (-1472.370) (-1472.828) (-1472.401) * [-1476.402] (-1477.220) (-1475.293) (-1476.199) -- 0:00:19 702500 -- [-1475.857] (-1477.529) (-1475.890) (-1472.388) * (-1475.704) (-1474.741) [-1476.094] (-1473.746) -- 0:00:19 703000 -- (-1471.445) (-1475.519) [-1474.189] (-1474.966) * (-1477.556) (-1474.002) [-1473.416] (-1474.662) -- 0:00:19 703500 -- [-1475.708] (-1480.326) (-1473.747) (-1474.967) * [-1473.872] (-1472.851) (-1474.626) (-1477.084) -- 0:00:18 704000 -- (-1473.992) (-1472.754) (-1476.421) [-1473.194] * [-1476.321] (-1473.456) (-1476.231) (-1475.475) -- 0:00:18 704500 -- (-1479.045) [-1472.009] (-1486.094) (-1474.998) * (-1471.622) (-1476.195) [-1473.606] (-1472.135) -- 0:00:18 705000 -- (-1476.896) (-1475.040) (-1477.643) [-1475.524] * (-1472.785) [-1478.640] (-1474.827) (-1472.146) -- 0:00:18 Average standard deviation of split frequencies: 0.008931 705500 -- [-1473.496] (-1475.407) (-1480.259) (-1475.804) * (-1475.252) [-1472.592] (-1480.415) (-1475.245) -- 0:00:18 706000 -- (-1477.333) (-1472.429) (-1477.530) [-1473.145] * (-1477.294) (-1475.001) [-1473.591] (-1473.876) -- 0:00:18 706500 -- [-1474.244] (-1472.836) (-1472.342) (-1474.888) * (-1477.012) (-1475.111) [-1472.325] (-1472.132) -- 0:00:18 707000 -- (-1472.677) [-1474.590] (-1474.310) (-1477.098) * (-1474.308) [-1475.111] (-1472.542) (-1475.875) -- 0:00:18 707500 -- (-1473.034) (-1474.887) [-1475.984] (-1474.403) * (-1474.995) (-1473.399) (-1477.126) [-1475.839] -- 0:00:18 708000 -- [-1472.788] (-1473.295) (-1474.357) (-1473.635) * (-1475.933) (-1472.890) (-1476.154) [-1477.610] -- 0:00:18 708500 -- [-1471.709] (-1473.460) (-1472.717) (-1473.484) * [-1479.147] (-1474.508) (-1476.160) (-1473.053) -- 0:00:18 709000 -- (-1472.971) (-1477.832) (-1474.079) [-1473.375] * (-1477.136) [-1473.996] (-1475.147) (-1472.819) -- 0:00:18 709500 -- (-1475.239) (-1474.568) (-1473.959) [-1473.299] * (-1477.480) [-1475.494] (-1472.524) (-1473.211) -- 0:00:18 710000 -- (-1473.577) (-1476.397) [-1475.131] (-1475.606) * (-1473.830) (-1476.828) (-1474.085) [-1477.230] -- 0:00:18 Average standard deviation of split frequencies: 0.008667 710500 -- (-1474.925) (-1475.369) [-1472.982] (-1474.170) * (-1474.659) (-1472.965) [-1479.332] (-1474.601) -- 0:00:18 711000 -- (-1474.093) (-1472.897) [-1473.441] (-1474.143) * (-1471.916) (-1474.644) (-1479.700) [-1474.577] -- 0:00:18 711500 -- [-1473.815] (-1472.278) (-1475.977) (-1477.977) * (-1475.428) (-1473.450) (-1474.583) [-1475.248] -- 0:00:18 712000 -- (-1474.339) (-1475.078) [-1474.597] (-1473.895) * (-1473.861) (-1475.429) [-1473.557] (-1473.119) -- 0:00:18 712500 -- (-1474.711) [-1474.369] (-1478.126) (-1473.295) * (-1474.209) (-1475.824) [-1475.809] (-1474.915) -- 0:00:18 713000 -- (-1472.898) (-1473.695) (-1473.802) [-1474.280] * (-1474.145) [-1473.239] (-1476.018) (-1477.097) -- 0:00:18 713500 -- [-1471.909] (-1475.617) (-1475.560) (-1478.656) * (-1474.135) [-1474.542] (-1474.494) (-1474.301) -- 0:00:18 714000 -- (-1472.263) (-1471.838) (-1475.190) [-1474.624] * (-1474.534) (-1472.917) (-1472.470) [-1473.212] -- 0:00:18 714500 -- (-1472.789) (-1471.972) [-1474.564] (-1473.928) * (-1475.702) (-1473.997) (-1473.459) [-1475.523] -- 0:00:17 715000 -- (-1475.004) (-1475.545) [-1474.047] (-1475.660) * (-1475.863) (-1473.337) [-1473.457] (-1474.547) -- 0:00:17 Average standard deviation of split frequencies: 0.008230 715500 -- (-1473.195) (-1475.159) (-1473.016) [-1473.771] * (-1474.897) [-1473.015] (-1478.849) (-1472.632) -- 0:00:17 716000 -- (-1473.156) (-1473.020) [-1474.752] (-1474.089) * (-1473.817) [-1473.570] (-1475.018) (-1473.740) -- 0:00:17 716500 -- (-1472.766) (-1476.637) [-1473.414] (-1473.941) * (-1472.287) (-1476.585) [-1474.233] (-1477.255) -- 0:00:18 717000 -- (-1472.472) (-1476.594) [-1473.469] (-1472.625) * (-1472.114) (-1473.085) (-1472.962) [-1474.399] -- 0:00:18 717500 -- (-1471.822) (-1473.274) [-1472.916] (-1473.643) * (-1473.661) [-1473.312] (-1475.612) (-1474.706) -- 0:00:18 718000 -- (-1475.680) (-1472.026) [-1473.493] (-1474.489) * (-1472.913) [-1471.523] (-1476.025) (-1473.004) -- 0:00:18 718500 -- [-1473.238] (-1472.804) (-1471.778) (-1474.267) * (-1472.957) (-1473.360) (-1483.353) [-1474.819] -- 0:00:18 719000 -- [-1473.292] (-1476.925) (-1471.718) (-1478.564) * (-1474.868) (-1472.733) (-1473.322) [-1472.532] -- 0:00:17 719500 -- (-1473.108) (-1472.587) (-1472.592) [-1474.311] * [-1472.285] (-1472.507) (-1476.678) (-1472.971) -- 0:00:17 720000 -- (-1476.711) [-1473.856] (-1475.016) (-1473.444) * (-1479.719) (-1474.830) [-1473.550] (-1472.116) -- 0:00:17 Average standard deviation of split frequencies: 0.007849 720500 -- (-1472.600) (-1472.708) (-1479.359) [-1472.398] * [-1473.430] (-1476.527) (-1476.363) (-1472.822) -- 0:00:17 721000 -- [-1473.184] (-1476.104) (-1475.223) (-1473.593) * (-1474.401) [-1473.852] (-1474.066) (-1475.672) -- 0:00:17 721500 -- (-1473.744) (-1472.799) [-1473.187] (-1473.110) * (-1475.173) (-1473.852) (-1473.938) [-1478.182] -- 0:00:17 722000 -- (-1472.601) (-1475.685) [-1472.289] (-1473.492) * (-1473.838) (-1475.172) [-1474.433] (-1477.993) -- 0:00:17 722500 -- (-1472.497) (-1475.268) [-1473.880] (-1471.989) * (-1474.942) (-1473.983) [-1474.076] (-1475.399) -- 0:00:17 723000 -- (-1472.034) (-1474.484) (-1474.758) [-1476.476] * (-1473.843) [-1471.633] (-1474.555) (-1475.124) -- 0:00:17 723500 -- (-1473.186) (-1473.635) [-1477.668] (-1481.204) * (-1472.886) (-1471.997) (-1473.098) [-1473.916] -- 0:00:17 724000 -- (-1475.640) [-1474.934] (-1472.395) (-1473.721) * (-1472.638) [-1471.808] (-1476.691) (-1472.810) -- 0:00:17 724500 -- (-1475.672) (-1472.033) [-1472.282] (-1476.039) * (-1475.919) [-1474.884] (-1477.877) (-1476.005) -- 0:00:17 725000 -- (-1476.546) [-1474.130] (-1472.341) (-1477.445) * (-1476.053) [-1472.280] (-1474.238) (-1472.593) -- 0:00:17 Average standard deviation of split frequencies: 0.008401 725500 -- [-1474.413] (-1472.142) (-1474.240) (-1475.493) * [-1473.256] (-1472.111) (-1474.385) (-1473.416) -- 0:00:17 726000 -- (-1474.453) (-1473.142) (-1477.142) [-1475.715] * (-1476.334) [-1474.769] (-1474.245) (-1475.612) -- 0:00:17 726500 -- (-1475.786) (-1477.690) (-1474.456) [-1474.583] * (-1473.985) (-1473.696) (-1477.182) [-1473.720] -- 0:00:17 727000 -- (-1475.110) (-1473.852) [-1475.884] (-1475.672) * [-1472.710] (-1473.369) (-1472.709) (-1471.620) -- 0:00:17 727500 -- [-1476.633] (-1472.965) (-1477.541) (-1476.378) * [-1474.728] (-1475.957) (-1473.647) (-1472.153) -- 0:00:17 728000 -- (-1475.701) (-1473.616) [-1473.659] (-1472.449) * (-1483.015) (-1477.268) [-1472.003] (-1472.136) -- 0:00:17 728500 -- (-1476.485) (-1477.190) [-1472.226] (-1473.965) * (-1475.023) (-1476.787) (-1476.145) [-1472.834] -- 0:00:17 729000 -- (-1475.088) (-1476.358) (-1474.844) [-1472.927] * (-1475.427) (-1476.081) [-1474.516] (-1471.941) -- 0:00:17 729500 -- (-1474.583) (-1475.615) [-1473.294] (-1474.679) * (-1477.298) (-1474.504) [-1474.125] (-1474.757) -- 0:00:17 730000 -- (-1473.544) (-1477.253) (-1476.349) [-1473.654] * (-1475.393) (-1474.188) [-1474.761] (-1473.030) -- 0:00:17 Average standard deviation of split frequencies: 0.008669 730500 -- (-1473.118) (-1472.366) (-1476.364) [-1474.803] * (-1471.827) (-1474.652) (-1472.624) [-1474.057] -- 0:00:16 731000 -- (-1472.897) (-1473.708) [-1472.965] (-1473.587) * (-1472.930) [-1474.433] (-1473.874) (-1474.575) -- 0:00:16 731500 -- (-1473.363) (-1476.800) [-1474.479] (-1472.539) * (-1474.515) (-1473.271) [-1473.350] (-1473.984) -- 0:00:16 732000 -- (-1472.946) (-1479.013) [-1478.426] (-1475.792) * [-1477.024] (-1475.910) (-1475.077) (-1475.175) -- 0:00:16 732500 -- (-1477.092) (-1474.475) (-1477.429) [-1477.723] * [-1474.061] (-1475.476) (-1473.799) (-1472.252) -- 0:00:17 733000 -- (-1474.764) (-1472.715) [-1474.173] (-1474.020) * (-1474.663) [-1472.589] (-1475.044) (-1472.198) -- 0:00:17 733500 -- (-1474.923) [-1473.635] (-1473.281) (-1475.061) * (-1476.442) [-1476.140] (-1471.921) (-1475.076) -- 0:00:17 734000 -- (-1472.709) [-1472.871] (-1473.444) (-1473.031) * [-1473.649] (-1473.161) (-1471.793) (-1475.691) -- 0:00:17 734500 -- (-1471.710) (-1472.602) [-1474.989] (-1472.455) * (-1475.102) (-1476.154) [-1471.883] (-1475.481) -- 0:00:16 735000 -- [-1472.373] (-1474.342) (-1474.754) (-1471.595) * (-1474.485) [-1473.517] (-1474.372) (-1471.938) -- 0:00:16 Average standard deviation of split frequencies: 0.008687 735500 -- (-1477.549) (-1478.926) [-1474.201] (-1472.482) * (-1474.464) (-1472.430) [-1473.257] (-1472.486) -- 0:00:16 736000 -- (-1476.331) (-1472.531) [-1472.859] (-1473.319) * (-1472.791) [-1472.960] (-1484.992) (-1472.066) -- 0:00:16 736500 -- (-1474.482) (-1472.126) [-1472.272] (-1473.687) * (-1473.561) (-1473.274) [-1474.573] (-1474.820) -- 0:00:16 737000 -- (-1473.784) [-1472.006] (-1473.448) (-1472.724) * [-1473.183] (-1475.818) (-1475.762) (-1473.672) -- 0:00:16 737500 -- (-1471.831) [-1472.231] (-1478.953) (-1472.914) * (-1474.182) (-1473.343) (-1477.129) [-1472.722] -- 0:00:16 738000 -- (-1475.860) (-1473.279) [-1474.332] (-1475.452) * [-1474.153] (-1473.254) (-1473.193) (-1474.967) -- 0:00:16 738500 -- (-1475.197) [-1472.910] (-1474.863) (-1479.965) * (-1473.315) (-1472.660) (-1475.928) [-1476.662] -- 0:00:16 739000 -- [-1471.977] (-1479.344) (-1476.214) (-1474.700) * (-1473.587) (-1476.589) (-1476.043) [-1473.615] -- 0:00:16 739500 -- (-1475.398) (-1471.880) (-1473.017) [-1476.683] * [-1475.080] (-1474.120) (-1474.660) (-1472.804) -- 0:00:16 740000 -- (-1478.917) (-1474.511) [-1473.491] (-1477.852) * (-1474.095) (-1475.581) (-1475.262) [-1472.144] -- 0:00:16 Average standard deviation of split frequencies: 0.008473 740500 -- (-1482.625) (-1474.109) (-1474.061) [-1474.507] * (-1472.691) (-1473.554) [-1473.156] (-1472.316) -- 0:00:16 741000 -- (-1472.692) (-1474.043) [-1477.397] (-1477.373) * [-1473.121] (-1473.881) (-1473.433) (-1472.109) -- 0:00:16 741500 -- [-1472.648] (-1472.587) (-1473.832) (-1473.395) * [-1473.352] (-1473.830) (-1472.657) (-1475.791) -- 0:00:16 742000 -- (-1473.440) (-1472.740) [-1476.999] (-1473.291) * (-1472.499) [-1473.620] (-1473.934) (-1479.582) -- 0:00:16 742500 -- (-1474.183) (-1472.919) (-1481.569) [-1473.482] * (-1472.385) (-1473.919) (-1473.479) [-1473.600] -- 0:00:16 743000 -- (-1475.483) [-1473.031] (-1475.859) (-1475.129) * (-1473.049) (-1473.116) [-1474.986] (-1471.955) -- 0:00:16 743500 -- (-1474.542) (-1473.099) (-1472.756) [-1474.581] * (-1472.289) (-1471.913) [-1474.082] (-1472.148) -- 0:00:16 744000 -- (-1473.741) [-1476.065] (-1472.610) (-1475.329) * [-1472.206] (-1475.243) (-1474.607) (-1474.196) -- 0:00:16 744500 -- [-1477.357] (-1473.061) (-1472.759) (-1473.991) * (-1474.127) (-1472.017) [-1472.971] (-1472.353) -- 0:00:16 745000 -- (-1475.944) (-1475.532) (-1476.031) [-1471.856] * (-1474.385) [-1474.763] (-1476.827) (-1472.788) -- 0:00:16 Average standard deviation of split frequencies: 0.007938 745500 -- [-1474.824] (-1474.328) (-1474.526) (-1471.856) * (-1474.484) (-1477.336) [-1474.633] (-1475.975) -- 0:00:16 746000 -- (-1474.064) (-1476.701) (-1473.521) [-1473.168] * [-1474.141] (-1474.900) (-1473.780) (-1474.449) -- 0:00:16 746500 -- (-1476.516) (-1475.618) (-1473.331) [-1472.904] * (-1475.210) [-1475.045] (-1471.844) (-1473.191) -- 0:00:15 747000 -- (-1475.090) (-1476.042) [-1472.763] (-1476.628) * (-1474.926) (-1478.921) (-1472.551) [-1472.543] -- 0:00:15 747500 -- [-1472.894] (-1477.542) (-1472.736) (-1474.915) * (-1476.055) [-1476.533] (-1477.369) (-1477.539) -- 0:00:15 748000 -- [-1472.909] (-1472.042) (-1473.713) (-1475.677) * (-1473.615) (-1475.915) [-1474.484] (-1477.610) -- 0:00:15 748500 -- (-1472.755) (-1473.001) (-1476.080) [-1472.373] * [-1472.893] (-1472.370) (-1472.160) (-1473.155) -- 0:00:16 749000 -- (-1475.559) (-1477.758) (-1472.108) [-1472.142] * (-1473.533) (-1473.530) [-1472.421] (-1475.984) -- 0:00:16 749500 -- (-1472.401) (-1474.844) [-1473.526] (-1471.971) * [-1472.744] (-1472.376) (-1472.820) (-1474.495) -- 0:00:16 750000 -- [-1471.810] (-1472.939) (-1474.478) (-1473.129) * (-1474.491) [-1471.873] (-1475.527) (-1473.697) -- 0:00:16 Average standard deviation of split frequencies: 0.008164 750500 -- (-1477.081) (-1473.072) (-1477.309) [-1473.825] * (-1472.550) [-1475.238] (-1472.462) (-1479.826) -- 0:00:15 751000 -- (-1475.569) (-1473.335) (-1475.484) [-1473.152] * (-1472.597) (-1474.894) (-1472.001) [-1472.248] -- 0:00:15 751500 -- (-1474.016) (-1473.429) (-1472.978) [-1476.215] * (-1477.841) (-1472.120) (-1471.775) [-1474.773] -- 0:00:15 752000 -- (-1475.346) (-1472.449) (-1474.465) [-1473.233] * (-1473.590) (-1472.658) [-1474.301] (-1475.471) -- 0:00:15 752500 -- [-1473.959] (-1473.037) (-1473.721) (-1474.560) * [-1471.916] (-1473.753) (-1476.257) (-1473.326) -- 0:00:15 753000 -- [-1473.306] (-1476.465) (-1472.817) (-1474.158) * (-1473.031) (-1478.077) [-1475.502] (-1475.568) -- 0:00:15 753500 -- [-1472.862] (-1473.802) (-1471.845) (-1472.995) * (-1476.925) (-1477.768) [-1474.291] (-1472.100) -- 0:00:15 754000 -- (-1475.326) [-1472.744] (-1476.468) (-1473.042) * (-1478.436) [-1472.797] (-1474.282) (-1475.004) -- 0:00:15 754500 -- (-1477.805) (-1475.554) [-1473.490] (-1474.488) * [-1475.118] (-1473.000) (-1475.155) (-1472.797) -- 0:00:15 755000 -- [-1476.595] (-1477.845) (-1473.438) (-1474.700) * (-1473.042) (-1472.189) [-1474.197] (-1476.178) -- 0:00:15 Average standard deviation of split frequencies: 0.008439 755500 -- [-1477.519] (-1473.020) (-1473.460) (-1474.963) * (-1475.869) [-1472.423] (-1477.211) (-1473.058) -- 0:00:15 756000 -- (-1473.077) (-1477.424) (-1473.939) [-1473.826] * (-1475.619) (-1473.829) [-1471.871] (-1473.669) -- 0:00:15 756500 -- (-1474.939) (-1474.990) (-1473.933) [-1475.575] * (-1474.512) (-1472.700) (-1473.901) [-1473.110] -- 0:00:15 757000 -- (-1477.419) (-1475.459) [-1472.845] (-1484.596) * (-1476.273) (-1472.802) [-1473.107] (-1474.236) -- 0:00:15 757500 -- (-1474.445) (-1477.584) (-1472.939) [-1473.980] * [-1471.744] (-1473.820) (-1475.211) (-1478.017) -- 0:00:15 758000 -- [-1474.200] (-1472.888) (-1473.369) (-1475.692) * (-1472.298) (-1472.731) (-1474.354) [-1476.325] -- 0:00:15 758500 -- (-1473.314) (-1472.950) [-1475.783] (-1473.645) * (-1474.097) [-1473.526] (-1471.952) (-1471.890) -- 0:00:15 759000 -- (-1475.670) (-1478.615) [-1473.805] (-1475.576) * (-1473.985) (-1479.164) (-1475.961) [-1473.956] -- 0:00:15 759500 -- [-1473.397] (-1474.337) (-1475.116) (-1476.229) * (-1472.835) (-1474.462) (-1475.139) [-1472.223] -- 0:00:15 760000 -- (-1473.518) (-1475.038) [-1473.096] (-1475.663) * [-1478.493] (-1475.012) (-1478.875) (-1472.928) -- 0:00:15 Average standard deviation of split frequencies: 0.008139 760500 -- (-1473.702) (-1473.225) [-1476.450] (-1475.127) * (-1474.220) (-1473.521) [-1472.228] (-1475.789) -- 0:00:15 761000 -- (-1473.904) (-1472.140) [-1473.343] (-1479.163) * (-1474.447) (-1472.814) [-1472.710] (-1475.896) -- 0:00:15 761500 -- (-1472.546) (-1473.417) (-1475.727) [-1476.283] * (-1476.703) (-1477.421) [-1472.089] (-1474.720) -- 0:00:15 762000 -- (-1474.432) (-1472.168) (-1473.991) [-1475.753] * (-1476.719) [-1472.167] (-1473.644) (-1473.526) -- 0:00:14 762500 -- (-1473.104) (-1473.336) (-1472.738) [-1472.323] * (-1476.524) [-1473.180] (-1477.496) (-1474.736) -- 0:00:14 763000 -- [-1474.917] (-1475.955) (-1473.447) (-1473.019) * (-1474.987) [-1472.470] (-1476.828) (-1473.138) -- 0:00:14 763500 -- (-1477.441) (-1472.235) [-1473.822] (-1473.370) * (-1473.630) [-1472.772] (-1475.351) (-1473.301) -- 0:00:14 764000 -- [-1473.558] (-1475.251) (-1475.733) (-1473.546) * [-1473.469] (-1473.846) (-1471.973) (-1473.227) -- 0:00:14 764500 -- (-1473.006) (-1475.366) [-1474.409] (-1472.821) * (-1478.848) (-1473.103) (-1472.506) [-1473.372] -- 0:00:15 765000 -- (-1472.835) (-1475.517) (-1480.495) [-1472.898] * (-1474.465) (-1472.898) (-1472.252) [-1472.388] -- 0:00:15 Average standard deviation of split frequencies: 0.008041 765500 -- (-1472.975) (-1476.824) [-1472.717] (-1473.244) * (-1474.485) (-1475.399) [-1472.435] (-1472.042) -- 0:00:15 766000 -- (-1471.742) (-1477.255) (-1473.545) [-1472.747] * [-1473.479] (-1473.790) (-1473.949) (-1474.547) -- 0:00:14 766500 -- (-1472.606) [-1473.406] (-1473.157) (-1473.294) * (-1478.893) (-1475.381) (-1475.824) [-1474.233] -- 0:00:14 767000 -- [-1473.495] (-1472.051) (-1476.556) (-1472.078) * (-1474.154) (-1474.282) [-1472.598] (-1478.014) -- 0:00:14 767500 -- (-1473.443) [-1474.769] (-1472.496) (-1472.882) * (-1473.394) (-1473.599) [-1473.949] (-1476.629) -- 0:00:14 768000 -- (-1473.865) [-1474.229] (-1477.473) (-1475.922) * (-1472.959) (-1473.909) (-1472.343) [-1477.653] -- 0:00:14 768500 -- (-1476.585) [-1472.862] (-1474.123) (-1476.276) * (-1474.661) (-1474.787) [-1472.686] (-1474.743) -- 0:00:14 769000 -- (-1473.388) (-1472.644) [-1474.919] (-1473.755) * (-1473.796) [-1475.278] (-1474.475) (-1475.847) -- 0:00:14 769500 -- (-1473.265) [-1471.672] (-1472.454) (-1473.162) * [-1473.851] (-1479.284) (-1475.738) (-1474.796) -- 0:00:14 770000 -- (-1475.110) (-1473.124) [-1474.395] (-1473.053) * [-1475.283] (-1472.080) (-1473.105) (-1476.775) -- 0:00:14 Average standard deviation of split frequencies: 0.008604 770500 -- (-1473.320) [-1475.090] (-1473.015) (-1476.816) * (-1474.964) (-1472.887) [-1478.811] (-1475.008) -- 0:00:14 771000 -- [-1473.053] (-1474.061) (-1474.000) (-1473.754) * (-1474.840) [-1474.294] (-1472.314) (-1473.255) -- 0:00:14 771500 -- (-1474.758) (-1477.027) (-1474.222) [-1477.878] * (-1473.560) [-1472.781] (-1474.294) (-1474.100) -- 0:00:14 772000 -- (-1472.881) [-1475.254] (-1476.335) (-1473.537) * (-1472.905) (-1479.388) [-1475.215] (-1473.705) -- 0:00:14 772500 -- (-1472.945) (-1476.117) [-1472.978] (-1473.106) * (-1474.488) (-1476.898) (-1475.982) [-1471.873] -- 0:00:14 773000 -- (-1471.684) [-1471.859] (-1474.643) (-1472.347) * [-1474.655] (-1475.297) (-1477.218) (-1475.895) -- 0:00:14 773500 -- (-1474.834) [-1474.025] (-1474.614) (-1473.255) * (-1473.740) (-1477.050) [-1478.466] (-1474.066) -- 0:00:14 774000 -- (-1478.138) [-1472.536] (-1477.077) (-1475.239) * (-1472.970) [-1476.545] (-1473.295) (-1473.509) -- 0:00:14 774500 -- (-1474.348) (-1474.611) [-1473.762] (-1471.577) * (-1473.633) [-1475.855] (-1474.502) (-1475.244) -- 0:00:14 775000 -- (-1473.747) [-1472.694] (-1472.558) (-1471.837) * (-1474.299) (-1473.086) (-1475.896) [-1475.695] -- 0:00:14 Average standard deviation of split frequencies: 0.008262 775500 -- (-1473.772) (-1472.300) [-1472.544] (-1477.333) * [-1472.793] (-1477.942) (-1472.062) (-1474.585) -- 0:00:14 776000 -- [-1474.830] (-1472.868) (-1472.852) (-1472.716) * [-1474.377] (-1474.266) (-1473.897) (-1474.355) -- 0:00:14 776500 -- (-1475.243) (-1472.553) (-1474.263) [-1472.882] * (-1476.924) (-1473.143) (-1478.721) [-1471.839] -- 0:00:14 777000 -- (-1475.047) [-1472.671] (-1472.328) (-1473.006) * (-1472.062) [-1473.290] (-1472.450) (-1472.407) -- 0:00:14 777500 -- (-1476.202) (-1473.602) (-1478.267) [-1474.821] * (-1475.202) (-1471.808) [-1473.216] (-1472.372) -- 0:00:14 778000 -- (-1474.815) (-1473.298) (-1478.031) [-1473.039] * (-1471.960) [-1471.882] (-1472.981) (-1472.620) -- 0:00:13 778500 -- [-1473.443] (-1474.395) (-1475.949) (-1474.477) * [-1475.039] (-1473.207) (-1472.890) (-1473.374) -- 0:00:13 779000 -- [-1472.657] (-1474.173) (-1478.628) (-1472.121) * (-1476.094) [-1473.318] (-1473.013) (-1475.903) -- 0:00:13 779500 -- [-1472.609] (-1472.740) (-1478.037) (-1471.645) * (-1476.281) (-1473.321) [-1478.025] (-1474.931) -- 0:00:13 780000 -- (-1473.772) (-1473.543) [-1473.124] (-1476.488) * (-1473.278) (-1474.894) (-1473.393) [-1472.181] -- 0:00:13 Average standard deviation of split frequencies: 0.007971 780500 -- [-1474.580] (-1473.780) (-1473.271) (-1475.381) * (-1476.264) [-1472.971] (-1475.255) (-1472.431) -- 0:00:14 781000 -- (-1475.377) [-1476.029] (-1474.853) (-1475.242) * (-1479.698) (-1474.740) (-1473.897) [-1473.351] -- 0:00:14 781500 -- [-1475.425] (-1473.012) (-1476.407) (-1473.272) * (-1476.325) (-1484.968) (-1475.108) [-1472.399] -- 0:00:13 782000 -- [-1473.842] (-1475.239) (-1475.505) (-1472.952) * (-1476.959) (-1476.966) [-1474.580] (-1472.594) -- 0:00:13 782500 -- (-1475.444) [-1474.909] (-1475.936) (-1474.604) * (-1473.068) (-1484.268) (-1474.877) [-1473.162] -- 0:00:13 783000 -- [-1473.613] (-1473.260) (-1475.389) (-1480.003) * (-1474.229) (-1474.308) [-1472.817] (-1473.392) -- 0:00:13 783500 -- (-1474.170) [-1476.437] (-1472.558) (-1472.864) * (-1473.206) [-1475.728] (-1472.195) (-1471.879) -- 0:00:13 784000 -- [-1473.421] (-1478.731) (-1471.982) (-1472.993) * (-1472.471) [-1475.350] (-1472.354) (-1472.620) -- 0:00:13 784500 -- [-1472.863] (-1474.464) (-1473.913) (-1474.281) * (-1473.927) (-1476.773) [-1472.678] (-1482.089) -- 0:00:13 785000 -- [-1472.863] (-1478.800) (-1473.142) (-1475.924) * (-1475.122) (-1475.704) (-1474.578) [-1474.741] -- 0:00:13 Average standard deviation of split frequencies: 0.008157 785500 -- (-1472.545) [-1476.596] (-1473.288) (-1473.876) * (-1472.605) (-1473.991) (-1477.686) [-1473.336] -- 0:00:13 786000 -- (-1475.888) (-1474.244) [-1475.090] (-1475.135) * (-1477.125) [-1474.130] (-1474.983) (-1474.102) -- 0:00:13 786500 -- (-1473.278) (-1477.676) [-1475.216] (-1477.631) * [-1473.245] (-1473.876) (-1473.380) (-1476.313) -- 0:00:13 787000 -- (-1476.802) (-1474.052) (-1476.535) [-1472.717] * (-1473.499) (-1472.318) (-1475.577) [-1474.043] -- 0:00:13 787500 -- [-1473.587] (-1473.948) (-1473.465) (-1476.558) * (-1474.385) (-1473.063) [-1472.930] (-1476.010) -- 0:00:13 788000 -- (-1476.378) [-1473.955] (-1473.950) (-1474.870) * (-1475.135) [-1474.637] (-1474.944) (-1474.608) -- 0:00:13 788500 -- (-1475.717) (-1472.755) (-1472.412) [-1473.282] * (-1472.812) (-1474.009) [-1474.964] (-1475.311) -- 0:00:13 789000 -- [-1472.662] (-1472.818) (-1472.813) (-1473.618) * (-1471.933) (-1477.816) [-1474.085] (-1474.339) -- 0:00:13 789500 -- (-1472.698) (-1474.386) (-1479.418) [-1474.528] * [-1472.312] (-1474.949) (-1475.370) (-1471.651) -- 0:00:13 790000 -- (-1472.977) (-1472.073) (-1475.363) [-1475.153] * (-1472.348) (-1476.900) (-1473.075) [-1475.141] -- 0:00:13 Average standard deviation of split frequencies: 0.008387 790500 -- (-1480.166) (-1477.627) (-1474.669) [-1473.279] * [-1472.340] (-1472.744) (-1473.389) (-1472.923) -- 0:00:13 791000 -- [-1474.432] (-1477.711) (-1474.602) (-1474.343) * (-1472.568) (-1474.377) (-1472.967) [-1473.887] -- 0:00:13 791500 -- (-1475.114) [-1474.322] (-1476.098) (-1473.556) * [-1472.117] (-1472.272) (-1474.565) (-1475.653) -- 0:00:13 792000 -- (-1475.086) (-1473.551) (-1476.349) [-1473.891] * (-1472.995) (-1472.267) [-1472.702] (-1475.242) -- 0:00:13 792500 -- (-1475.636) (-1473.135) [-1472.669] (-1473.217) * (-1474.009) (-1474.274) (-1472.948) [-1472.526] -- 0:00:13 793000 -- [-1473.486] (-1473.392) (-1473.328) (-1472.186) * (-1473.908) (-1477.073) (-1474.196) [-1474.068] -- 0:00:13 793500 -- [-1473.518] (-1473.463) (-1475.439) (-1471.762) * (-1471.672) (-1475.573) (-1473.741) [-1474.068] -- 0:00:13 794000 -- (-1472.973) [-1472.854] (-1472.258) (-1472.606) * (-1474.236) (-1474.250) (-1472.777) [-1473.097] -- 0:00:12 794500 -- [-1479.998] (-1473.803) (-1472.683) (-1473.436) * (-1474.322) (-1476.103) [-1473.748] (-1472.587) -- 0:00:12 795000 -- (-1477.811) (-1475.226) (-1473.896) [-1473.342] * (-1474.604) [-1474.075] (-1473.213) (-1473.550) -- 0:00:12 Average standard deviation of split frequencies: 0.007921 795500 -- (-1479.828) (-1473.625) [-1473.975] (-1473.603) * (-1475.033) [-1475.052] (-1477.771) (-1474.167) -- 0:00:12 796000 -- (-1474.768) (-1473.955) [-1474.065] (-1472.880) * (-1471.941) [-1476.131] (-1473.511) (-1480.140) -- 0:00:12 796500 -- (-1475.973) [-1475.553] (-1476.748) (-1472.648) * (-1476.522) [-1474.826] (-1472.762) (-1472.173) -- 0:00:13 797000 -- (-1476.025) [-1474.746] (-1473.015) (-1472.994) * (-1474.540) (-1474.488) (-1474.966) [-1472.785] -- 0:00:12 797500 -- (-1473.124) (-1479.232) [-1474.101] (-1476.271) * [-1474.855] (-1473.349) (-1477.417) (-1474.868) -- 0:00:12 798000 -- (-1480.407) (-1475.892) (-1473.184) [-1473.036] * [-1475.872] (-1475.722) (-1475.884) (-1477.209) -- 0:00:12 798500 -- (-1477.335) (-1472.326) [-1471.900] (-1477.014) * (-1475.184) (-1473.346) [-1475.956] (-1473.893) -- 0:00:12 799000 -- (-1475.317) [-1474.055] (-1474.801) (-1475.436) * [-1475.010] (-1473.709) (-1473.983) (-1479.749) -- 0:00:12 799500 -- [-1472.511] (-1476.115) (-1475.943) (-1474.342) * (-1474.217) [-1473.770] (-1477.465) (-1472.706) -- 0:00:12 800000 -- [-1474.550] (-1475.129) (-1473.525) (-1476.741) * (-1475.786) [-1473.573] (-1474.956) (-1471.643) -- 0:00:12 Average standard deviation of split frequencies: 0.007728 800500 -- (-1479.269) (-1475.110) (-1476.349) [-1474.163] * (-1473.044) (-1474.352) (-1473.596) [-1471.697] -- 0:00:12 801000 -- [-1475.225] (-1472.230) (-1477.094) (-1474.742) * (-1473.894) (-1473.570) [-1473.177] (-1472.212) -- 0:00:12 801500 -- (-1474.384) [-1472.889] (-1473.759) (-1482.155) * (-1475.035) [-1473.869] (-1472.939) (-1474.067) -- 0:00:12 802000 -- (-1475.578) [-1476.689] (-1475.064) (-1473.151) * (-1477.815) (-1478.328) [-1473.108] (-1473.033) -- 0:00:12 802500 -- (-1472.951) (-1472.811) [-1473.322] (-1472.102) * (-1473.945) (-1473.539) [-1471.861] (-1472.249) -- 0:00:12 803000 -- (-1474.972) [-1472.872] (-1473.553) (-1472.859) * (-1472.339) (-1475.493) [-1474.616] (-1474.052) -- 0:00:12 803500 -- (-1475.173) [-1474.207] (-1474.687) (-1476.330) * (-1474.323) (-1474.165) (-1474.797) [-1473.856] -- 0:00:12 804000 -- (-1474.727) [-1478.746] (-1474.034) (-1475.599) * (-1476.299) (-1472.095) (-1475.079) [-1475.821] -- 0:00:12 804500 -- (-1473.482) (-1472.299) [-1476.297] (-1473.811) * (-1473.674) (-1475.648) [-1482.020] (-1473.319) -- 0:00:12 805000 -- (-1474.228) (-1472.922) (-1473.572) [-1474.479] * (-1472.736) (-1475.313) (-1477.464) [-1472.250] -- 0:00:12 Average standard deviation of split frequencies: 0.008188 805500 -- (-1472.853) (-1474.790) [-1472.260] (-1476.331) * (-1477.928) (-1477.443) (-1472.394) [-1472.530] -- 0:00:12 806000 -- (-1473.701) (-1474.722) [-1478.231] (-1477.575) * [-1475.500] (-1474.064) (-1473.003) (-1474.667) -- 0:00:12 806500 -- [-1479.017] (-1475.104) (-1479.203) (-1473.870) * (-1472.463) [-1472.144] (-1472.964) (-1475.508) -- 0:00:12 807000 -- (-1478.883) (-1472.861) (-1478.517) [-1473.096] * (-1476.183) (-1480.975) (-1471.811) [-1472.855] -- 0:00:12 807500 -- (-1473.511) (-1472.026) (-1473.833) [-1473.004] * (-1474.103) (-1477.113) [-1473.342] (-1472.202) -- 0:00:12 808000 -- [-1474.298] (-1471.929) (-1473.321) (-1473.023) * (-1474.821) (-1474.602) [-1472.645] (-1477.459) -- 0:00:12 808500 -- (-1477.780) [-1475.502] (-1472.979) (-1472.243) * (-1476.934) [-1471.933] (-1473.127) (-1486.333) -- 0:00:12 809000 -- (-1474.514) (-1473.602) (-1472.130) [-1472.911] * (-1476.263) (-1473.045) [-1475.754] (-1477.916) -- 0:00:12 809500 -- (-1475.283) (-1474.047) [-1472.633] (-1472.248) * (-1473.249) (-1473.767) [-1472.725] (-1472.074) -- 0:00:12 810000 -- [-1474.020] (-1473.189) (-1472.908) (-1472.463) * (-1472.591) (-1475.610) [-1476.710] (-1472.156) -- 0:00:11 Average standard deviation of split frequencies: 0.007705 810500 -- (-1476.450) [-1472.341] (-1475.517) (-1481.662) * (-1472.220) [-1472.468] (-1475.460) (-1472.055) -- 0:00:11 811000 -- (-1475.119) (-1473.363) (-1473.974) [-1473.311] * (-1474.579) (-1473.332) (-1474.088) [-1472.016] -- 0:00:11 811500 -- (-1473.561) (-1484.526) (-1472.011) [-1473.293] * [-1472.421] (-1472.654) (-1476.480) (-1473.940) -- 0:00:11 812000 -- (-1477.096) (-1477.946) [-1472.970] (-1473.541) * [-1473.132] (-1473.005) (-1474.122) (-1474.819) -- 0:00:11 812500 -- (-1474.021) (-1475.097) [-1473.337] (-1472.732) * (-1474.334) (-1478.091) [-1475.061] (-1478.025) -- 0:00:11 813000 -- [-1472.918] (-1473.377) (-1476.381) (-1475.235) * (-1475.092) [-1472.833] (-1473.060) (-1479.545) -- 0:00:11 813500 -- (-1473.073) [-1476.304] (-1475.994) (-1472.883) * (-1473.251) (-1476.190) [-1472.151] (-1474.332) -- 0:00:11 814000 -- (-1472.648) (-1475.532) (-1475.123) [-1474.924] * [-1474.244] (-1478.437) (-1471.890) (-1476.080) -- 0:00:11 814500 -- [-1474.312] (-1474.164) (-1473.533) (-1473.363) * (-1474.240) (-1475.483) (-1472.668) [-1472.949] -- 0:00:11 815000 -- (-1473.421) (-1471.825) (-1475.906) [-1473.110] * (-1476.433) (-1473.619) (-1473.522) [-1475.629] -- 0:00:11 Average standard deviation of split frequencies: 0.007943 815500 -- [-1475.005] (-1472.208) (-1474.726) (-1473.169) * (-1475.380) (-1474.902) (-1473.976) [-1474.675] -- 0:00:11 816000 -- [-1473.761] (-1472.655) (-1473.820) (-1474.739) * (-1475.803) [-1473.833] (-1473.786) (-1471.888) -- 0:00:11 816500 -- [-1474.211] (-1476.993) (-1473.764) (-1474.311) * (-1474.512) (-1474.316) (-1475.246) [-1472.406] -- 0:00:11 817000 -- (-1474.802) (-1472.164) [-1473.530] (-1472.730) * (-1474.691) [-1473.335] (-1473.793) (-1476.349) -- 0:00:11 817500 -- (-1472.336) (-1474.537) [-1476.025] (-1473.874) * (-1477.834) (-1472.976) (-1473.593) [-1473.048] -- 0:00:11 818000 -- (-1475.553) [-1474.330] (-1472.616) (-1475.613) * (-1477.807) [-1475.526] (-1473.478) (-1473.580) -- 0:00:11 818500 -- (-1476.508) (-1474.744) (-1473.805) [-1474.328] * [-1475.522] (-1479.229) (-1475.938) (-1472.088) -- 0:00:11 819000 -- [-1472.425] (-1474.679) (-1473.061) (-1479.559) * (-1471.807) [-1476.747] (-1475.701) (-1472.387) -- 0:00:11 819500 -- (-1472.364) (-1475.212) [-1472.110] (-1472.655) * (-1471.909) (-1477.849) [-1472.249] (-1475.465) -- 0:00:11 820000 -- [-1472.591] (-1474.215) (-1477.118) (-1473.510) * [-1472.996] (-1474.795) (-1474.927) (-1474.531) -- 0:00:11 Average standard deviation of split frequencies: 0.007970 820500 -- [-1473.930] (-1474.308) (-1471.692) (-1473.979) * [-1474.117] (-1475.079) (-1473.783) (-1475.156) -- 0:00:11 821000 -- [-1472.123] (-1476.714) (-1473.715) (-1471.663) * (-1473.677) (-1474.305) (-1473.540) [-1472.813] -- 0:00:11 821500 -- (-1473.011) [-1472.207] (-1472.129) (-1473.506) * [-1472.827] (-1477.845) (-1473.594) (-1472.810) -- 0:00:11 822000 -- (-1473.939) (-1474.071) (-1473.790) [-1473.895] * (-1473.185) (-1473.382) [-1474.861] (-1474.674) -- 0:00:11 822500 -- (-1472.993) [-1472.315] (-1473.270) (-1476.996) * (-1472.514) (-1472.960) (-1473.275) [-1473.806] -- 0:00:11 823000 -- (-1475.671) (-1472.147) [-1474.726] (-1473.462) * [-1475.825] (-1474.339) (-1473.020) (-1473.740) -- 0:00:11 823500 -- (-1475.875) (-1473.251) [-1472.788] (-1473.990) * [-1476.026] (-1475.242) (-1474.007) (-1474.671) -- 0:00:11 824000 -- [-1476.454] (-1472.585) (-1472.944) (-1474.840) * (-1480.526) (-1474.933) [-1475.982] (-1474.961) -- 0:00:11 824500 -- [-1472.826] (-1477.839) (-1472.599) (-1478.004) * (-1475.822) (-1472.941) [-1472.442] (-1475.060) -- 0:00:11 825000 -- (-1475.244) [-1472.022] (-1474.358) (-1474.671) * (-1473.503) [-1476.776] (-1471.953) (-1474.743) -- 0:00:11 Average standard deviation of split frequencies: 0.008275 825500 -- (-1474.187) [-1473.417] (-1475.348) (-1475.150) * (-1472.323) [-1473.543] (-1473.148) (-1477.654) -- 0:00:10 826000 -- [-1472.921] (-1474.911) (-1476.220) (-1474.398) * (-1473.961) [-1472.750] (-1472.536) (-1474.673) -- 0:00:10 826500 -- [-1475.514] (-1473.679) (-1472.150) (-1473.436) * (-1473.439) (-1477.274) (-1471.939) [-1473.412] -- 0:00:10 827000 -- (-1474.437) (-1475.581) [-1473.555] (-1475.652) * (-1472.574) [-1475.608] (-1473.666) (-1472.284) -- 0:00:10 827500 -- (-1476.576) (-1474.546) [-1474.590] (-1472.409) * (-1474.267) [-1473.186] (-1478.238) (-1472.080) -- 0:00:10 828000 -- [-1473.787] (-1472.278) (-1474.949) (-1474.084) * [-1472.445] (-1475.013) (-1474.831) (-1473.117) -- 0:00:10 828500 -- (-1473.985) (-1472.860) (-1474.655) [-1474.095] * (-1473.513) (-1475.806) (-1476.741) [-1472.950] -- 0:00:10 829000 -- (-1473.269) (-1472.950) [-1475.061] (-1475.444) * (-1472.873) (-1474.667) [-1473.272] (-1476.215) -- 0:00:10 829500 -- (-1474.061) (-1472.720) [-1472.595] (-1473.860) * (-1472.574) [-1472.759] (-1473.221) (-1477.705) -- 0:00:10 830000 -- (-1473.910) (-1472.413) [-1472.818] (-1473.118) * (-1472.205) [-1472.078] (-1472.945) (-1475.316) -- 0:00:10 Average standard deviation of split frequencies: 0.008335 830500 -- (-1474.018) (-1473.317) (-1474.994) [-1473.605] * (-1474.050) [-1473.733] (-1473.005) (-1478.287) -- 0:00:10 831000 -- [-1474.255] (-1475.441) (-1474.455) (-1473.519) * (-1475.589) (-1472.862) (-1473.285) [-1478.009] -- 0:00:10 831500 -- (-1476.767) (-1472.877) (-1475.682) [-1475.358] * (-1472.671) (-1472.509) [-1474.486] (-1473.103) -- 0:00:10 832000 -- [-1473.070] (-1472.020) (-1479.526) (-1472.807) * (-1477.046) (-1472.915) (-1471.945) [-1472.764] -- 0:00:10 832500 -- (-1475.188) (-1472.400) (-1473.334) [-1474.949] * (-1474.397) (-1477.902) [-1475.049] (-1475.862) -- 0:00:10 833000 -- (-1477.858) (-1473.936) [-1474.757] (-1473.563) * (-1471.912) (-1473.281) [-1473.002] (-1473.702) -- 0:00:10 833500 -- (-1474.711) [-1473.493] (-1474.879) (-1474.314) * [-1478.538] (-1475.618) (-1474.992) (-1473.444) -- 0:00:10 834000 -- (-1472.653) (-1472.281) (-1478.505) [-1475.795] * (-1476.318) [-1477.569] (-1474.167) (-1473.581) -- 0:00:10 834500 -- (-1472.052) (-1472.902) (-1473.875) [-1473.636] * [-1471.937] (-1472.956) (-1471.968) (-1473.448) -- 0:00:10 835000 -- (-1475.190) (-1478.745) (-1475.262) [-1473.688] * [-1472.889] (-1472.325) (-1472.589) (-1473.562) -- 0:00:10 Average standard deviation of split frequencies: 0.008106 835500 -- (-1473.600) (-1474.807) (-1476.113) [-1477.352] * (-1472.450) (-1472.510) (-1472.095) [-1473.818] -- 0:00:10 836000 -- (-1473.608) [-1473.670] (-1475.153) (-1473.932) * (-1475.338) [-1472.510] (-1473.218) (-1472.763) -- 0:00:10 836500 -- (-1474.291) (-1472.662) [-1474.089] (-1472.621) * (-1477.715) [-1474.519] (-1473.720) (-1476.535) -- 0:00:10 837000 -- [-1473.150] (-1479.459) (-1472.756) (-1475.799) * (-1476.269) [-1471.967] (-1474.348) (-1475.442) -- 0:00:10 837500 -- [-1473.549] (-1475.945) (-1472.605) (-1474.174) * (-1476.218) (-1472.954) [-1472.175] (-1478.388) -- 0:00:10 838000 -- (-1472.852) (-1479.440) (-1472.582) [-1472.928] * [-1475.483] (-1472.824) (-1471.867) (-1477.370) -- 0:00:10 838500 -- [-1473.925] (-1474.468) (-1472.260) (-1472.908) * (-1472.301) (-1473.765) (-1475.347) [-1476.609] -- 0:00:10 839000 -- (-1473.560) [-1472.606] (-1471.923) (-1472.182) * [-1472.388] (-1478.043) (-1475.597) (-1475.247) -- 0:00:10 839500 -- (-1472.025) (-1474.844) [-1471.995] (-1472.258) * (-1473.388) [-1474.234] (-1475.352) (-1476.268) -- 0:00:10 840000 -- (-1472.523) (-1474.469) [-1472.756] (-1474.524) * (-1475.879) [-1473.539] (-1473.478) (-1475.533) -- 0:00:10 Average standard deviation of split frequencies: 0.008446 840500 -- (-1475.661) (-1474.913) (-1475.709) [-1475.378] * (-1472.331) (-1474.349) [-1476.011] (-1474.574) -- 0:00:10 841000 -- (-1474.561) [-1473.021] (-1474.074) (-1474.676) * (-1474.942) (-1473.069) [-1473.087] (-1473.650) -- 0:00:10 841500 -- (-1475.302) (-1472.650) [-1472.471] (-1473.923) * (-1472.333) [-1472.680] (-1473.253) (-1471.653) -- 0:00:09 842000 -- (-1474.546) (-1472.553) [-1472.251] (-1474.363) * [-1472.727] (-1472.257) (-1473.390) (-1471.758) -- 0:00:09 842500 -- (-1474.074) [-1472.377] (-1477.044) (-1473.213) * (-1472.808) (-1475.547) (-1476.740) [-1472.882] -- 0:00:09 843000 -- (-1475.382) (-1474.551) [-1473.899] (-1472.971) * [-1473.996] (-1472.829) (-1473.492) (-1472.058) -- 0:00:09 843500 -- (-1473.922) (-1473.802) [-1475.548] (-1474.503) * (-1475.695) [-1471.874] (-1476.846) (-1475.754) -- 0:00:09 844000 -- (-1472.448) [-1475.497] (-1475.522) (-1475.910) * (-1475.121) (-1473.153) (-1475.440) [-1472.466] -- 0:00:09 844500 -- (-1475.858) (-1477.268) [-1473.185] (-1472.522) * (-1476.293) (-1472.817) [-1472.727] (-1475.024) -- 0:00:09 845000 -- (-1473.513) (-1474.232) [-1473.993] (-1474.403) * (-1475.582) (-1476.529) (-1476.954) [-1474.319] -- 0:00:09 Average standard deviation of split frequencies: 0.007871 845500 -- [-1477.512] (-1473.935) (-1472.557) (-1473.214) * (-1475.137) (-1480.599) (-1475.574) [-1475.861] -- 0:00:09 846000 -- (-1474.975) (-1474.488) (-1473.444) [-1476.128] * (-1474.037) [-1472.682] (-1473.190) (-1473.926) -- 0:00:09 846500 -- [-1473.365] (-1473.903) (-1474.816) (-1472.879) * [-1472.902] (-1475.990) (-1473.041) (-1473.133) -- 0:00:09 847000 -- (-1473.989) (-1473.955) (-1475.335) [-1474.794] * (-1476.849) (-1478.037) (-1474.750) [-1474.033] -- 0:00:09 847500 -- (-1472.911) (-1475.746) (-1472.986) [-1474.848] * (-1477.079) (-1472.830) [-1474.141] (-1473.118) -- 0:00:09 848000 -- (-1473.332) (-1473.315) (-1477.834) [-1475.010] * (-1477.477) (-1477.223) (-1472.459) [-1474.643] -- 0:00:09 848500 -- (-1475.399) [-1473.442] (-1477.055) (-1473.602) * [-1473.335] (-1477.721) (-1472.978) (-1472.233) -- 0:00:09 849000 -- (-1474.643) (-1474.684) (-1475.038) [-1473.966] * (-1473.836) (-1474.425) [-1473.615] (-1476.736) -- 0:00:09 849500 -- (-1473.423) (-1472.610) (-1475.131) [-1473.631] * [-1477.145] (-1472.517) (-1473.869) (-1473.255) -- 0:00:09 850000 -- (-1474.781) [-1471.467] (-1477.620) (-1473.793) * (-1474.020) (-1473.595) [-1473.232] (-1477.268) -- 0:00:09 Average standard deviation of split frequencies: 0.007827 850500 -- [-1473.071] (-1472.852) (-1472.408) (-1473.455) * (-1475.682) (-1473.373) (-1477.273) [-1474.144] -- 0:00:09 851000 -- (-1473.264) (-1473.313) (-1472.113) [-1475.091] * (-1472.134) (-1471.835) [-1472.948] (-1476.547) -- 0:00:09 851500 -- (-1472.924) (-1471.815) [-1472.126] (-1473.629) * (-1473.086) (-1474.612) [-1474.566] (-1473.821) -- 0:00:09 852000 -- (-1475.775) (-1475.419) (-1475.213) [-1472.837] * (-1472.920) (-1472.985) (-1473.530) [-1476.650] -- 0:00:09 852500 -- (-1472.733) [-1475.802] (-1476.045) (-1475.291) * [-1473.353] (-1479.976) (-1472.420) (-1475.568) -- 0:00:09 853000 -- [-1473.231] (-1475.371) (-1473.978) (-1474.425) * [-1476.974] (-1474.333) (-1472.056) (-1472.836) -- 0:00:09 853500 -- (-1472.720) [-1474.618] (-1472.416) (-1476.489) * (-1473.412) (-1472.798) [-1477.142] (-1475.328) -- 0:00:09 854000 -- (-1472.870) (-1476.487) (-1474.507) [-1473.429] * (-1474.838) [-1472.860] (-1479.162) (-1474.032) -- 0:00:09 854500 -- (-1473.325) (-1473.021) [-1473.550] (-1473.015) * (-1477.653) (-1472.977) (-1472.903) [-1474.313] -- 0:00:09 855000 -- (-1473.061) (-1473.973) (-1473.401) [-1472.265] * (-1477.707) (-1474.317) (-1473.563) [-1475.061] -- 0:00:09 Average standard deviation of split frequencies: 0.008157 855500 -- (-1475.027) (-1472.572) [-1473.936] (-1474.895) * [-1475.683] (-1474.651) (-1474.830) (-1474.531) -- 0:00:09 856000 -- (-1472.801) (-1476.057) (-1473.720) [-1472.844] * (-1476.930) (-1472.401) [-1472.850] (-1475.838) -- 0:00:09 856500 -- (-1474.711) (-1474.313) [-1476.854] (-1472.419) * (-1476.766) [-1473.377] (-1474.725) (-1474.505) -- 0:00:09 857000 -- (-1473.417) [-1471.778] (-1475.679) (-1478.207) * (-1479.166) [-1474.881] (-1474.880) (-1476.256) -- 0:00:09 857500 -- [-1472.087] (-1471.702) (-1475.357) (-1473.218) * (-1473.802) (-1473.121) (-1473.568) [-1476.787] -- 0:00:08 858000 -- (-1473.097) (-1473.310) [-1473.905] (-1474.135) * (-1472.470) (-1473.226) [-1472.641] (-1475.698) -- 0:00:08 858500 -- [-1475.302] (-1472.445) (-1472.975) (-1473.823) * [-1471.904] (-1474.310) (-1473.284) (-1473.333) -- 0:00:08 859000 -- (-1475.670) (-1472.590) (-1475.763) [-1476.440] * [-1477.520] (-1473.241) (-1474.728) (-1473.315) -- 0:00:08 859500 -- (-1473.413) (-1473.142) (-1474.356) [-1474.086] * [-1472.256] (-1471.884) (-1472.960) (-1473.171) -- 0:00:08 860000 -- (-1473.686) (-1472.807) (-1476.687) [-1473.553] * (-1474.830) (-1472.820) [-1472.330] (-1474.324) -- 0:00:08 Average standard deviation of split frequencies: 0.008284 860500 -- [-1475.469] (-1476.459) (-1474.389) (-1476.791) * (-1471.570) (-1472.440) [-1474.512] (-1471.746) -- 0:00:08 861000 -- (-1472.960) (-1474.619) [-1473.871] (-1476.547) * [-1474.327] (-1472.047) (-1473.571) (-1473.470) -- 0:00:08 861500 -- (-1477.127) [-1475.598] (-1474.100) (-1473.232) * [-1472.030] (-1473.988) (-1474.444) (-1474.370) -- 0:00:08 862000 -- [-1473.832] (-1474.173) (-1474.008) (-1473.250) * (-1471.920) (-1473.337) [-1473.430] (-1473.232) -- 0:00:08 862500 -- [-1472.692] (-1474.892) (-1473.025) (-1472.061) * (-1472.435) (-1473.307) [-1474.925] (-1473.061) -- 0:00:08 863000 -- [-1471.777] (-1474.123) (-1473.751) (-1474.147) * (-1472.233) [-1473.439] (-1476.798) (-1473.449) -- 0:00:08 863500 -- [-1472.639] (-1474.910) (-1471.793) (-1473.300) * [-1474.044] (-1474.322) (-1472.555) (-1473.831) -- 0:00:08 864000 -- (-1474.393) (-1474.317) (-1474.309) [-1474.416] * (-1473.262) (-1475.909) (-1474.182) [-1475.892] -- 0:00:08 864500 -- (-1474.728) [-1474.751] (-1474.810) (-1472.136) * (-1476.105) [-1473.929] (-1474.932) (-1474.024) -- 0:00:08 865000 -- [-1471.999] (-1472.963) (-1473.160) (-1473.832) * [-1473.429] (-1472.812) (-1477.411) (-1473.568) -- 0:00:08 Average standard deviation of split frequencies: 0.008607 865500 -- (-1472.666) (-1472.850) (-1473.830) [-1472.862] * (-1475.841) (-1471.947) [-1475.426] (-1472.125) -- 0:00:08 866000 -- (-1472.852) (-1473.549) (-1476.294) [-1474.148] * (-1475.316) (-1471.969) [-1473.735] (-1472.704) -- 0:00:08 866500 -- [-1474.819] (-1474.168) (-1473.179) (-1472.988) * (-1475.339) [-1473.270] (-1474.603) (-1472.403) -- 0:00:08 867000 -- [-1473.063] (-1472.924) (-1474.371) (-1473.162) * (-1473.991) (-1474.103) [-1474.132] (-1476.551) -- 0:00:08 867500 -- (-1472.779) [-1475.602] (-1477.963) (-1474.676) * (-1472.051) (-1474.476) (-1475.407) [-1473.169] -- 0:00:08 868000 -- (-1475.994) (-1473.991) [-1473.658] (-1481.431) * (-1478.651) (-1474.613) [-1473.776] (-1474.984) -- 0:00:08 868500 -- [-1475.086] (-1471.920) (-1472.062) (-1472.462) * (-1477.221) (-1477.348) (-1475.378) [-1476.878] -- 0:00:08 869000 -- (-1473.861) [-1472.333] (-1472.895) (-1474.244) * (-1472.987) (-1473.353) [-1472.651] (-1477.888) -- 0:00:08 869500 -- [-1474.397] (-1474.870) (-1471.996) (-1475.876) * [-1472.950] (-1474.028) (-1473.816) (-1477.464) -- 0:00:08 870000 -- (-1473.573) [-1473.280] (-1476.632) (-1473.069) * [-1475.546] (-1474.310) (-1472.334) (-1475.505) -- 0:00:08 Average standard deviation of split frequencies: 0.008054 870500 -- (-1473.238) [-1473.236] (-1477.070) (-1476.356) * [-1476.488] (-1472.952) (-1473.909) (-1476.327) -- 0:00:08 871000 -- (-1473.055) [-1473.015] (-1472.730) (-1478.642) * [-1475.245] (-1473.885) (-1473.570) (-1473.398) -- 0:00:08 871500 -- (-1477.889) [-1474.097] (-1473.307) (-1472.516) * [-1471.900] (-1474.111) (-1476.276) (-1473.183) -- 0:00:08 872000 -- [-1478.089] (-1475.438) (-1472.675) (-1477.580) * (-1472.752) (-1473.880) (-1475.963) [-1475.406] -- 0:00:08 872500 -- (-1477.419) (-1473.201) [-1472.691] (-1474.560) * (-1474.047) (-1471.925) (-1473.823) [-1473.037] -- 0:00:08 873000 -- [-1474.970] (-1473.917) (-1474.329) (-1473.242) * (-1474.695) (-1472.033) (-1474.786) [-1472.115] -- 0:00:08 873500 -- [-1480.296] (-1474.158) (-1475.771) (-1474.092) * [-1474.020] (-1472.087) (-1474.442) (-1471.836) -- 0:00:07 874000 -- [-1473.865] (-1474.446) (-1472.047) (-1473.614) * (-1474.706) (-1475.284) [-1473.390] (-1472.501) -- 0:00:07 874500 -- [-1473.606] (-1473.729) (-1472.121) (-1473.583) * (-1474.811) [-1473.330] (-1473.303) (-1472.752) -- 0:00:07 875000 -- (-1472.145) (-1481.656) [-1472.451] (-1474.371) * (-1477.709) (-1473.567) (-1473.222) [-1472.525] -- 0:00:07 Average standard deviation of split frequencies: 0.008072 875500 -- (-1471.861) [-1478.133] (-1474.681) (-1473.574) * (-1475.289) [-1473.139] (-1472.866) (-1472.432) -- 0:00:07 876000 -- (-1471.924) (-1473.295) [-1473.327] (-1473.794) * (-1474.264) (-1473.550) (-1473.785) [-1471.930] -- 0:00:07 876500 -- [-1471.835] (-1474.935) (-1471.907) (-1473.066) * (-1473.438) (-1473.360) [-1472.837] (-1474.529) -- 0:00:07 877000 -- (-1474.539) (-1473.454) [-1471.891] (-1473.624) * [-1474.233] (-1475.212) (-1473.802) (-1472.028) -- 0:00:07 877500 -- (-1481.293) (-1474.259) [-1473.523] (-1475.220) * (-1472.478) [-1474.019] (-1477.404) (-1472.503) -- 0:00:07 878000 -- (-1474.819) (-1473.315) (-1473.946) [-1471.861] * (-1473.425) [-1474.355] (-1473.690) (-1475.469) -- 0:00:07 878500 -- (-1476.435) [-1474.861] (-1473.714) (-1475.920) * (-1474.244) (-1473.914) [-1474.041] (-1472.157) -- 0:00:07 879000 -- (-1473.487) [-1472.662] (-1473.418) (-1473.628) * [-1474.517] (-1473.528) (-1476.028) (-1473.690) -- 0:00:07 879500 -- (-1473.954) [-1472.424] (-1473.537) (-1474.472) * (-1473.430) (-1474.135) [-1478.450] (-1473.169) -- 0:00:07 880000 -- (-1474.581) [-1472.850] (-1477.976) (-1473.033) * (-1474.163) (-1474.612) (-1472.397) [-1472.871] -- 0:00:07 Average standard deviation of split frequencies: 0.007862 880500 -- (-1475.918) [-1474.060] (-1475.558) (-1472.970) * (-1473.104) (-1473.027) (-1474.692) [-1475.251] -- 0:00:07 881000 -- (-1474.096) [-1472.807] (-1472.868) (-1472.164) * (-1472.911) (-1474.561) (-1474.236) [-1473.477] -- 0:00:07 881500 -- (-1481.914) (-1472.511) (-1473.188) [-1472.405] * [-1473.640] (-1477.802) (-1473.996) (-1474.813) -- 0:00:07 882000 -- (-1473.689) (-1472.569) (-1476.198) [-1472.821] * [-1475.924] (-1476.446) (-1474.787) (-1474.393) -- 0:00:07 882500 -- (-1472.996) [-1472.520] (-1478.601) (-1473.058) * (-1473.781) (-1478.279) [-1477.577] (-1472.807) -- 0:00:07 883000 -- (-1473.982) [-1472.595] (-1475.673) (-1473.868) * (-1472.206) [-1475.570] (-1479.130) (-1478.866) -- 0:00:07 883500 -- (-1475.255) (-1472.266) (-1475.229) [-1473.125] * [-1476.503] (-1474.689) (-1475.016) (-1474.720) -- 0:00:07 884000 -- (-1471.941) (-1473.297) [-1473.643] (-1476.755) * (-1475.820) (-1473.790) [-1475.187] (-1475.421) -- 0:00:07 884500 -- [-1472.710] (-1473.918) (-1473.089) (-1475.220) * (-1472.650) (-1476.597) (-1472.827) [-1476.505] -- 0:00:07 885000 -- (-1472.639) (-1471.956) [-1472.519] (-1474.247) * [-1472.280] (-1472.372) (-1473.437) (-1477.007) -- 0:00:07 Average standard deviation of split frequencies: 0.007781 885500 -- [-1474.345] (-1471.937) (-1474.512) (-1474.449) * (-1475.324) (-1472.701) [-1473.698] (-1473.135) -- 0:00:07 886000 -- [-1476.121] (-1472.488) (-1472.768) (-1476.793) * (-1477.630) [-1471.928] (-1472.995) (-1473.228) -- 0:00:07 886500 -- (-1474.869) [-1476.397] (-1474.284) (-1476.869) * (-1475.248) (-1472.322) [-1474.265] (-1472.493) -- 0:00:07 887000 -- (-1473.861) (-1475.548) [-1474.985] (-1474.294) * (-1476.214) (-1472.507) [-1474.308] (-1474.292) -- 0:00:07 887500 -- (-1473.304) [-1473.008] (-1473.963) (-1474.730) * [-1474.125] (-1473.955) (-1473.513) (-1474.705) -- 0:00:07 888000 -- (-1472.817) [-1472.673] (-1471.750) (-1472.424) * (-1472.649) [-1472.138] (-1473.883) (-1474.875) -- 0:00:07 888500 -- (-1472.828) (-1476.840) [-1471.877] (-1474.651) * (-1474.601) [-1474.584] (-1475.876) (-1473.902) -- 0:00:07 889000 -- [-1473.518] (-1474.095) (-1473.831) (-1474.079) * [-1476.126] (-1476.744) (-1477.231) (-1472.120) -- 0:00:06 889500 -- [-1474.102] (-1473.041) (-1474.540) (-1479.327) * (-1474.080) (-1475.172) (-1476.795) [-1474.788] -- 0:00:06 890000 -- (-1472.569) (-1472.099) [-1479.854] (-1473.923) * (-1472.876) [-1473.415] (-1477.299) (-1475.673) -- 0:00:06 Average standard deviation of split frequencies: 0.007674 890500 -- (-1472.212) (-1472.123) [-1473.733] (-1473.110) * (-1473.277) (-1478.748) [-1474.455] (-1476.551) -- 0:00:06 891000 -- [-1472.227] (-1477.226) (-1476.065) (-1474.857) * [-1472.861] (-1478.825) (-1476.021) (-1472.832) -- 0:00:06 891500 -- (-1474.248) (-1473.999) [-1475.535] (-1473.548) * [-1472.774] (-1478.317) (-1473.786) (-1473.785) -- 0:00:06 892000 -- (-1474.199) (-1472.512) (-1475.366) [-1472.487] * (-1478.166) (-1475.342) (-1475.102) [-1472.338] -- 0:00:06 892500 -- (-1472.580) [-1474.170] (-1473.030) (-1472.326) * (-1480.498) [-1476.502] (-1473.604) (-1474.135) -- 0:00:06 893000 -- (-1474.751) (-1474.605) [-1472.099] (-1472.098) * [-1475.003] (-1473.141) (-1473.225) (-1474.645) -- 0:00:06 893500 -- [-1479.670] (-1472.256) (-1472.609) (-1476.431) * [-1472.893] (-1473.915) (-1476.638) (-1473.004) -- 0:00:06 894000 -- (-1475.291) (-1473.271) [-1473.004] (-1479.339) * (-1472.227) (-1476.798) (-1477.487) [-1471.568] -- 0:00:06 894500 -- (-1475.683) [-1472.478] (-1472.641) (-1475.642) * (-1474.742) (-1475.824) [-1475.213] (-1472.008) -- 0:00:06 895000 -- (-1473.574) (-1473.334) [-1473.741] (-1474.900) * (-1473.953) (-1475.996) [-1473.375] (-1474.352) -- 0:00:06 Average standard deviation of split frequencies: 0.007596 895500 -- (-1475.561) [-1475.189] (-1474.455) (-1472.936) * (-1475.109) (-1473.723) (-1472.058) [-1474.097] -- 0:00:06 896000 -- [-1474.797] (-1474.987) (-1474.517) (-1472.878) * (-1478.156) (-1472.771) [-1473.676] (-1474.664) -- 0:00:06 896500 -- (-1472.575) (-1478.582) (-1473.356) [-1473.141] * (-1474.310) [-1472.397] (-1475.405) (-1473.312) -- 0:00:06 897000 -- (-1473.289) [-1472.153] (-1473.361) (-1474.067) * (-1476.219) [-1474.371] (-1474.231) (-1473.773) -- 0:00:06 897500 -- [-1472.118] (-1474.294) (-1481.532) (-1473.528) * (-1473.867) (-1473.109) (-1472.454) [-1473.883] -- 0:00:06 898000 -- [-1473.685] (-1475.212) (-1475.819) (-1472.977) * (-1474.875) (-1473.097) [-1472.921] (-1475.557) -- 0:00:06 898500 -- (-1475.294) [-1475.031] (-1476.669) (-1474.261) * (-1473.867) (-1472.925) [-1475.936] (-1478.380) -- 0:00:06 899000 -- (-1472.697) (-1475.369) (-1481.664) [-1473.844] * (-1473.623) [-1475.278] (-1473.533) (-1476.468) -- 0:00:06 899500 -- (-1472.870) (-1475.820) (-1479.518) [-1474.282] * (-1474.093) (-1472.768) [-1473.632] (-1474.348) -- 0:00:06 900000 -- (-1474.447) (-1473.544) (-1474.347) [-1473.919] * [-1473.385] (-1474.861) (-1472.669) (-1476.815) -- 0:00:06 Average standard deviation of split frequencies: 0.007328 900500 -- (-1474.314) [-1473.128] (-1476.075) (-1472.116) * [-1473.810] (-1474.973) (-1472.868) (-1474.021) -- 0:00:06 901000 -- (-1475.025) (-1471.723) (-1476.138) [-1474.241] * (-1472.876) (-1473.174) (-1473.521) [-1473.219] -- 0:00:06 901500 -- (-1472.085) (-1473.802) [-1472.615] (-1472.067) * (-1474.268) (-1477.774) [-1475.663] (-1473.533) -- 0:00:06 902000 -- (-1472.323) (-1473.357) [-1472.658] (-1474.579) * (-1477.252) (-1475.758) [-1474.830] (-1474.178) -- 0:00:06 902500 -- (-1471.727) (-1475.726) [-1473.929] (-1473.333) * [-1476.785] (-1474.014) (-1474.461) (-1477.097) -- 0:00:06 903000 -- (-1471.956) (-1475.958) (-1473.280) [-1473.416] * (-1475.301) (-1473.042) [-1473.677] (-1478.910) -- 0:00:06 903500 -- (-1474.423) (-1477.330) (-1472.905) [-1473.755] * (-1473.940) (-1474.643) (-1472.950) [-1473.075] -- 0:00:06 904000 -- (-1475.800) (-1477.517) (-1471.993) [-1472.977] * (-1474.312) [-1474.355] (-1474.431) (-1473.685) -- 0:00:06 904500 -- (-1473.205) (-1476.801) [-1474.093] (-1475.551) * (-1473.072) (-1474.660) [-1476.643] (-1473.719) -- 0:00:06 905000 -- (-1475.378) (-1472.787) (-1476.519) [-1472.961] * [-1476.425] (-1474.830) (-1474.542) (-1472.880) -- 0:00:05 Average standard deviation of split frequencies: 0.006992 905500 -- [-1474.671] (-1475.394) (-1477.877) (-1472.272) * (-1475.920) (-1474.752) (-1476.760) [-1472.561] -- 0:00:05 906000 -- (-1474.409) (-1473.480) (-1475.730) [-1475.584] * (-1474.412) (-1478.978) [-1473.617] (-1475.273) -- 0:00:05 906500 -- (-1473.731) [-1472.309] (-1472.887) (-1475.085) * (-1474.244) (-1475.037) [-1475.088] (-1474.180) -- 0:00:05 907000 -- (-1481.657) (-1472.329) [-1473.870] (-1474.679) * (-1472.287) (-1474.047) [-1475.518] (-1472.722) -- 0:00:05 907500 -- (-1476.981) (-1476.723) [-1474.378] (-1472.871) * (-1474.354) [-1472.468] (-1473.549) (-1473.775) -- 0:00:05 908000 -- (-1477.402) (-1477.440) [-1476.757] (-1472.607) * (-1473.654) (-1472.572) (-1477.355) [-1476.903] -- 0:00:05 908500 -- (-1472.901) (-1476.896) [-1474.406] (-1473.425) * [-1472.089] (-1472.723) (-1472.493) (-1472.416) -- 0:00:05 909000 -- (-1473.415) [-1475.380] (-1473.301) (-1472.290) * (-1474.864) (-1473.695) [-1477.967] (-1472.581) -- 0:00:05 909500 -- [-1473.572] (-1474.052) (-1473.383) (-1473.328) * (-1474.053) (-1474.696) [-1473.300] (-1477.243) -- 0:00:05 910000 -- (-1476.278) [-1472.768] (-1473.722) (-1485.723) * [-1471.938] (-1472.751) (-1474.686) (-1472.894) -- 0:00:05 Average standard deviation of split frequencies: 0.007506 910500 -- [-1472.996] (-1472.694) (-1474.860) (-1479.150) * (-1472.618) [-1473.967] (-1474.078) (-1472.055) -- 0:00:05 911000 -- (-1475.837) (-1473.799) (-1476.891) [-1472.762] * [-1473.623] (-1472.987) (-1477.478) (-1473.377) -- 0:00:05 911500 -- [-1472.414] (-1479.088) (-1475.400) (-1474.760) * (-1476.328) [-1472.953] (-1477.903) (-1472.939) -- 0:00:05 912000 -- (-1472.357) (-1473.493) [-1471.649] (-1473.243) * (-1475.593) (-1474.548) [-1476.117] (-1473.229) -- 0:00:05 912500 -- (-1472.792) (-1473.810) [-1474.938] (-1473.308) * (-1473.742) (-1474.471) [-1473.490] (-1475.654) -- 0:00:05 913000 -- (-1475.925) (-1473.687) [-1472.541] (-1473.631) * (-1473.007) (-1474.675) [-1473.346] (-1474.816) -- 0:00:05 913500 -- (-1476.184) (-1473.804) (-1473.604) [-1473.532] * (-1471.713) [-1472.576] (-1474.988) (-1476.039) -- 0:00:05 914000 -- (-1476.032) (-1473.642) [-1475.241] (-1473.943) * [-1474.194] (-1474.988) (-1475.241) (-1473.889) -- 0:00:05 914500 -- (-1474.554) (-1473.176) (-1476.266) [-1477.167] * (-1474.129) [-1475.884] (-1472.722) (-1472.830) -- 0:00:05 915000 -- [-1472.232] (-1472.880) (-1476.487) (-1477.389) * [-1471.948] (-1473.095) (-1472.605) (-1472.417) -- 0:00:05 Average standard deviation of split frequencies: 0.007462 915500 -- [-1474.267] (-1472.675) (-1479.685) (-1475.693) * (-1473.586) [-1472.644] (-1474.472) (-1474.975) -- 0:00:05 916000 -- (-1474.006) (-1473.950) [-1475.122] (-1471.977) * (-1472.797) (-1471.938) [-1472.283] (-1474.548) -- 0:00:05 916500 -- (-1472.226) (-1473.499) (-1473.456) [-1471.977] * (-1472.060) (-1474.693) (-1471.980) [-1474.516] -- 0:00:05 917000 -- [-1472.357] (-1473.154) (-1474.148) (-1474.385) * (-1471.898) (-1473.915) [-1471.791] (-1473.425) -- 0:00:05 917500 -- (-1473.816) [-1473.342] (-1473.195) (-1475.832) * (-1474.550) (-1473.518) (-1472.279) [-1473.171] -- 0:00:05 918000 -- (-1475.037) (-1480.402) (-1472.973) [-1474.792] * [-1474.141] (-1477.190) (-1473.014) (-1471.925) -- 0:00:05 918500 -- (-1475.055) [-1475.450] (-1472.951) (-1471.740) * [-1473.692] (-1476.552) (-1474.012) (-1476.735) -- 0:00:05 919000 -- (-1473.923) (-1475.342) (-1472.599) [-1474.843] * (-1475.583) (-1473.576) [-1473.773] (-1478.341) -- 0:00:05 919500 -- (-1472.993) [-1478.568] (-1471.997) (-1480.777) * (-1477.378) (-1473.559) (-1472.644) [-1475.606] -- 0:00:05 920000 -- (-1472.132) (-1475.319) (-1472.997) [-1473.010] * (-1472.876) [-1472.606] (-1472.500) (-1473.345) -- 0:00:05 Average standard deviation of split frequencies: 0.007840 920500 -- (-1474.090) (-1475.463) (-1474.237) [-1475.820] * (-1477.016) [-1473.280] (-1473.832) (-1472.701) -- 0:00:05 921000 -- [-1473.955] (-1476.189) (-1473.582) (-1472.674) * (-1473.415) [-1475.638] (-1472.945) (-1473.549) -- 0:00:04 921500 -- (-1473.089) (-1475.708) (-1475.646) [-1473.280] * (-1472.774) [-1473.629] (-1474.996) (-1477.017) -- 0:00:04 922000 -- [-1475.228] (-1472.746) (-1475.254) (-1472.894) * (-1472.619) [-1477.479] (-1475.536) (-1479.597) -- 0:00:04 922500 -- (-1472.797) [-1472.747] (-1473.660) (-1471.988) * (-1473.756) (-1477.680) [-1472.007] (-1478.272) -- 0:00:04 923000 -- (-1474.757) [-1472.743] (-1473.674) (-1474.804) * (-1474.785) [-1475.926] (-1472.409) (-1473.854) -- 0:00:04 923500 -- (-1475.027) [-1472.443] (-1474.253) (-1478.111) * (-1474.773) (-1473.037) (-1472.913) [-1472.527] -- 0:00:04 924000 -- (-1473.245) [-1472.682] (-1472.100) (-1474.092) * (-1474.208) (-1473.301) (-1475.941) [-1474.704] -- 0:00:04 924500 -- (-1475.605) (-1474.200) [-1471.773] (-1473.945) * [-1473.976] (-1472.762) (-1475.794) (-1476.262) -- 0:00:04 925000 -- (-1474.412) [-1473.643] (-1472.955) (-1475.390) * (-1476.500) (-1473.527) [-1478.861] (-1474.174) -- 0:00:04 Average standard deviation of split frequencies: 0.007876 925500 -- [-1471.894] (-1474.209) (-1473.947) (-1479.129) * (-1475.541) [-1475.038] (-1478.706) (-1473.553) -- 0:00:04 926000 -- [-1473.526] (-1473.473) (-1474.214) (-1476.356) * [-1474.284] (-1475.731) (-1472.931) (-1473.051) -- 0:00:04 926500 -- (-1473.545) [-1471.640] (-1472.932) (-1476.198) * (-1474.127) (-1474.466) (-1473.986) [-1472.932] -- 0:00:04 927000 -- (-1472.074) (-1472.770) [-1472.540] (-1472.382) * [-1477.169] (-1472.922) (-1475.431) (-1473.043) -- 0:00:04 927500 -- (-1473.651) (-1478.334) (-1476.444) [-1472.961] * (-1476.323) (-1476.365) (-1473.128) [-1474.445] -- 0:00:04 928000 -- (-1473.244) [-1474.693] (-1474.343) (-1473.702) * [-1472.699] (-1472.860) (-1472.723) (-1474.373) -- 0:00:04 928500 -- (-1471.775) (-1473.935) [-1472.207] (-1472.533) * (-1472.958) [-1473.348] (-1473.569) (-1475.688) -- 0:00:04 929000 -- (-1472.492) (-1478.711) (-1475.121) [-1472.045] * [-1475.296] (-1475.244) (-1473.287) (-1474.755) -- 0:00:04 929500 -- [-1472.512] (-1476.456) (-1474.618) (-1473.091) * (-1476.678) [-1473.817] (-1473.946) (-1474.853) -- 0:00:04 930000 -- (-1471.909) (-1474.343) (-1473.815) [-1471.942] * (-1475.420) (-1473.288) [-1473.775] (-1473.189) -- 0:00:04 Average standard deviation of split frequencies: 0.008104 930500 -- (-1476.418) (-1473.808) [-1474.301] (-1474.464) * [-1472.074] (-1477.759) (-1472.254) (-1475.507) -- 0:00:04 931000 -- (-1472.575) (-1473.090) (-1473.080) [-1474.802] * (-1472.003) (-1478.173) [-1472.373] (-1472.446) -- 0:00:04 931500 -- (-1472.379) (-1471.703) [-1473.002] (-1473.472) * (-1473.326) (-1475.864) (-1472.940) [-1472.199] -- 0:00:04 932000 -- (-1471.985) (-1473.880) [-1473.186] (-1474.430) * (-1474.035) (-1474.330) [-1472.129] (-1474.420) -- 0:00:04 932500 -- [-1473.399] (-1473.474) (-1473.442) (-1474.942) * (-1473.544) [-1471.870] (-1474.015) (-1472.977) -- 0:00:04 933000 -- [-1471.986] (-1471.867) (-1473.889) (-1472.644) * [-1472.678] (-1475.086) (-1478.039) (-1473.195) -- 0:00:04 933500 -- (-1472.653) [-1471.648] (-1473.114) (-1476.346) * [-1473.444] (-1473.959) (-1474.420) (-1473.442) -- 0:00:04 934000 -- (-1472.870) [-1475.311] (-1473.687) (-1472.092) * (-1472.662) (-1480.173) (-1473.518) [-1474.441] -- 0:00:04 934500 -- [-1472.533] (-1474.170) (-1474.304) (-1472.273) * (-1473.564) (-1478.123) [-1475.126] (-1473.503) -- 0:00:04 935000 -- (-1473.383) (-1473.248) (-1472.564) [-1471.740] * (-1473.564) [-1471.784] (-1472.785) (-1473.494) -- 0:00:04 Average standard deviation of split frequencies: 0.008029 935500 -- [-1472.539] (-1473.835) (-1474.100) (-1472.643) * (-1472.945) (-1472.923) [-1471.917] (-1475.586) -- 0:00:04 936000 -- (-1472.659) [-1473.149] (-1474.923) (-1473.161) * (-1473.020) (-1477.156) (-1475.023) [-1474.074] -- 0:00:04 936500 -- (-1473.728) [-1473.497] (-1473.450) (-1478.022) * (-1472.829) (-1474.340) [-1475.402] (-1477.139) -- 0:00:04 937000 -- (-1472.520) (-1473.367) [-1474.071] (-1475.373) * [-1472.388] (-1475.170) (-1476.748) (-1473.182) -- 0:00:03 937500 -- (-1472.767) [-1472.981] (-1475.736) (-1474.935) * (-1471.862) (-1472.418) (-1474.410) [-1472.977] -- 0:00:03 938000 -- (-1475.153) [-1474.855] (-1472.809) (-1478.721) * (-1472.940) (-1471.855) (-1474.408) [-1473.671] -- 0:00:03 938500 -- [-1472.254] (-1474.463) (-1475.075) (-1474.668) * (-1472.676) (-1479.759) [-1473.414] (-1478.473) -- 0:00:03 939000 -- (-1471.997) (-1473.949) (-1476.733) [-1474.323] * [-1478.206] (-1481.045) (-1472.333) (-1478.702) -- 0:00:03 939500 -- (-1472.461) (-1474.465) [-1474.255] (-1474.535) * (-1474.629) [-1477.315] (-1472.083) (-1474.825) -- 0:00:03 940000 -- (-1475.304) [-1473.541] (-1476.448) (-1472.792) * (-1476.221) (-1472.949) [-1473.238] (-1472.224) -- 0:00:03 Average standard deviation of split frequencies: 0.007611 940500 -- (-1474.119) (-1475.992) [-1472.842] (-1473.013) * (-1475.152) [-1473.297] (-1473.480) (-1476.207) -- 0:00:03 941000 -- (-1473.789) [-1473.916] (-1473.677) (-1472.586) * (-1473.265) (-1478.118) (-1475.220) [-1474.371] -- 0:00:03 941500 -- (-1476.932) (-1475.414) [-1475.177] (-1473.336) * [-1473.889] (-1472.442) (-1473.016) (-1474.450) -- 0:00:03 942000 -- [-1473.507] (-1474.633) (-1477.134) (-1472.453) * (-1472.756) (-1474.224) (-1472.892) [-1473.750] -- 0:00:03 942500 -- (-1473.407) [-1476.402] (-1473.526) (-1473.302) * [-1472.944] (-1474.907) (-1472.074) (-1472.745) -- 0:00:03 943000 -- (-1476.710) (-1473.311) (-1473.868) [-1472.169] * (-1473.341) (-1473.685) [-1475.012] (-1475.398) -- 0:00:03 943500 -- [-1472.132] (-1477.738) (-1475.388) (-1472.990) * (-1474.607) (-1474.981) [-1474.733] (-1475.756) -- 0:00:03 944000 -- (-1476.352) [-1473.056] (-1476.866) (-1475.631) * (-1473.592) (-1479.948) (-1475.836) [-1475.208] -- 0:00:03 944500 -- (-1473.938) [-1472.058] (-1477.111) (-1474.225) * (-1473.743) (-1474.200) [-1472.931] (-1473.040) -- 0:00:03 945000 -- (-1473.074) (-1471.840) [-1474.326] (-1476.760) * (-1473.759) (-1473.034) [-1471.968] (-1473.814) -- 0:00:03 Average standard deviation of split frequencies: 0.007475 945500 -- (-1471.854) (-1473.416) (-1472.912) [-1478.827] * (-1472.236) [-1475.170] (-1473.796) (-1475.929) -- 0:00:03 946000 -- (-1473.430) (-1472.595) [-1476.240] (-1479.901) * (-1472.388) (-1477.676) [-1471.855] (-1474.324) -- 0:00:03 946500 -- [-1473.445] (-1472.819) (-1476.453) (-1473.686) * (-1475.717) (-1474.216) [-1472.436] (-1473.102) -- 0:00:03 947000 -- (-1473.504) (-1472.724) [-1475.999] (-1474.847) * [-1473.703] (-1476.802) (-1472.555) (-1473.587) -- 0:00:03 947500 -- [-1475.681] (-1475.120) (-1476.684) (-1472.780) * (-1476.545) (-1477.988) [-1473.122] (-1473.123) -- 0:00:03 948000 -- (-1474.330) (-1476.722) [-1473.946] (-1474.301) * (-1475.576) (-1476.629) (-1473.784) [-1473.099] -- 0:00:03 948500 -- (-1474.714) (-1477.190) (-1474.369) [-1479.645] * (-1476.022) (-1474.495) [-1478.406] (-1474.336) -- 0:00:03 949000 -- [-1474.889] (-1472.284) (-1473.494) (-1472.906) * (-1476.239) [-1474.112] (-1472.122) (-1474.341) -- 0:00:03 949500 -- (-1474.534) (-1472.898) (-1473.993) [-1473.064] * (-1476.689) (-1472.084) [-1474.302] (-1474.607) -- 0:00:03 950000 -- (-1476.238) [-1473.777] (-1473.613) (-1474.529) * [-1476.258] (-1473.083) (-1474.815) (-1473.219) -- 0:00:03 Average standard deviation of split frequencies: 0.007314 950500 -- (-1472.548) (-1475.206) [-1475.767] (-1474.043) * (-1476.139) (-1472.732) [-1473.281] (-1479.201) -- 0:00:03 951000 -- (-1473.966) [-1475.510] (-1472.799) (-1478.899) * (-1474.077) [-1472.290] (-1474.123) (-1475.033) -- 0:00:03 951500 -- (-1474.777) [-1472.407] (-1473.435) (-1473.066) * (-1478.702) [-1472.211] (-1474.074) (-1473.429) -- 0:00:03 952000 -- (-1472.527) (-1474.260) [-1473.577] (-1473.906) * (-1475.311) [-1474.938] (-1473.968) (-1473.308) -- 0:00:03 952500 -- [-1474.773] (-1474.894) (-1478.309) (-1476.257) * (-1475.111) (-1473.506) (-1473.934) [-1472.040] -- 0:00:02 953000 -- (-1479.004) (-1474.786) (-1473.985) [-1475.010] * (-1474.065) [-1472.768] (-1473.055) (-1472.863) -- 0:00:02 953500 -- (-1474.699) (-1473.733) [-1476.847] (-1474.828) * (-1474.942) (-1472.032) (-1472.898) [-1472.627] -- 0:00:02 954000 -- [-1473.806] (-1476.299) (-1476.107) (-1478.005) * [-1474.432] (-1473.784) (-1472.881) (-1474.965) -- 0:00:02 954500 -- (-1475.686) [-1473.677] (-1474.983) (-1476.830) * (-1474.469) (-1472.608) [-1473.716] (-1472.779) -- 0:00:02 955000 -- (-1475.337) (-1477.366) [-1476.196] (-1473.745) * [-1472.984] (-1473.249) (-1472.619) (-1476.186) -- 0:00:02 Average standard deviation of split frequencies: 0.007520 955500 -- (-1474.141) [-1475.771] (-1478.659) (-1471.920) * (-1475.389) (-1474.407) (-1474.543) [-1472.697] -- 0:00:02 956000 -- (-1472.994) [-1476.612] (-1478.003) (-1472.436) * (-1472.284) [-1473.579] (-1475.255) (-1472.435) -- 0:00:02 956500 -- (-1474.841) [-1477.450] (-1473.430) (-1478.981) * (-1473.760) (-1475.006) [-1474.801] (-1474.090) -- 0:00:02 957000 -- (-1472.536) (-1475.469) (-1478.594) [-1474.872] * (-1474.171) [-1479.300] (-1472.448) (-1473.887) -- 0:00:02 957500 -- (-1472.681) [-1473.830] (-1476.592) (-1476.026) * (-1475.420) (-1477.151) [-1471.893] (-1476.380) -- 0:00:02 958000 -- (-1475.458) [-1472.592] (-1479.147) (-1472.943) * (-1477.305) [-1473.410] (-1472.995) (-1475.027) -- 0:00:02 958500 -- (-1474.752) (-1474.027) [-1476.474] (-1474.213) * (-1473.310) (-1473.803) (-1472.265) [-1475.427] -- 0:00:02 959000 -- (-1475.083) [-1475.578] (-1473.835) (-1475.944) * [-1476.256] (-1475.915) (-1473.097) (-1476.923) -- 0:00:02 959500 -- (-1476.173) (-1475.441) [-1476.651] (-1472.370) * [-1473.220] (-1473.776) (-1478.394) (-1474.033) -- 0:00:02 960000 -- (-1476.356) [-1473.370] (-1473.727) (-1473.971) * [-1472.743] (-1472.218) (-1473.928) (-1472.191) -- 0:00:02 Average standard deviation of split frequencies: 0.007575 960500 -- (-1472.889) (-1472.224) [-1473.160] (-1472.993) * (-1474.974) [-1474.063] (-1473.760) (-1473.238) -- 0:00:02 961000 -- (-1472.934) (-1472.477) [-1474.797] (-1472.778) * [-1472.968] (-1473.408) (-1475.340) (-1475.824) -- 0:00:02 961500 -- [-1472.657] (-1472.183) (-1476.333) (-1477.132) * [-1472.645] (-1475.580) (-1473.496) (-1474.631) -- 0:00:02 962000 -- (-1475.917) (-1474.207) [-1476.308] (-1474.955) * (-1472.702) [-1472.440] (-1473.514) (-1474.807) -- 0:00:02 962500 -- [-1474.241] (-1478.643) (-1476.738) (-1473.208) * (-1472.425) [-1477.851] (-1473.355) (-1473.565) -- 0:00:02 963000 -- (-1472.339) [-1472.801] (-1472.345) (-1473.232) * (-1473.654) [-1473.120] (-1472.999) (-1474.247) -- 0:00:02 963500 -- (-1473.887) [-1476.166] (-1473.706) (-1473.013) * (-1475.825) (-1476.535) [-1478.202] (-1474.128) -- 0:00:02 964000 -- (-1472.017) (-1474.339) [-1472.404] (-1472.897) * [-1472.490] (-1474.422) (-1474.061) (-1473.513) -- 0:00:02 964500 -- (-1475.051) (-1473.856) (-1473.509) [-1477.206] * (-1472.669) [-1473.454] (-1474.906) (-1472.891) -- 0:00:02 965000 -- (-1476.320) (-1474.497) [-1472.902] (-1472.939) * [-1473.628] (-1472.770) (-1472.754) (-1475.857) -- 0:00:02 Average standard deviation of split frequencies: 0.007991 965500 -- [-1473.908] (-1480.467) (-1472.746) (-1472.401) * (-1475.219) (-1472.514) [-1472.685] (-1475.717) -- 0:00:02 966000 -- (-1472.296) [-1474.271] (-1472.528) (-1473.268) * (-1472.920) (-1474.465) [-1473.253] (-1476.063) -- 0:00:02 966500 -- (-1472.147) [-1472.950] (-1474.220) (-1472.420) * (-1472.389) (-1476.200) (-1474.715) [-1472.099] -- 0:00:02 967000 -- [-1473.158] (-1474.098) (-1473.756) (-1472.872) * (-1472.441) (-1473.756) (-1472.258) [-1472.431] -- 0:00:02 967500 -- (-1473.880) [-1473.285] (-1474.193) (-1477.227) * (-1473.137) (-1481.820) [-1472.971] (-1472.927) -- 0:00:02 968000 -- (-1472.486) (-1473.005) (-1472.517) [-1474.372] * (-1473.193) (-1476.222) (-1471.737) [-1474.485] -- 0:00:02 968500 -- [-1472.362] (-1474.007) (-1471.753) (-1471.672) * (-1480.904) (-1473.403) (-1473.984) [-1474.452] -- 0:00:01 969000 -- (-1473.223) (-1472.747) [-1471.940] (-1473.607) * (-1477.698) (-1474.619) (-1473.758) [-1472.629] -- 0:00:01 969500 -- (-1473.478) [-1474.741] (-1472.464) (-1476.751) * [-1477.411] (-1472.845) (-1474.529) (-1473.379) -- 0:00:01 970000 -- (-1478.768) (-1473.700) [-1472.480] (-1474.285) * (-1473.176) [-1475.570] (-1473.879) (-1474.982) -- 0:00:01 Average standard deviation of split frequencies: 0.007799 970500 -- (-1476.843) [-1473.996] (-1474.604) (-1473.257) * (-1472.886) [-1472.736] (-1473.343) (-1475.407) -- 0:00:01 971000 -- [-1473.438] (-1474.021) (-1477.314) (-1472.699) * (-1474.604) (-1476.226) [-1472.583] (-1474.448) -- 0:00:01 971500 -- (-1472.064) [-1474.068] (-1479.492) (-1472.406) * (-1472.368) (-1474.327) [-1473.169] (-1473.494) -- 0:00:01 972000 -- [-1473.756] (-1473.741) (-1476.286) (-1476.580) * (-1475.105) [-1478.762] (-1472.159) (-1473.897) -- 0:00:01 972500 -- [-1476.458] (-1476.295) (-1474.510) (-1472.007) * (-1473.626) [-1472.773] (-1472.883) (-1477.285) -- 0:00:01 973000 -- [-1473.043] (-1474.257) (-1475.969) (-1472.841) * [-1474.162] (-1472.486) (-1475.447) (-1475.087) -- 0:00:01 973500 -- (-1475.770) [-1472.635] (-1477.265) (-1476.809) * (-1472.682) [-1471.991] (-1476.949) (-1472.943) -- 0:00:01 974000 -- (-1475.428) (-1472.998) (-1475.841) [-1475.957] * (-1475.563) (-1472.347) (-1478.214) [-1474.085] -- 0:00:01 974500 -- (-1474.886) (-1474.139) [-1473.325] (-1472.220) * [-1472.476] (-1473.138) (-1476.746) (-1474.219) -- 0:00:01 975000 -- [-1474.068] (-1471.645) (-1477.823) (-1474.003) * (-1475.319) (-1475.466) [-1474.077] (-1472.628) -- 0:00:01 Average standard deviation of split frequencies: 0.008126 975500 -- (-1476.960) (-1472.033) [-1473.188] (-1475.381) * (-1475.081) (-1475.239) (-1473.365) [-1474.613] -- 0:00:01 976000 -- (-1474.526) (-1473.028) [-1472.980] (-1477.917) * (-1474.766) [-1473.575] (-1477.684) (-1478.030) -- 0:00:01 976500 -- (-1473.378) [-1471.702] (-1472.643) (-1475.465) * (-1477.022) (-1474.806) [-1472.242] (-1478.307) -- 0:00:01 977000 -- (-1473.439) [-1471.699] (-1473.360) (-1473.287) * (-1471.799) (-1475.945) (-1474.954) [-1473.025] -- 0:00:01 977500 -- (-1474.235) [-1471.656] (-1474.137) (-1474.657) * (-1476.573) (-1472.751) (-1475.520) [-1474.410] -- 0:00:01 978000 -- [-1472.360] (-1473.907) (-1475.341) (-1478.209) * (-1475.392) [-1475.820] (-1474.111) (-1474.015) -- 0:00:01 978500 -- (-1474.453) (-1472.771) (-1473.527) [-1474.456] * (-1473.081) [-1475.992] (-1475.989) (-1472.982) -- 0:00:01 979000 -- [-1476.275] (-1473.749) (-1474.702) (-1478.388) * (-1475.963) [-1474.039] (-1477.299) (-1472.772) -- 0:00:01 979500 -- (-1475.502) (-1479.095) (-1473.824) [-1472.337] * (-1472.795) (-1475.233) [-1473.818] (-1473.208) -- 0:00:01 980000 -- (-1477.388) [-1477.085] (-1472.744) (-1472.561) * (-1478.991) (-1478.821) (-1472.869) [-1477.730] -- 0:00:01 Average standard deviation of split frequencies: 0.008172 980500 -- (-1477.258) (-1474.602) (-1473.484) [-1473.632] * (-1478.662) (-1476.640) (-1473.223) [-1472.832] -- 0:00:01 981000 -- (-1473.792) [-1472.773] (-1473.690) (-1477.141) * (-1472.617) (-1472.742) [-1471.704] (-1472.085) -- 0:00:01 981500 -- (-1474.208) [-1473.500] (-1472.774) (-1475.057) * (-1473.555) (-1476.591) (-1471.535) [-1476.646] -- 0:00:01 982000 -- [-1475.996] (-1476.108) (-1473.692) (-1473.903) * [-1473.952] (-1471.999) (-1476.306) (-1472.854) -- 0:00:01 982500 -- (-1476.519) (-1471.913) [-1473.592] (-1474.358) * (-1472.211) (-1474.524) [-1476.752] (-1473.611) -- 0:00:01 983000 -- (-1474.402) (-1473.001) [-1472.786] (-1473.747) * (-1473.296) (-1473.108) (-1473.028) [-1472.578] -- 0:00:01 983500 -- (-1478.721) (-1474.403) [-1473.152] (-1472.611) * [-1475.553] (-1473.418) (-1474.575) (-1476.774) -- 0:00:01 984000 -- (-1473.667) [-1473.985] (-1473.764) (-1476.032) * (-1475.054) (-1473.188) [-1474.807] (-1475.673) -- 0:00:01 984500 -- (-1474.137) (-1473.354) [-1476.436] (-1473.144) * [-1473.034] (-1474.616) (-1473.325) (-1473.782) -- 0:00:00 985000 -- (-1473.966) [-1476.208] (-1479.436) (-1473.110) * (-1475.270) [-1472.678] (-1472.264) (-1472.417) -- 0:00:00 Average standard deviation of split frequencies: 0.008578 985500 -- [-1474.929] (-1476.822) (-1477.827) (-1472.929) * (-1474.730) [-1471.620] (-1472.748) (-1472.144) -- 0:00:00 986000 -- (-1472.729) [-1476.417] (-1478.203) (-1474.857) * [-1472.721] (-1472.342) (-1473.654) (-1471.970) -- 0:00:00 986500 -- [-1471.568] (-1476.302) (-1479.007) (-1473.610) * (-1473.228) [-1472.476] (-1473.945) (-1472.421) -- 0:00:00 987000 -- (-1475.891) (-1473.504) [-1474.248] (-1473.197) * (-1473.165) (-1472.466) [-1474.970] (-1472.108) -- 0:00:00 987500 -- [-1474.662] (-1473.540) (-1473.831) (-1474.337) * (-1474.681) (-1474.836) (-1472.340) [-1475.483] -- 0:00:00 988000 -- (-1475.777) (-1475.012) [-1472.622] (-1476.879) * (-1474.586) [-1474.404] (-1479.213) (-1472.454) -- 0:00:00 988500 -- [-1475.128] (-1476.489) (-1473.760) (-1474.519) * (-1477.089) (-1473.322) [-1473.675] (-1472.334) -- 0:00:00 989000 -- [-1472.195] (-1474.821) (-1473.607) (-1472.367) * (-1475.414) (-1474.301) [-1472.333] (-1473.984) -- 0:00:00 989500 -- (-1472.453) (-1477.773) (-1473.355) [-1473.119] * (-1473.399) [-1474.051] (-1473.853) (-1476.392) -- 0:00:00 990000 -- (-1473.845) (-1473.461) (-1479.707) [-1476.975] * (-1472.178) (-1478.853) (-1473.436) [-1472.262] -- 0:00:00 Average standard deviation of split frequencies: 0.008761 990500 -- (-1473.390) [-1472.362] (-1478.758) (-1473.941) * (-1472.850) [-1475.478] (-1474.611) (-1476.438) -- 0:00:00 991000 -- (-1474.854) [-1473.569] (-1478.534) (-1472.948) * (-1473.746) (-1473.278) (-1475.667) [-1474.659] -- 0:00:00 991500 -- (-1478.438) (-1471.921) (-1477.102) [-1473.515] * [-1475.626] (-1473.880) (-1474.689) (-1473.516) -- 0:00:00 992000 -- (-1476.576) (-1473.481) [-1472.366] (-1474.940) * (-1472.157) (-1475.084) [-1472.421] (-1474.305) -- 0:00:00 992500 -- (-1474.214) (-1473.004) [-1473.283] (-1473.366) * (-1473.977) (-1474.000) [-1473.127] (-1473.051) -- 0:00:00 993000 -- [-1473.163] (-1474.252) (-1474.811) (-1473.515) * (-1473.865) (-1472.352) [-1471.854] (-1473.203) -- 0:00:00 993500 -- [-1473.472] (-1473.980) (-1474.013) (-1474.721) * [-1474.139] (-1473.003) (-1473.221) (-1473.506) -- 0:00:00 994000 -- (-1474.411) [-1474.756] (-1479.041) (-1474.273) * (-1475.193) (-1478.646) (-1475.792) [-1475.067] -- 0:00:00 994500 -- [-1472.612] (-1472.833) (-1475.482) (-1473.305) * (-1472.993) (-1474.730) (-1482.746) [-1472.840] -- 0:00:00 995000 -- (-1472.834) [-1473.876] (-1474.796) (-1471.963) * (-1472.509) (-1474.992) (-1474.758) [-1473.405] -- 0:00:00 Average standard deviation of split frequencies: 0.009048 995500 -- (-1472.115) [-1473.530] (-1476.279) (-1472.722) * (-1476.430) [-1473.374] (-1473.708) (-1475.228) -- 0:00:00 996000 -- (-1477.244) (-1472.933) [-1474.898] (-1472.492) * (-1476.955) (-1473.883) (-1474.804) [-1473.209] -- 0:00:00 996500 -- [-1474.741] (-1473.731) (-1477.604) (-1474.042) * (-1474.744) (-1473.269) (-1474.105) [-1473.186] -- 0:00:00 997000 -- (-1473.109) (-1477.261) [-1475.268] (-1473.443) * [-1476.625] (-1477.734) (-1482.641) (-1473.236) -- 0:00:00 997500 -- [-1474.745] (-1473.334) (-1472.860) (-1474.000) * [-1475.746] (-1474.438) (-1479.383) (-1474.800) -- 0:00:00 998000 -- [-1473.355] (-1473.788) (-1473.883) (-1473.497) * (-1475.578) (-1475.710) (-1474.356) [-1476.936] -- 0:00:00 998500 -- [-1474.108] (-1472.752) (-1475.205) (-1480.706) * (-1474.687) [-1475.046] (-1475.855) (-1473.617) -- 0:00:00 999000 -- (-1473.112) (-1472.361) [-1476.606] (-1478.338) * [-1473.482] (-1473.615) (-1475.150) (-1473.651) -- 0:00:00 999500 -- [-1478.002] (-1473.920) (-1474.249) (-1472.755) * [-1474.419] (-1477.406) (-1472.321) (-1476.820) -- 0:00:00 1000000 -- (-1472.671) (-1472.328) [-1472.855] (-1473.649) * (-1474.344) (-1476.277) [-1472.843] (-1474.140) -- 0:00:00 Average standard deviation of split frequencies: 0.008729 Analysis completed in 1 mins 3 seconds Analysis used 61.95 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1471.44 Likelihood of best state for "cold" chain of run 2 was -1471.44 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.3 % ( 72 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 25.5 % ( 30 %) Dirichlet(Pi{all}) 26.8 % ( 27 %) Slider(Pi{all}) 78.3 % ( 66 %) Multiplier(Alpha{1,2}) 77.9 % ( 48 %) Multiplier(Alpha{3}) 17.2 % ( 24 %) Slider(Pinvar{all}) 98.6 % ( 98 %) ExtSPR(Tau{all},V{all}) 69.8 % ( 67 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 26 %) Multiplier(V{all}) 97.4 % ( 99 %) Nodeslider(V{all}) 30.7 % ( 22 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 74.4 % ( 63 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.4 % ( 26 %) Dirichlet(Pi{all}) 26.8 % ( 22 %) Slider(Pi{all}) 78.8 % ( 50 %) Multiplier(Alpha{1,2}) 77.4 % ( 59 %) Multiplier(Alpha{3}) 17.4 % ( 26 %) Slider(Pinvar{all}) 98.7 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.1 % ( 72 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 86 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 22 %) Multiplier(V{all}) 97.4 % ( 98 %) Nodeslider(V{all}) 30.4 % ( 28 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 165793 0.82 0.67 3 | 166754 167617 0.84 4 | 166547 166662 166627 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166991 0.82 0.67 3 | 165852 166787 0.84 4 | 166316 166978 167076 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1472.99 | 1 | | | | 1 1 | |2 1 2 2 2 11 2 1 | | 11 1 1 1 2 1 1 1 | | 2 21 * 2 2 * 2 2 2 2 2 12 21 22 2 | | 1 2 21 1 1 2 2 1 2 * * *1 * 11 | | 2 2 112 1 211 11 1* 2* 1 1 22*| | * 2 2 21 1 1 2 11 1 2 2 | |1 2 2 1 2 12 2 | | 1 22 2 1 2 2 1 | | 2 | | 1 | | 1 | | 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1475.03 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1473.19 -1476.38 2 -1473.18 -1478.67 -------------------------------------- TOTAL -1473.18 -1478.07 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896183 0.090581 0.358954 1.463274 0.863699 1466.78 1483.89 1.000 r(A<->C){all} 0.166519 0.020179 0.000074 0.454364 0.125961 175.94 250.93 1.003 r(A<->G){all} 0.174946 0.022522 0.000051 0.487872 0.133970 156.26 164.44 1.002 r(A<->T){all} 0.162328 0.019128 0.000001 0.440624 0.121122 145.41 166.02 1.000 r(C<->G){all} 0.170744 0.020079 0.000147 0.456852 0.135239 199.02 286.70 1.001 r(C<->T){all} 0.159231 0.019069 0.000007 0.447086 0.122694 122.65 215.59 1.001 r(G<->T){all} 0.166233 0.020237 0.000002 0.451615 0.128933 166.81 190.42 1.000 pi(A){all} 0.208012 0.000153 0.184669 0.231759 0.207965 1214.49 1341.78 1.000 pi(C){all} 0.338176 0.000208 0.308408 0.364509 0.338049 1100.55 1167.54 1.000 pi(G){all} 0.291002 0.000188 0.266033 0.318653 0.291062 1285.12 1349.64 1.000 pi(T){all} 0.162809 0.000120 0.141047 0.183373 0.162642 1382.62 1388.82 1.002 alpha{1,2} 0.420505 0.230393 0.000131 1.372514 0.238354 1075.18 1288.09 1.000 alpha{3} 0.466506 0.250251 0.000727 1.455050 0.307653 1305.65 1341.51 1.000 pinvar{all} 0.998611 0.000003 0.995563 0.999999 0.999121 1116.18 1232.46 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- .*...* 8 -- ....** 9 -- ..*.*. 10 -- .**.** 11 -- ..**** 12 -- ..**.. 13 -- ...*.* 14 -- ...**. 15 -- .*.*** 16 -- .*..*. 17 -- .**... 18 -- ..*..* 19 -- .***.* 20 -- .*.*.. 21 -- .****. 22 -- ..***. 23 -- .*..** ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 463 0.154231 0.019315 0.140573 0.167888 2 8 454 0.151233 0.019786 0.137242 0.165223 2 9 450 0.149900 0.008480 0.143904 0.155896 2 10 447 0.148901 0.017430 0.136576 0.161226 2 11 443 0.147568 0.011777 0.139241 0.155896 2 12 440 0.146569 0.000942 0.145903 0.147235 2 13 440 0.146569 0.000942 0.145903 0.147235 2 14 433 0.144237 0.000471 0.143904 0.144570 2 15 431 0.143571 0.014604 0.133245 0.153897 2 16 417 0.138907 0.009893 0.131912 0.145903 2 17 415 0.138241 0.004240 0.135243 0.141239 2 18 413 0.137575 0.007066 0.132578 0.142572 2 19 395 0.131579 0.008951 0.125250 0.137908 2 20 392 0.130580 0.001884 0.129247 0.131912 2 21 382 0.127249 0.006595 0.122585 0.131912 2 22 300 0.099933 0.010364 0.092605 0.107262 2 23 292 0.097268 0.005653 0.093271 0.101266 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.094896 0.009176 0.000028 0.293214 0.063967 1.002 2 length{all}[2] 0.100820 0.009985 0.000013 0.300367 0.070406 1.000 2 length{all}[3] 0.100568 0.009670 0.000084 0.304214 0.071243 1.000 2 length{all}[4] 0.099777 0.010148 0.000002 0.305309 0.068817 1.000 2 length{all}[5] 0.100481 0.009939 0.000016 0.301968 0.069167 1.000 2 length{all}[6] 0.103763 0.010877 0.000058 0.314061 0.070526 1.000 2 length{all}[7] 0.093603 0.009196 0.000079 0.299634 0.061463 0.998 2 length{all}[8] 0.103841 0.009812 0.000265 0.280417 0.075316 0.999 2 length{all}[9] 0.093971 0.010593 0.000115 0.299280 0.063833 0.998 2 length{all}[10] 0.096674 0.008016 0.000124 0.280458 0.070564 0.998 2 length{all}[11] 0.097721 0.009940 0.000103 0.308915 0.066643 0.998 2 length{all}[12] 0.091592 0.008188 0.000192 0.296851 0.061173 0.998 2 length{all}[13] 0.098110 0.010581 0.000315 0.310147 0.069019 1.013 2 length{all}[14] 0.095418 0.008117 0.000280 0.258477 0.071810 0.998 2 length{all}[15] 0.103025 0.012020 0.000081 0.305850 0.068136 1.001 2 length{all}[16] 0.101128 0.010546 0.000042 0.308597 0.070102 0.998 2 length{all}[17] 0.098567 0.010782 0.000232 0.307113 0.067527 1.003 2 length{all}[18] 0.097189 0.009824 0.000012 0.293238 0.064881 0.999 2 length{all}[19] 0.100591 0.010341 0.000074 0.302216 0.063229 0.998 2 length{all}[20] 0.100627 0.010189 0.000126 0.312680 0.063495 0.998 2 length{all}[21] 0.099337 0.009278 0.000145 0.277399 0.072272 0.997 2 length{all}[22] 0.102222 0.012507 0.000066 0.347574 0.068337 1.006 2 length{all}[23] 0.093629 0.010794 0.000054 0.340384 0.056333 0.997 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008729 Maximum standard deviation of split frequencies = 0.019786 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.013 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /----------------------------------------------------------------- C1 (1) | |----------------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------------ C3 (3) + |---------------------------------------------------------------------- C4 (4) | |---------------------------------------------------------------------- C5 (5) | \----------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1092 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 56 patterns at 364 / 364 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 56 patterns at 364 / 364 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 54656 bytes for conP 4928 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.010504 0.041883 0.104780 0.093869 0.090017 0.093596 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1584.057217 Iterating by ming2 Initial: fx= 1584.057217 x= 0.01050 0.04188 0.10478 0.09387 0.09002 0.09360 0.30000 1.30000 1 h-m-p 0.0000 0.0000 867.2184 ++ 1561.982654 m 0.0000 13 | 1/8 2 h-m-p 0.0002 0.0024 129.3302 ++ 1545.015121 m 0.0024 24 | 2/8 3 h-m-p 0.0000 0.0000 1650.9735 ++ 1538.954434 m 0.0000 35 | 3/8 4 h-m-p 0.0000 0.0008 2578.1034 ++++ 1473.617796 m 0.0008 48 | 4/8 5 h-m-p 0.0000 0.0000 71908.0633 ++ 1456.583458 m 0.0000 59 | 5/8 6 h-m-p 0.0000 0.0000 12338.5209 ++ 1454.824329 m 0.0000 70 | 6/8 7 h-m-p 0.0000 0.0006 14441.1865 +++ 1429.383610 m 0.0006 82 | 7/8 8 h-m-p 1.6000 8.0000 0.0004 -------C 1429.383610 0 0.0000 100 | 7/8 9 h-m-p 1.6000 8.0000 0.0000 -----------Y 1429.383610 0 0.0000 123 Out.. lnL = -1429.383610 124 lfun, 124 eigenQcodon, 744 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.094534 0.086640 0.032860 0.108075 0.033060 0.026248 0.000100 0.606620 0.242473 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 12.736451 np = 9 lnL0 = -1559.662867 Iterating by ming2 Initial: fx= 1559.662867 x= 0.09453 0.08664 0.03286 0.10807 0.03306 0.02625 0.00011 0.60662 0.24247 1 h-m-p 0.0000 0.0000 801.5227 ++ 1558.667488 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0002 545.2557 +++ 1505.884799 m 0.0002 27 | 2/9 3 h-m-p 0.0000 0.0000 482.9905 ++ 1497.138721 m 0.0000 39 | 3/9 4 h-m-p 0.0000 0.0000 357.2426 ++ 1496.882458 m 0.0000 51 | 4/9 5 h-m-p 0.0000 0.0002 477.8931 +++ 1444.396335 m 0.0002 64 | 5/9 6 h-m-p 0.0001 0.0003 170.6603 ++ 1437.121449 m 0.0003 76 | 6/9 7 h-m-p 0.0000 0.0000 6359.2892 ++ 1436.453727 m 0.0000 88 | 7/9 8 h-m-p 0.0023 0.1948 4.2912 ------------.. | 7/9 9 h-m-p 0.0000 0.0001 351.6043 ++ 1429.383651 m 0.0001 122 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 ++ 1429.383651 m 8.0000 134 | 7/9 11 h-m-p 0.0160 8.0000 0.0000 +++++ 1429.383651 m 8.0000 150 | 7/9 12 h-m-p 0.0052 0.0259 0.0147 ------C 1429.383651 0 0.0000 170 | 7/9 13 h-m-p 0.0160 8.0000 0.0007 +++++ 1429.383651 m 8.0000 187 | 7/9 14 h-m-p 0.0092 1.6415 0.6089 ++++ 1429.383628 m 1.6415 203 | 8/9 15 h-m-p 1.6000 8.0000 0.0000 N 1429.383628 0 1.6000 217 | 8/9 16 h-m-p 0.0160 8.0000 0.0000 N 1429.383628 0 0.0160 230 Out.. lnL = -1429.383628 231 lfun, 693 eigenQcodon, 2772 P(t) Time used: 0:01 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.100411 0.081526 0.031920 0.034747 0.049010 0.081385 0.000100 1.553114 0.518873 0.218624 14.469843 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 4.199102 np = 11 lnL0 = -1509.688101 Iterating by ming2 Initial: fx= 1509.688101 x= 0.10041 0.08153 0.03192 0.03475 0.04901 0.08138 0.00011 1.55311 0.51887 0.21862 14.46984 1 h-m-p 0.0000 0.0000 340.7871 ++ 1509.470340 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0022 103.7602 ++++ 1487.991665 m 0.0022 32 | 2/11 3 h-m-p 0.0018 0.0100 43.3378 ++ 1471.722041 m 0.0100 46 | 3/11 4 h-m-p 0.0002 0.0011 446.8718 ++ 1466.503862 m 0.0011 60 | 4/11 5 h-m-p 0.0001 0.0003 2400.3724 ++ 1443.313903 m 0.0003 74 | 5/11 6 h-m-p 0.0001 0.0004 1834.1022 ++ 1438.419345 m 0.0004 88 | 6/11 7 h-m-p 0.0000 0.0000 586393.3964 ++ 1436.137233 m 0.0000 102 | 7/11 8 h-m-p 0.0063 0.0314 30.7339 ++ 1429.383620 m 0.0314 116 | 8/11 9 h-m-p 1.6000 8.0000 0.0000 ++ 1429.383620 m 8.0000 130 | 8/11 10 h-m-p 0.1050 8.0000 0.0030 ------C 1429.383620 0 0.0000 153 | 8/11 11 h-m-p 0.0160 8.0000 0.0000 ---Y 1429.383620 0 0.0001 173 | 8/11 12 h-m-p 0.0160 8.0000 0.0000 +++++ 1429.383620 m 8.0000 193 | 8/11 13 h-m-p 0.0160 8.0000 0.1051 +++++ 1429.383616 m 8.0000 213 | 8/11 14 h-m-p 1.0461 8.0000 0.8040 ++ 1429.383613 m 8.0000 230 | 8/11 15 h-m-p 1.6000 8.0000 0.0512 ++ 1429.383613 m 8.0000 247 | 8/11 16 h-m-p 0.0845 8.0000 4.8487 ++++ 1429.383612 m 8.0000 266 | 8/11 17 h-m-p 0.1741 0.8703 64.0091 ++ 1429.383612 m 0.8703 280 | 8/11 18 h-m-p 1.6000 8.0000 21.0646 --------Y 1429.383612 0 0.0000 302 | 8/11 19 h-m-p 0.1076 0.5381 0.0002 -Y 1429.383612 0 0.0067 317 | 8/11 20 h-m-p 0.0001 0.0070 0.0182 N 1429.383612 0 0.0000 334 | 8/11 21 h-m-p 0.0024 1.1762 0.0001 -C 1429.383612 0 0.0001 352 | 8/11 22 h-m-p 0.0160 8.0000 0.0000 Y 1429.383612 0 0.0040 369 Out.. lnL = -1429.383612 370 lfun, 1480 eigenQcodon, 6660 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1429.378268 S = -1429.375470 -0.001068 Calculating f(w|X), posterior probabilities of site classes. did 10 / 56 patterns 0:03 did 20 / 56 patterns 0:03 did 30 / 56 patterns 0:03 did 40 / 56 patterns 0:03 did 50 / 56 patterns 0:03 did 56 / 56 patterns 0:03 Time used: 0:03 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.103935 0.105123 0.071570 0.011027 0.045428 0.052643 0.000100 1.086750 1.960069 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 16.156182 np = 9 lnL0 = -1564.065048 Iterating by ming2 Initial: fx= 1564.065048 x= 0.10393 0.10512 0.07157 0.01103 0.04543 0.05264 0.00011 1.08675 1.96007 1 h-m-p 0.0000 0.0000 819.4317 ++ 1563.182518 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0120 62.4174 +++++ 1539.166721 m 0.0120 29 | 2/9 3 h-m-p 0.0001 0.0005 262.7566 ++ 1501.151500 m 0.0005 41 | 3/9 4 h-m-p 0.0003 0.0015 202.3211 ++ 1484.971280 m 0.0015 53 | 4/9 5 h-m-p 0.0000 0.0000 528.0769 ++ 1481.915069 m 0.0000 65 | 5/9 6 h-m-p 0.0005 0.0208 36.1080 -----------.. | 5/9 7 h-m-p 0.0000 0.0002 481.4799 +++ 1443.155004 m 0.0002 99 | 6/9 8 h-m-p 0.0035 0.0451 15.6645 ------------.. | 6/9 9 h-m-p 0.0000 0.0001 351.6101 ++ 1429.383652 m 0.0001 133 | 7/9 10 h-m-p 0.6877 8.0000 0.0000 ++ 1429.383652 m 8.0000 145 | 7/9 11 h-m-p 0.0378 8.0000 0.0017 -----Y 1429.383652 0 0.0000 164 | 7/9 12 h-m-p 0.0160 8.0000 0.0000 +++++ 1429.383652 m 8.0000 181 | 7/9 13 h-m-p 0.0027 1.3357 1.4177 +++++ 1429.383628 m 1.3357 198 | 8/9 14 h-m-p 1.6000 8.0000 0.0022 --N 1429.383628 0 0.0250 212 | 8/9 15 h-m-p 1.6000 8.0000 0.0000 N 1429.383628 0 1.6000 225 Out.. lnL = -1429.383628 226 lfun, 2486 eigenQcodon, 13560 P(t) Time used: 0:06 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.013481 0.108281 0.099289 0.022531 0.093504 0.028905 0.000100 0.900000 0.514301 1.484682 14.208304 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 5.615182 np = 11 lnL0 = -1500.776279 Iterating by ming2 Initial: fx= 1500.776279 x= 0.01348 0.10828 0.09929 0.02253 0.09350 0.02890 0.00011 0.90000 0.51430 1.48468 14.20830 1 h-m-p 0.0000 0.0000 315.5864 ++ 1500.602651 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0004 202.3867 +++ 1491.140103 m 0.0004 31 | 2/11 3 h-m-p 0.0000 0.0001 354.1419 ++ 1484.457040 m 0.0001 45 | 3/11 4 h-m-p 0.0008 0.0077 38.0479 ++ 1463.306353 m 0.0077 59 | 3/11 5 h-m-p 0.0000 0.0000 43.3550 h-m-p: 0.00000000e+00 0.00000000e+00 4.33549776e+01 1463.306353 .. | 3/11 6 h-m-p 0.0000 0.0000 961.8777 ++ 1442.979652 m 0.0000 84 | 4/11 7 h-m-p 0.0000 0.0000 616.0924 ++ 1430.575656 m 0.0000 98 | 5/11 8 h-m-p 0.0005 0.0025 9.8892 ++ 1429.931681 m 0.0025 112 | 6/11 9 h-m-p 0.0000 0.0000 1891.0120 ++ 1429.383633 m 0.0000 126 | 7/11 10 h-m-p 1.6000 8.0000 0.0003 ++ 1429.383633 m 8.0000 140 | 7/11 11 h-m-p 0.0161 1.0192 0.1566 +++ 1429.383626 m 1.0192 159 | 7/11 12 h-m-p 0.0000 0.0000 0.2134 h-m-p: 3.14123745e-17 1.57061872e-16 2.13438540e-01 1429.383626 .. | 7/11 13 h-m-p 0.0160 8.0000 0.0002 +++++ 1429.383626 m 8.0000 195 | 7/11 14 h-m-p 0.0271 8.0000 0.0502 +++++ 1429.383612 m 8.0000 216 | 7/11 15 h-m-p 1.6000 8.0000 0.0173 ++ 1429.383611 m 8.0000 234 | 7/11 16 h-m-p 0.3423 1.7117 0.2220 ++ 1429.383610 m 1.7117 252 | 8/11 17 h-m-p 0.5745 8.0000 0.0039 ++ 1429.383610 m 8.0000 270 | 8/11 18 h-m-p 0.0160 8.0000 22.8029 +++++ 1429.383609 m 8.0000 290 | 8/11 19 h-m-p 1.6000 8.0000 12.1094 ++ 1429.383609 m 8.0000 304 | 8/11 20 h-m-p 0.3189 1.5946 175.1755 ------C 1429.383609 0 0.0000 324 | 8/11 21 h-m-p 1.6000 8.0000 0.0003 -Y 1429.383609 0 0.0769 339 | 8/11 22 h-m-p 1.6000 8.0000 0.0000 Y 1429.383609 0 0.4000 356 Out.. lnL = -1429.383609 357 lfun, 4284 eigenQcodon, 23562 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1429.375132 S = -1429.375038 -0.000041 Calculating f(w|X), posterior probabilities of site classes. did 10 / 56 patterns 0:13 did 20 / 56 patterns 0:13 did 30 / 56 patterns 0:13 did 40 / 56 patterns 0:13 did 50 / 56 patterns 0:13 did 56 / 56 patterns 0:13 Time used: 0:13 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=364 NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI NC_002677_1_NP_302191_1_1063_fecB LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI ************************************************** NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA NC_002677_1_NP_302191_1_1063_fecB GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA ************************************************** NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL NC_002677_1_NP_302191_1_1063_fecB GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL ************************************************** NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG NC_002677_1_NP_302191_1_1063_fecB SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG ************************************************** NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NC_002677_1_NP_302191_1_1063_fecB AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN ************************************************** NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY NC_002677_1_NP_302191_1_1063_fecB NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY ************************************************** NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR NC_002677_1_NP_302191_1_1063_fecB VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR ************************************************** NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 GIVDDLRWINAPIN NC_002677_1_NP_302191_1_1063_fecB GIVDDLRWINAPIN NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 GIVDDLRWINAPIN NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 GIVDDLRWINAPIN NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 GIVDDLRWINAPIN NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 GIVDDLRWINAPIN **************
>NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT >NC_002677_1_NP_302191_1_1063_fecB TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT >NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT >NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT >NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT >NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 TTGCTACCCACCAGGGCCATCGTCACAGTAGCGGCGGCGGTAATAGCAGT GGGTAGCGGTTGCGGGTCGGGACAGCCCGGAAGCAAACCATCGTCACCCA CCCGGTCGCTGCTCACCCCCACCACCCAAATCGCGGGAGCCACTGTGATC GGAAATGAGCGCCGGCCGGACCAAGCCTGCGCACCAGAGCCAGCGACGGT TGATCCGGGGCCGCCGACACGGCCGGCCCACAACGTCGCGGGAGTCAAAC CAGATGTGGTCCAGGTGCCAGCTGAAGCACAGCGCATCGTGGTGCTGGCC GGTGACCAGCTCGATGCGCTGTGCGCGCTTGGCTTGCAATACCGAGTCGC CGCCGCCGCATTGCCGAACGACTCCGTAAGCCAGCCCTCCTACCTGGGCA AAACCGTGCATGGCCTGCCCGGCGTCGGTACCCGCAGGGCCCCGGACCTG AGCGCTATTGCGGCTACTCAACCAGATCTGATTCTGGGCTCTCAAGAGTT GACGCCGCAATTATATCCGCAGCTAACGGCGATCGCCCCGACGGTGTTCA CAGCAGCAGCACCGGGCGCAACGTGGGAAGACAACCTTCGTGGTGTCGGC GCTGCCACGGCGCGCAACGATGCCGTAGAAACACTGATCAACGGCTTCTC CCAACGGGCCACCCAGATCGGGGCCACTCATGACGCAACCCACTACCAAG TGTCCATCGTCCAGCTGACCACCAACACTATGCGGGTTTACGGATCCAAT AATTTCCCGGCCCGCGTGCTAACCGCGGTCGGAGTGGACCGGCCCACGTC ACAGCGATTCACCGACCAGGCTTATATTCAGAGCGGGATCACCGATGCTG ATCTCGCGAAGGAGCCGGATTTCTCCGCGGTTGACGCCGACATCATCTAC GTATCGTGCACCTCACCGGCAGTCGCAAAGCGCGCCGCCACCGTGCTCGA CAGCGGCCCGTGGCGCAAGCTGTCCGCCAATCATGACAACCGTATCTTCA TCGTCAACGATGAAGTGTGGCAGACCGGTGAGGGCTTGATCGCGGCCCGC GGCATCGTCGATGACCTGAGGTGGATCAACGCACCAATCAAT
>NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >NC_002677_1_NP_302191_1_1063_fecB LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN >NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 LLPTRAIVTVAAAVIAVGSGCGSGQPGSKPSSPTRSLLTPTTQIAGATVI GNERRPDQACAPEPATVDPGPPTRPAHNVAGVKPDVVQVPAEAQRIVVLA GDQLDALCALGLQYRVAAAALPNDSVSQPSYLGKTVHGLPGVGTRRAPDL SAIAATQPDLILGSQELTPQLYPQLTAIAPTVFTAAAPGATWEDNLRGVG AATARNDAVETLINGFSQRATQIGATHDATHYQVSIVQLTTNTMRVYGSN NFPARVLTAVGVDRPTSQRFTDQAYIQSGITDADLAKEPDFSAVDADIIY VSCTSPAVAKRAATVLDSGPWRKLSANHDNRIFIVNDEVWQTGEGLIAAR GIVDDLRWINAPIN
#NEXUS [ID: 0748271022] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 NC_002677_1_NP_302191_1_1063_fecB NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 ; end; begin trees; translate 1 NC_011896_1_WP_010908512_1_1840_MLBR_RS08735, 2 NC_002677_1_NP_302191_1_1063_fecB, 3 NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765, 4 NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025, 5 NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500, 6 NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06396698,2:0.07040644,3:0.07124335,4:0.06881663,5:0.06916723,6:0.07052562); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06396698,2:0.07040644,3:0.07124335,4:0.06881663,5:0.06916723,6:0.07052562); end;
Estimated marginal likelihoods for runs sampled in files "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1473.19 -1476.38 2 -1473.18 -1478.67 -------------------------------------- TOTAL -1473.18 -1478.07 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/fecB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896183 0.090581 0.358954 1.463274 0.863699 1466.78 1483.89 1.000 r(A<->C){all} 0.166519 0.020179 0.000074 0.454364 0.125961 175.94 250.93 1.003 r(A<->G){all} 0.174946 0.022522 0.000051 0.487872 0.133970 156.26 164.44 1.002 r(A<->T){all} 0.162328 0.019128 0.000001 0.440624 0.121122 145.41 166.02 1.000 r(C<->G){all} 0.170744 0.020079 0.000147 0.456852 0.135239 199.02 286.70 1.001 r(C<->T){all} 0.159231 0.019069 0.000007 0.447086 0.122694 122.65 215.59 1.001 r(G<->T){all} 0.166233 0.020237 0.000002 0.451615 0.128933 166.81 190.42 1.000 pi(A){all} 0.208012 0.000153 0.184669 0.231759 0.207965 1214.49 1341.78 1.000 pi(C){all} 0.338176 0.000208 0.308408 0.364509 0.338049 1100.55 1167.54 1.000 pi(G){all} 0.291002 0.000188 0.266033 0.318653 0.291062 1285.12 1349.64 1.000 pi(T){all} 0.162809 0.000120 0.141047 0.183373 0.162642 1382.62 1388.82 1.002 alpha{1,2} 0.420505 0.230393 0.000131 1.372514 0.238354 1075.18 1288.09 1.000 alpha{3} 0.466506 0.250251 0.000727 1.455050 0.307653 1305.65 1341.51 1.000 pinvar{all} 0.998611 0.000003 0.995563 0.999999 0.999121 1116.18 1232.46 1.001 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/fecB/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 364 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 0 0 0 0 0 0 TTC 6 6 6 6 6 6 | TCC 7 7 7 7 7 7 | TAC 5 5 5 5 5 5 | TGC 4 4 4 4 4 4 Leu TTA 1 1 1 1 1 1 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 5 5 5 5 5 5 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 2 2 2 2 2 2 CTC 4 4 4 4 4 4 | CCC 7 7 7 7 7 7 | CAC 2 2 2 2 2 2 | CGC 8 8 8 8 8 8 CTA 3 3 3 3 3 3 | CCA 7 7 7 7 7 7 | Gln CAA 8 8 8 8 8 8 | CGA 2 2 2 2 2 2 CTG 12 12 12 12 12 12 | CCG 15 15 15 15 15 15 | CAG 12 12 12 12 12 12 | CGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 3 3 3 3 3 3 | Thr ACT 4 4 4 4 4 4 | Asn AAT 5 5 5 5 5 5 | Ser AGT 0 0 0 0 0 0 ATC 17 17 17 17 17 17 | ACC 17 17 17 17 17 17 | AAC 9 9 9 9 9 9 | AGC 6 6 6 6 6 6 ATA 1 1 1 1 1 1 | ACA 4 4 4 4 4 4 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0 Met ATG 1 1 1 1 1 1 | ACG 7 7 7 7 7 7 | AAG 3 3 3 3 3 3 | AGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 3 3 3 3 3 3 | Ala GCT 6 6 6 6 6 6 | Asp GAT 10 10 10 10 10 10 | Gly GGT 6 6 6 6 6 6 GTC 12 12 12 12 12 12 | GCC 20 20 20 20 20 20 | GAC 13 13 13 13 13 13 | GGC 11 11 11 11 11 11 GTA 5 5 5 5 5 5 | GCA 12 12 12 12 12 12 | Glu GAA 4 4 4 4 4 4 | GGA 7 7 7 7 7 7 GTG 13 13 13 13 13 13 | GCG 15 15 15 15 15 15 | GAG 5 5 5 5 5 5 | GGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908512_1_1840_MLBR_RS08735 position 1: T:0.11538 C:0.25549 A:0.22802 G:0.40110 position 2: T:0.24176 C:0.35440 A:0.23077 G:0.17308 position 3: T:0.12912 C:0.40659 A:0.16484 G:0.29945 Average T:0.16209 C:0.33883 A:0.20788 G:0.29121 #2: NC_002677_1_NP_302191_1_1063_fecB position 1: T:0.11538 C:0.25549 A:0.22802 G:0.40110 position 2: T:0.24176 C:0.35440 A:0.23077 G:0.17308 position 3: T:0.12912 C:0.40659 A:0.16484 G:0.29945 Average T:0.16209 C:0.33883 A:0.20788 G:0.29121 #3: NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765 position 1: T:0.11538 C:0.25549 A:0.22802 G:0.40110 position 2: T:0.24176 C:0.35440 A:0.23077 G:0.17308 position 3: T:0.12912 C:0.40659 A:0.16484 G:0.29945 Average T:0.16209 C:0.33883 A:0.20788 G:0.29121 #4: NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025 position 1: T:0.11538 C:0.25549 A:0.22802 G:0.40110 position 2: T:0.24176 C:0.35440 A:0.23077 G:0.17308 position 3: T:0.12912 C:0.40659 A:0.16484 G:0.29945 Average T:0.16209 C:0.33883 A:0.20788 G:0.29121 #5: NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500 position 1: T:0.11538 C:0.25549 A:0.22802 G:0.40110 position 2: T:0.24176 C:0.35440 A:0.23077 G:0.17308 position 3: T:0.12912 C:0.40659 A:0.16484 G:0.29945 Average T:0.16209 C:0.33883 A:0.20788 G:0.29121 #6: NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750 position 1: T:0.11538 C:0.25549 A:0.22802 G:0.40110 position 2: T:0.24176 C:0.35440 A:0.23077 G:0.17308 position 3: T:0.12912 C:0.40659 A:0.16484 G:0.29945 Average T:0.16209 C:0.33883 A:0.20788 G:0.29121 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 0 TTC 36 | TCC 42 | TAC 30 | TGC 24 Leu L TTA 6 | TCA 18 | *** * TAA 0 | *** * TGA 0 TTG 30 | TCG 24 | TAG 0 | Trp W TGG 24 ------------------------------------------------------------------------------ Leu L CTT 12 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 12 CTC 24 | CCC 42 | CAC 12 | CGC 48 CTA 18 | CCA 42 | Gln Q CAA 48 | CGA 12 CTG 72 | CCG 90 | CAG 72 | CGG 36 ------------------------------------------------------------------------------ Ile I ATT 18 | Thr T ACT 24 | Asn N AAT 30 | Ser S AGT 0 ATC 102 | ACC 102 | AAC 54 | AGC 36 ATA 6 | ACA 24 | Lys K AAA 18 | Arg R AGA 0 Met M ATG 6 | ACG 42 | AAG 18 | AGG 18 ------------------------------------------------------------------------------ Val V GTT 18 | Ala A GCT 36 | Asp D GAT 60 | Gly G GGT 36 GTC 72 | GCC 120 | GAC 78 | GGC 66 GTA 30 | GCA 72 | Glu E GAA 24 | GGA 42 GTG 78 | GCG 90 | GAG 30 | GGG 24 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.11538 C:0.25549 A:0.22802 G:0.40110 position 2: T:0.24176 C:0.35440 A:0.23077 G:0.17308 position 3: T:0.12912 C:0.40659 A:0.16484 G:0.29945 Average T:0.16209 C:0.33883 A:0.20788 G:0.29121 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1429.383610 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 14.208304 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908512_1_1840_MLBR_RS08735: 0.000004, NC_002677_1_NP_302191_1_1063_fecB: 0.000004, NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765: 0.000004, NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025: 0.000004, NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500: 0.000004, NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 omega (dN/dS) = 14.20830 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 818.1 273.9 14.2083 0.0000 0.0000 0.0 0.0 7..2 0.000 818.1 273.9 14.2083 0.0000 0.0000 0.0 0.0 7..3 0.000 818.1 273.9 14.2083 0.0000 0.0000 0.0 0.0 7..4 0.000 818.1 273.9 14.2083 0.0000 0.0000 0.0 0.0 7..5 0.000 818.1 273.9 14.2083 0.0000 0.0000 0.0 0.0 7..6 0.000 818.1 273.9 14.2083 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1429.383628 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.818095 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908512_1_1840_MLBR_RS08735: 0.000004, NC_002677_1_NP_302191_1_1063_fecB: 0.000004, NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765: 0.000004, NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025: 0.000004, NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500: 0.000004, NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.81810 0.18190 w: 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 Time used: 0:01 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1429.383612 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.794564 0.000001 31.060143 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908512_1_1840_MLBR_RS08735: 0.000004, NC_002677_1_NP_302191_1_1063_fecB: 0.000004, NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765: 0.000004, NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025: 0.000004, NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500: 0.000004, NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.00000 0.79456 0.20544 w: 0.00000 1.00000 31.06014 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 818.1 273.9 7.1754 0.0000 0.0000 0.0 0.0 7..2 0.000 818.1 273.9 7.1754 0.0000 0.0000 0.0 0.0 7..3 0.000 818.1 273.9 7.1754 0.0000 0.0000 0.0 0.0 7..4 0.000 818.1 273.9 7.1754 0.0000 0.0000 0.0 0.0 7..5 0.000 818.1 273.9 7.1754 0.0000 0.0000 0.0 0.0 7..6 0.000 818.1 273.9 7.1754 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908512_1_1840_MLBR_RS08735) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908512_1_1840_MLBR_RS08735) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:03 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1429.383628 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.793432 0.005000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908512_1_1840_MLBR_RS08735: 0.000004, NC_002677_1_NP_302191_1_1063_fecB: 0.000004, NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765: 0.000004, NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025: 0.000004, NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500: 0.000004, NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.79343 q = 0.00500 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.99995 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 818.1 273.9 1.0000 0.0000 0.0000 0.0 0.0 Time used: 0:06 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1429.383609 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 11.578015 1.652176 293.346568 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908512_1_1840_MLBR_RS08735: 0.000004, NC_002677_1_NP_302191_1_1063_fecB: 0.000004, NZ_LVXE01000029_1_WP_010908512_1_1185_A3216_RS08765: 0.000004, NZ_LYPH01000032_1_WP_010908512_1_1251_A8144_RS06025: 0.000004, NZ_CP029543_1_WP_010908512_1_1866_DIJ64_RS09500: 0.000004, NZ_AP014567_1_WP_010908512_1_1916_JK2ML_RS09750: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.00001 p = 11.57801 q = 1.65218 (p1 = 0.99999) w = 293.34657 MLEs of dN/dS (w) for site classes (K=11) p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999 w: 0.70427 0.78493 0.82757 0.85822 0.88296 0.90430 0.92363 0.94195 0.96034 0.98121 293.34657 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 818.1 273.9 293.3436 0.0000 0.0000 0.0 0.0 7..2 0.000 818.1 273.9 293.3436 0.0000 0.0000 0.0 0.0 7..3 0.000 818.1 273.9 293.3436 0.0000 0.0000 0.0 0.0 7..4 0.000 818.1 273.9 293.3436 0.0000 0.0000 0.0 0.0 7..5 0.000 818.1 273.9 293.3436 0.0000 0.0000 0.0 0.0 7..6 0.000 818.1 273.9 293.3436 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908512_1_1840_MLBR_RS08735) Pr(w>1) post mean +- SE for w 1 L 1.000** 293.344 2 L 1.000** 293.344 3 P 1.000** 293.344 4 T 1.000** 293.344 5 R 1.000** 293.344 6 A 1.000** 293.344 7 I 1.000** 293.344 8 V 1.000** 293.344 9 T 1.000** 293.344 10 V 1.000** 293.344 11 A 1.000** 293.344 12 A 1.000** 293.344 13 A 1.000** 293.344 14 V 1.000** 293.344 15 I 1.000** 293.344 16 A 1.000** 293.344 17 V 1.000** 293.344 18 G 1.000** 293.344 19 S 1.000** 293.344 20 G 1.000** 293.344 21 C 1.000** 293.344 22 G 1.000** 293.344 23 S 1.000** 293.344 24 G 1.000** 293.344 25 Q 1.000** 293.344 26 P 1.000** 293.344 27 G 1.000** 293.344 28 S 1.000** 293.344 29 K 1.000** 293.344 30 P 1.000** 293.344 31 S 1.000** 293.344 32 S 1.000** 293.344 33 P 1.000** 293.344 34 T 1.000** 293.344 35 R 1.000** 293.344 36 S 1.000** 293.344 37 L 1.000** 293.344 38 L 1.000** 293.344 39 T 1.000** 293.344 40 P 1.000** 293.344 41 T 1.000** 293.344 42 T 1.000** 293.344 43 Q 1.000** 293.344 44 I 1.000** 293.344 45 A 1.000** 293.344 46 G 1.000** 293.344 47 A 1.000** 293.344 48 T 1.000** 293.344 49 V 1.000** 293.344 50 I 1.000** 293.344 51 G 1.000** 293.344 52 N 1.000** 293.344 53 E 1.000** 293.344 54 R 1.000** 293.344 55 R 1.000** 293.344 56 P 1.000** 293.344 57 D 1.000** 293.344 58 Q 1.000** 293.344 59 A 1.000** 293.344 60 C 1.000** 293.344 61 A 1.000** 293.344 62 P 1.000** 293.344 63 E 1.000** 293.344 64 P 1.000** 293.344 65 A 1.000** 293.344 66 T 1.000** 293.344 67 V 1.000** 293.344 68 D 1.000** 293.344 69 P 1.000** 293.344 70 G 1.000** 293.344 71 P 1.000** 293.344 72 P 1.000** 293.344 73 T 1.000** 293.344 74 R 1.000** 293.344 75 P 1.000** 293.344 76 A 1.000** 293.344 77 H 1.000** 293.344 78 N 1.000** 293.344 79 V 1.000** 293.344 80 A 1.000** 293.344 81 G 1.000** 293.344 82 V 1.000** 293.344 83 K 1.000** 293.344 84 P 1.000** 293.344 85 D 1.000** 293.344 86 V 1.000** 293.344 87 V 1.000** 293.344 88 Q 1.000** 293.344 89 V 1.000** 293.344 90 P 1.000** 293.344 91 A 1.000** 293.344 92 E 1.000** 293.344 93 A 1.000** 293.344 94 Q 1.000** 293.344 95 R 1.000** 293.344 96 I 1.000** 293.344 97 V 1.000** 293.344 98 V 1.000** 293.344 99 L 1.000** 293.344 100 A 1.000** 293.344 101 G 1.000** 293.344 102 D 1.000** 293.344 103 Q 1.000** 293.344 104 L 1.000** 293.344 105 D 1.000** 293.344 106 A 1.000** 293.344 107 L 1.000** 293.344 108 C 1.000** 293.344 109 A 1.000** 293.344 110 L 1.000** 293.344 111 G 1.000** 293.344 112 L 1.000** 293.344 113 Q 1.000** 293.344 114 Y 1.000** 293.344 115 R 1.000** 293.344 116 V 1.000** 293.344 117 A 1.000** 293.344 118 A 1.000** 293.344 119 A 1.000** 293.344 120 A 1.000** 293.344 121 L 1.000** 293.344 122 P 1.000** 293.344 123 N 1.000** 293.344 124 D 1.000** 293.344 125 S 1.000** 293.344 126 V 1.000** 293.344 127 S 1.000** 293.344 128 Q 1.000** 293.344 129 P 1.000** 293.344 130 S 1.000** 293.344 131 Y 1.000** 293.344 132 L 1.000** 293.344 133 G 1.000** 293.344 134 K 1.000** 293.344 135 T 1.000** 293.344 136 V 1.000** 293.344 137 H 1.000** 293.344 138 G 1.000** 293.344 139 L 1.000** 293.344 140 P 1.000** 293.344 141 G 1.000** 293.344 142 V 1.000** 293.344 143 G 1.000** 293.344 144 T 1.000** 293.344 145 R 1.000** 293.344 146 R 1.000** 293.344 147 A 1.000** 293.344 148 P 1.000** 293.344 149 D 1.000** 293.344 150 L 1.000** 293.344 151 S 1.000** 293.344 152 A 1.000** 293.344 153 I 1.000** 293.344 154 A 1.000** 293.344 155 A 1.000** 293.344 156 T 1.000** 293.344 157 Q 1.000** 293.344 158 P 1.000** 293.344 159 D 1.000** 293.344 160 L 1.000** 293.344 161 I 1.000** 293.344 162 L 1.000** 293.344 163 G 1.000** 293.344 164 S 1.000** 293.344 165 Q 1.000** 293.344 166 E 1.000** 293.344 167 L 1.000** 293.344 168 T 1.000** 293.344 169 P 1.000** 293.344 170 Q 1.000** 293.344 171 L 1.000** 293.344 172 Y 1.000** 293.344 173 P 1.000** 293.344 174 Q 1.000** 293.344 175 L 1.000** 293.344 176 T 1.000** 293.344 177 A 1.000** 293.344 178 I 1.000** 293.344 179 A 1.000** 293.344 180 P 1.000** 293.344 181 T 1.000** 293.344 182 V 1.000** 293.344 183 F 1.000** 293.344 184 T 1.000** 293.344 185 A 1.000** 293.344 186 A 1.000** 293.344 187 A 1.000** 293.344 188 P 1.000** 293.344 189 G 1.000** 293.344 190 A 1.000** 293.344 191 T 1.000** 293.344 192 W 1.000** 293.344 193 E 1.000** 293.344 194 D 1.000** 293.344 195 N 1.000** 293.344 196 L 1.000** 293.344 197 R 1.000** 293.344 198 G 1.000** 293.344 199 V 1.000** 293.344 200 G 1.000** 293.344 201 A 1.000** 293.344 202 A 1.000** 293.344 203 T 1.000** 293.344 204 A 1.000** 293.344 205 R 1.000** 293.344 206 N 1.000** 293.344 207 D 1.000** 293.344 208 A 1.000** 293.344 209 V 1.000** 293.344 210 E 1.000** 293.344 211 T 1.000** 293.344 212 L 1.000** 293.344 213 I 1.000** 293.344 214 N 1.000** 293.344 215 G 1.000** 293.344 216 F 1.000** 293.344 217 S 1.000** 293.344 218 Q 1.000** 293.344 219 R 1.000** 293.344 220 A 1.000** 293.344 221 T 1.000** 293.344 222 Q 1.000** 293.344 223 I 1.000** 293.344 224 G 1.000** 293.344 225 A 1.000** 293.344 226 T 1.000** 293.344 227 H 1.000** 293.344 228 D 1.000** 293.344 229 A 1.000** 293.344 230 T 1.000** 293.344 231 H 1.000** 293.344 232 Y 1.000** 293.344 233 Q 1.000** 293.344 234 V 1.000** 293.344 235 S 1.000** 293.344 236 I 1.000** 293.344 237 V 1.000** 293.344 238 Q 1.000** 293.344 239 L 1.000** 293.344 240 T 1.000** 293.344 241 T 1.000** 293.344 242 N 1.000** 293.344 243 T 1.000** 293.344 244 M 1.000** 293.344 245 R 1.000** 293.344 246 V 1.000** 293.344 247 Y 1.000** 293.344 248 G 1.000** 293.344 249 S 1.000** 293.344 250 N 1.000** 293.344 251 N 1.000** 293.344 252 F 1.000** 293.344 253 P 1.000** 293.344 254 A 1.000** 293.344 255 R 1.000** 293.344 256 V 1.000** 293.344 257 L 1.000** 293.344 258 T 1.000** 293.344 259 A 1.000** 293.344 260 V 1.000** 293.344 261 G 1.000** 293.344 262 V 1.000** 293.344 263 D 1.000** 293.344 264 R 1.000** 293.344 265 P 1.000** 293.344 266 T 1.000** 293.344 267 S 1.000** 293.344 268 Q 1.000** 293.344 269 R 1.000** 293.344 270 F 1.000** 293.344 271 T 1.000** 293.344 272 D 1.000** 293.344 273 Q 1.000** 293.344 274 A 1.000** 293.344 275 Y 1.000** 293.344 276 I 1.000** 293.344 277 Q 1.000** 293.344 278 S 1.000** 293.344 279 G 1.000** 293.344 280 I 1.000** 293.344 281 T 1.000** 293.344 282 D 1.000** 293.344 283 A 1.000** 293.344 284 D 1.000** 293.344 285 L 1.000** 293.344 286 A 1.000** 293.344 287 K 1.000** 293.344 288 E 1.000** 293.344 289 P 1.000** 293.344 290 D 1.000** 293.344 291 F 1.000** 293.344 292 S 1.000** 293.344 293 A 1.000** 293.344 294 V 1.000** 293.344 295 D 1.000** 293.344 296 A 1.000** 293.344 297 D 1.000** 293.344 298 I 1.000** 293.344 299 I 1.000** 293.344 300 Y 1.000** 293.344 301 V 1.000** 293.344 302 S 1.000** 293.344 303 C 1.000** 293.344 304 T 1.000** 293.344 305 S 1.000** 293.344 306 P 1.000** 293.344 307 A 1.000** 293.344 308 V 1.000** 293.344 309 A 1.000** 293.344 310 K 1.000** 293.344 311 R 1.000** 293.344 312 A 1.000** 293.344 313 A 1.000** 293.344 314 T 1.000** 293.344 315 V 1.000** 293.344 316 L 1.000** 293.344 317 D 1.000** 293.344 318 S 1.000** 293.344 319 G 1.000** 293.344 320 P 1.000** 293.344 321 W 1.000** 293.344 322 R 1.000** 293.344 323 K 1.000** 293.344 324 L 1.000** 293.344 325 S 1.000** 293.344 326 A 1.000** 293.344 327 N 1.000** 293.344 328 H 1.000** 293.344 329 D 1.000** 293.344 330 N 1.000** 293.344 331 R 1.000** 293.344 332 I 1.000** 293.344 333 F 1.000** 293.344 334 I 1.000** 293.344 335 V 1.000** 293.344 336 N 1.000** 293.344 337 D 1.000** 293.344 338 E 1.000** 293.344 339 V 1.000** 293.344 340 W 1.000** 293.344 341 Q 1.000** 293.344 342 T 1.000** 293.344 343 G 1.000** 293.344 344 E 1.000** 293.344 345 G 1.000** 293.344 346 L 1.000** 293.344 347 I 1.000** 293.344 348 A 1.000** 293.344 349 A 1.000** 293.344 350 R 1.000** 293.344 351 G 1.000** 293.344 352 I 1.000** 293.344 353 V 1.000** 293.344 354 D 1.000** 293.344 355 D 1.000** 293.344 356 L 1.000** 293.344 357 R 1.000** 293.344 358 W 1.000** 293.344 359 I 1.000** 293.344 360 N 1.000** 293.344 361 A 1.000** 293.344 362 P 1.000** 293.344 363 I 1.000** 293.344 364 N 1.000** 293.344 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908512_1_1840_MLBR_RS08735) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 Time used: 0:13
Model 1: NearlyNeutral -1429.383628 Model 2: PositiveSelection -1429.383612 Model 0: one-ratio -1429.38361 Model 7: beta -1429.383628 Model 8: beta&w>1 -1429.383609 Model 0 vs 1 3.599999990910874E-5 Model 2 vs 1 3.199999991920777E-5 Model 8 vs 7 3.80000001314329E-5